MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000208 -- new
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220618\20220618002634800212^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\111222_HL11.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220618\20220618002634800212^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\111222_HL11.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Acetyl (Protein N-term),Label:13C(6) (K),Label:13C(6)15N(4) (R),Oxidation (M)
MTD	software[1]-setting	maxMissedCleavages=1
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=40
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Label:13C(6) (K),Label:13C(6)15N(4) (R),Acetyl (Protein N-term)
MTD	software[2]-setting	TOL(-)=20
MTD	software[2]-setting	TOL(+)=20
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=1000
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=1
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Acetyl (Protein N-term),Label:13C(6) (K),Label:13C(6)15N(4) (R),Oxidation (M)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=1
MTD	software[3]-setting	peptide_mass_tolerance=20
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:1, Acetyl,]
MTD	variable_mod[1]-site	N-term
MTD	variable_mod[1]-position	Protein N-term
MTD	variable_mod[2]	[UNIMOD, UNIMOD:188, Label:13C(6),]
MTD	variable_mod[2]-site	K
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:267, Label:13C(6)15N(4),]
MTD	variable_mod[3]-site	R
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[4]-site	M
MTD	variable_mod[4]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|Q16555|DPYL2_HUMAN	Dihydropyrimidinase-related protein 2 OS=Homo sapiens OX=9606 GN=DPYSL2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	null	552-UNIMOD:267,439-UNIMOD:4,440-UNIMOD:267	0.07	51.0	8	2	0
PRT	sp|Q14839|CHD4_HUMAN	Chromodomain-helicase-DNA-binding protein 4 OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	null	1468-UNIMOD:4,1484-UNIMOD:267,817-UNIMOD:267,829-UNIMOD:267	0.02	49.0	5	2	0
PRT	sp|P31939-2|PUR9_HUMAN	Isoform 2 of Bifunctional purine biosynthesis protein PURH OS=Homo sapiens OX=9606 GN=ATIC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	null	284-UNIMOD:188	0.03	49.0	2	1	0
PRT	sp|P14618-3|KPYM_HUMAN	Isoform 3 of Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	192-UNIMOD:188,209-UNIMOD:188,311-UNIMOD:4	0.07	47.0	4	2	1
PRT	sp|Q14195|DPYL3_HUMAN	Dihydropyrimidinase-related protein 3 OS=Homo sapiens OX=9606 GN=DPYSL3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	550-UNIMOD:267	0.07	47.0	4	2	0
PRT	sp|P07355-2|ANXA2_HUMAN	Isoform 2 of Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	197-UNIMOD:267,214-UNIMOD:267,342-UNIMOD:188,347-UNIMOD:188,67-UNIMOD:188,81-UNIMOD:267,151-UNIMOD:4	0.20	47.0	9	5	3
PRT	sp|P52209-2|6PGD_HUMAN	Isoform 2 of 6-phosphogluconate dehydrogenase, decarboxylating OS=Homo sapiens OX=9606 GN=PGD	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.04	46.0	1	1	1
PRT	sp|P22234|PUR6_HUMAN	Multifunctional protein ADE2 OS=Homo sapiens OX=9606 GN=PAICS PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	81-UNIMOD:4,91-UNIMOD:4,100-UNIMOD:4,313-UNIMOD:188,331-UNIMOD:267	0.10	46.0	4	2	1
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	46.0	null	28-UNIMOD:188,42-UNIMOD:188,173-UNIMOD:267,258-UNIMOD:267	0.16	46.0	9	3	0
PRT	sp|P21796|VDAC1_HUMAN	Voltage-dependent anion-selective channel protein 1 OS=Homo sapiens OX=9606 GN=VDAC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	201-UNIMOD:188,218-UNIMOD:267	0.12	46.0	4	2	1
PRT	sp|Q9P258|RCC2_HUMAN	Protein RCC2 OS=Homo sapiens OX=9606 GN=RCC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	46.0	null	230-UNIMOD:188,209-UNIMOD:4	0.07	46.0	6	2	1
PRT	sp|Q99959|PKP2_HUMAN	Plakophilin-2 OS=Homo sapiens OX=9606 GN=PKP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46.0	null	336-UNIMOD:267	0.02	46.0	1	1	0
PRT	sp|Q99959-2|PKP2_HUMAN	Isoform 1 of Plakophilin-2 OS=Homo sapiens OX=9606 GN=PKP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.03	45.0	1	1	0
PRT	sp|P09525-2|ANXA4_HUMAN	Isoform 2 of Annexin A4 OS=Homo sapiens OX=9606 GN=ANXA4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	26-UNIMOD:4,18-UNIMOD:188,34-UNIMOD:267	0.08	45.0	3	1	0
PRT	sp|P24534|EF1B_HUMAN	Elongation factor 1-beta OS=Homo sapiens OX=9606 GN=EEF1B2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	7-UNIMOD:188,22-UNIMOD:188	0.10	45.0	3	1	0
PRT	sp|P22694-8|KAPCB_HUMAN	Isoform 8 of cAMP-dependent protein kinase catalytic subunit beta OS=Homo sapiens OX=9606 GN=PRKACB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.07	45.0	2	1	0
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	45.0	null	1828-UNIMOD:4,1841-UNIMOD:267,1828-UNIMOD:385,343-UNIMOD:188,329-UNIMOD:35,1159-UNIMOD:35,1171-UNIMOD:267,1180-UNIMOD:267,241-UNIMOD:267,257-UNIMOD:188	0.06	45.0	20	8	4
PRT	sp|P60174|TPIS_HUMAN	Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	164-UNIMOD:4,168-UNIMOD:188,56-UNIMOD:188,70-UNIMOD:188,150-UNIMOD:188	0.23	45.0	8	4	1
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	785-UNIMOD:188,781-UNIMOD:35	0.02	44.0	4	1	0
PRT	sp|P51858-2|HDGF_HUMAN	Isoform 2 of Hepatoma-derived growth factor OS=Homo sapiens OX=9606 GN=HDGF	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	73-UNIMOD:188,89-UNIMOD:188	0.13	44.0	4	2	1
PRT	sp|Q16531|DDB1_HUMAN	DNA damage-binding protein 1 OS=Homo sapiens OX=9606 GN=DDB1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	725-UNIMOD:4,732-UNIMOD:4,723-UNIMOD:188,739-UNIMOD:267	0.03	44.0	5	2	1
PRT	sp|Q13310-2|PABP4_HUMAN	Isoform 2 of Polyadenylate-binding protein 4 OS=Homo sapiens OX=9606 GN=PABPC4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	339-UNIMOD:4,333-UNIMOD:188,348-UNIMOD:188,50-UNIMOD:267,67-UNIMOD:267,95-UNIMOD:188,104-UNIMOD:188	0.10	44.0	7	4	1
PRT	sp|P30101|PDIA3_HUMAN	Protein disulfide-isomerase A3 OS=Homo sapiens OX=9606 GN=PDIA3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	329-UNIMOD:267,62-UNIMOD:267,73-UNIMOD:267	0.08	44.0	6	2	0
PRT	sp|O43660-2|PLRG1_HUMAN	Isoform 2 of Pleiotropic regulator 1 OS=Homo sapiens OX=9606 GN=PLRG1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	459-UNIMOD:4	0.06	44.0	1	1	1
PRT	sp|P54920|SNAA_HUMAN	Alpha-soluble NSF attachment protein OS=Homo sapiens OX=9606 GN=NAPA PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	153-UNIMOD:188,163-UNIMOD:188,212-UNIMOD:4,215-UNIMOD:4,222-UNIMOD:188	0.13	43.0	5	2	0
PRT	sp|Q9P1Y5|CAMP3_HUMAN	Calmodulin-regulated spectrin-associated protein 3 OS=Homo sapiens OX=9606 GN=CAMSAP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.02	43.0	1	1	1
PRT	sp|P29144|TPP2_HUMAN	Tripeptidyl-peptidase 2 OS=Homo sapiens OX=9606 GN=TPP2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	43.0	null	710-UNIMOD:4,715-UNIMOD:188,728-UNIMOD:188,902-UNIMOD:267	0.02	43.0	5	2	1
PRT	sp|Q14697|GANAB_HUMAN	Neutral alpha-glucosidase AB OS=Homo sapiens OX=9606 GN=GANAB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	627-UNIMOD:188,929-UNIMOD:267	0.07	43.0	10	4	2
PRT	sp|Q15029-2|U5S1_HUMAN	Isoform 2 of 116 kDa U5 small nuclear ribonucleoprotein component OS=Homo sapiens OX=9606 GN=EFTUD2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	837-UNIMOD:188,109-UNIMOD:4,113-UNIMOD:4	0.04	43.0	5	2	0
PRT	sp|O75694-2|NU155_HUMAN	Isoform 2 of Nuclear pore complex protein Nup155 OS=Homo sapiens OX=9606 GN=NUP155	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	478-UNIMOD:267	0.01	43.0	4	1	0
PRT	sp|Q9Y5P6|GMPPB_HUMAN	Mannose-1-phosphate guanyltransferase beta OS=Homo sapiens OX=9606 GN=GMPPB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	43.0	null	94-UNIMOD:267	0.06	43.0	2	1	0
PRT	sp|Q9UKV3-5|ACINU_HUMAN	Isoform 4 of Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens OX=9606 GN=ACIN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	733-UNIMOD:4	0.02	43.0	2	1	0
PRT	sp|Q00839-2|HNRPU_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	478-UNIMOD:4,476-UNIMOD:188,491-UNIMOD:188,482-UNIMOD:35	0.07	43.0	9	3	1
PRT	sp|P84098|RL19_HUMAN	60S ribosomal protein L19 OS=Homo sapiens OX=9606 GN=RPL19 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	21-UNIMOD:188,38-UNIMOD:267	0.10	43.0	2	1	0
PRT	sp|Q99613-2|EIF3C_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit C OS=Homo sapiens OX=9606 GN=EIF3C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	278-UNIMOD:267,293-UNIMOD:267,742-UNIMOD:4	0.04	43.0	4	3	2
PRT	sp|Q9Y653-5|AGRG1_HUMAN	Isoform 5 of Adhesion G-protein coupled receptor G1 OS=Homo sapiens OX=9606 GN=ADGRG1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.03	43.0	2	1	0
PRT	sp|O95630-2|STABP_HUMAN	Isoform 2 of STAM-binding protein OS=Homo sapiens OX=9606 GN=STAMBP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.06	43.0	1	1	1
PRT	sp|Q9UDY2-5|ZO2_HUMAN	Isoform A3 of Tight junction protein ZO-2 OS=Homo sapiens OX=9606 GN=TJP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.02	43.0	1	1	1
PRT	sp|Q6PJT7-10|ZC3HE_HUMAN	Isoform 10 of Zinc finger CCCH domain-containing protein 14 OS=Homo sapiens OX=9606 GN=ZC3H14	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	194-UNIMOD:267	0.06	43.0	2	2	2
PRT	sp|P36915|GNL1_HUMAN	Guanine nucleotide-binding protein-like 1 OS=Homo sapiens OX=9606 GN=GNL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	365-UNIMOD:4,357-UNIMOD:188,373-UNIMOD:188	0.03	43.0	3	1	0
PRT	sp|Q71U36|TBA1A_HUMAN	Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0	null	85-UNIMOD:28,96-UNIMOD:188,105-UNIMOD:267	0.05	43.0	10	1	0
PRT	sp|Q15365|PCBP1_HUMAN	Poly(rC)-binding protein 1 OS=Homo sapiens OX=9606 GN=PCBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0	null	244-UNIMOD:28,268-UNIMOD:188,250-UNIMOD:35	0.07	43.0	4	1	0
PRT	sp|Q16762|THTR_HUMAN	Thiosulfate sulfurtransferase OS=Homo sapiens OX=9606 GN=TST PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	206-UNIMOD:267	0.07	42.0	3	1	0
PRT	sp|P19784|CSK22_HUMAN	Casein kinase II subunit alpha' OS=Homo sapiens OX=9606 GN=CSNK2A2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.05	42.0	2	1	0
PRT	sp|P35580|MYH10_HUMAN	Myosin-10 OS=Homo sapiens OX=9606 GN=MYH10 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.02	42.0	3	3	3
PRT	sp|P08195-2|4F2_HUMAN	Isoform 2 of 4F2 cell-surface antigen heavy chain OS=Homo sapiens OX=9606 GN=SLC3A2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	144-UNIMOD:188,65-UNIMOD:188,70-UNIMOD:188	0.06	42.0	4	2	0
PRT	sp|Q00610-2|CLH1_HUMAN	Isoform 2 of Clathrin heavy chain 1 OS=Homo sapiens OX=9606 GN=CLTC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	367-UNIMOD:188,382-UNIMOD:188,151-UNIMOD:4,157-UNIMOD:267,112-UNIMOD:188,1254-UNIMOD:188,1257-UNIMOD:4,1260-UNIMOD:4,1264-UNIMOD:188	0.06	42.0	12	6	1
PRT	sp|Q9Y490|TLN1_HUMAN	Talin-1 OS=Homo sapiens OX=9606 GN=TLN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	1766-UNIMOD:188,131-UNIMOD:267	0.02	42.0	5	3	1
PRT	sp|P11908|PRPS2_HUMAN	Ribose-phosphate pyrophosphokinase 2 OS=Homo sapiens OX=9606 GN=PRPS2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	18-UNIMOD:267	0.06	42.0	4	1	0
PRT	sp|Q12849-5|GRSF1_HUMAN	Isoform 2 of G-rich sequence factor 1 OS=Homo sapiens OX=9606 GN=GRSF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.05	42.0	1	1	1
PRT	sp|P25705-2|ATPA_HUMAN	Isoform 2 of ATP synthase subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	83-UNIMOD:267,99-UNIMOD:267,266-UNIMOD:188	0.08	42.0	7	3	1
PRT	sp|Q14141-3|SEPT6_HUMAN	Isoform IV of Septin-6 OS=Homo sapiens OX=9606 GN=SEPTIN6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	35-UNIMOD:188	0.08	42.0	2	1	0
PRT	sp|Q9BWD1|THIC_HUMAN	Acetyl-CoA acetyltransferase, cytosolic OS=Homo sapiens OX=9606 GN=ACAT2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	360-UNIMOD:4,361-UNIMOD:267,233-UNIMOD:188	0.08	42.0	3	2	1
PRT	sp|Q14676-4|MDC1_HUMAN	Isoform 4 of Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens OX=9606 GN=MDC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	642-UNIMOD:267	0.02	41.0	2	1	0
PRT	sp|O15143|ARC1B_HUMAN	Actin-related protein 2/3 complex subunit 1B OS=Homo sapiens OX=9606 GN=ARPC1B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	66-UNIMOD:267	0.09	41.0	3	2	1
PRT	sp|Q9Y606-2|TRUA_HUMAN	Isoform 2 of tRNA pseudouridine synthase A OS=Homo sapiens OX=9606 GN=PUS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.05	41.0	2	1	0
PRT	sp|P21333-2|FLNA_HUMAN	Isoform 2 of Filamin-A OS=Homo sapiens OX=9606 GN=FLNA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	2325-UNIMOD:267,1018-UNIMOD:4,906-UNIMOD:188,916-UNIMOD:188,1157-UNIMOD:4,771-UNIMOD:188	0.03	41.0	9	5	2
PRT	sp|O15067|PUR4_HUMAN	Phosphoribosylformylglycinamidine synthase OS=Homo sapiens OX=9606 GN=PFAS PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	1285-UNIMOD:4,1287-UNIMOD:4,1290-UNIMOD:267	0.03	41.0	2	1	0
PRT	sp|Q09666|AHNK_HUMAN	Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	41.0	null	540-UNIMOD:267,556-UNIMOD:267,1125-UNIMOD:188,1128-UNIMOD:188,2637-UNIMOD:188,156-UNIMOD:267,167-UNIMOD:267,4859-UNIMOD:188,4862-UNIMOD:188,4139-UNIMOD:188,4142-UNIMOD:188,1077-UNIMOD:188,1080-UNIMOD:188,1333-UNIMOD:188,1336-UNIMOD:188,2463-UNIMOD:188,2466-UNIMOD:188,1081-UNIMOD:35,1082-UNIMOD:188,1091-UNIMOD:188,2709-UNIMOD:35,2717-UNIMOD:188,2720-UNIMOD:188,976-UNIMOD:188,979-UNIMOD:188	0.05	41.0	16	12	8
PRT	sp|O60343-2|TBCD4_HUMAN	Isoform 2 of TBC1 domain family member 4 OS=Homo sapiens OX=9606 GN=TBC1D4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	498-UNIMOD:267	0.01	41.0	2	1	0
PRT	sp|Q9NZM1-2|MYOF_HUMAN	Isoform 2 of Myoferlin OS=Homo sapiens OX=9606 GN=MYOF	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	1089-UNIMOD:4,1093-UNIMOD:267,1717-UNIMOD:188,1786-UNIMOD:188,1788-UNIMOD:188	0.04	41.0	9	5	1
PRT	sp|Q8NBU5|ATAD1_HUMAN	ATPase family AAA domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ATAD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.06	41.0	2	1	0
PRT	sp|P19338|NUCL_HUMAN	Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	348-UNIMOD:188,362-UNIMOD:188,370-UNIMOD:188,377-UNIMOD:188,523-UNIMOD:188,537-UNIMOD:188,513-UNIMOD:188,521-UNIMOD:188	0.10	41.0	9	5	3
PRT	sp|Q68CZ2-2|TENS3_HUMAN	Isoform 2 of Tensin-3 OS=Homo sapiens OX=9606 GN=TNS3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.02	41.0	2	1	0
PRT	sp|Q10713|MPPA_HUMAN	Mitochondrial-processing peptidase subunit alpha OS=Homo sapiens OX=9606 GN=PMPCA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	269-UNIMOD:188,288-UNIMOD:267	0.04	41.0	2	1	0
PRT	sp|P05556-2|ITB1_HUMAN	Isoform 2 of Integrin beta-1 OS=Homo sapiens OX=9606 GN=ITGB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.02	41.0	2	1	0
PRT	sp|Q96A33-2|CCD47_HUMAN	Isoform 2 of Coiled-coil domain-containing protein 47 OS=Homo sapiens OX=9606 GN=CCDC47	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	209-UNIMOD:4,212-UNIMOD:267	0.04	41.0	2	1	0
PRT	sp|Q8TCS8|PNPT1_HUMAN	Polyribonucleotide nucleotidyltransferase 1, mitochondrial OS=Homo sapiens OX=9606 GN=PNPT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	715-UNIMOD:267	0.02	41.0	3	1	0
PRT	sp|Q9BYD1|RM13_HUMAN	39S ribosomal protein L13, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL13 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	41.0	null	154-UNIMOD:267,168-UNIMOD:267	0.09	41.0	3	1	0
PRT	sp|P50395-2|GDIB_HUMAN	Isoform 2 of Rab GDP dissociation inhibitor beta OS=Homo sapiens OX=9606 GN=GDI2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	369-UNIMOD:4,373-UNIMOD:188,377-UNIMOD:188,379-UNIMOD:35,322-UNIMOD:267,334-UNIMOD:188	0.19	41.0	9	5	3
PRT	sp|P22102|PUR2_HUMAN	Trifunctional purine biosynthetic protein adenosine-3 OS=Homo sapiens OX=9606 GN=GART PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	729-UNIMOD:267,466-UNIMOD:4,467-UNIMOD:188,480-UNIMOD:188,965-UNIMOD:267,975-UNIMOD:267,697-UNIMOD:188,708-UNIMOD:267	0.08	41.0	10	5	2
PRT	sp|Q9NY12-2|GAR1_HUMAN	Isoform 2 of H/ACA ribonucleoprotein complex subunit 1 OS=Homo sapiens OX=9606 GN=GAR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	80-UNIMOD:4,86-UNIMOD:4,87-UNIMOD:188	0.10	41.0	2	1	0
PRT	sp|Q14980-2|NUMA1_HUMAN	Isoform 2 of Nuclear mitotic apparatus protein 1 OS=Homo sapiens OX=9606 GN=NUMA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	947-UNIMOD:267,958-UNIMOD:267,230-UNIMOD:267,241-UNIMOD:267	0.02	40.0	6	3	0
PRT	sp|Q9BSH4|TACO1_HUMAN	Translational activator of cytochrome c oxidase 1 OS=Homo sapiens OX=9606 GN=TACO1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	112-UNIMOD:4,113-UNIMOD:267,159-UNIMOD:188	0.13	40.0	5	2	0
PRT	sp|O75369-6|FLNB_HUMAN	Isoform 6 of Filamin-B OS=Homo sapiens OX=9606 GN=FLNB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	2223-UNIMOD:267,877-UNIMOD:188,894-UNIMOD:188,1319-UNIMOD:188,340-UNIMOD:188,976-UNIMOD:188,986-UNIMOD:267,849-UNIMOD:188,857-UNIMOD:188	0.04	40.0	9	6	5
PRT	sp|P16152|CBR1_HUMAN	Carbonyl reductase [NADPH] 1 OS=Homo sapiens OX=9606 GN=CBR1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null	159-UNIMOD:267,174-UNIMOD:188,122-UNIMOD:4	0.12	40.0	3	2	1
PRT	sp|O43818|U3IP2_HUMAN	U3 small nucleolar RNA-interacting protein 2 OS=Homo sapiens OX=9606 GN=RRP9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	445-UNIMOD:267	0.04	40.0	2	1	0
PRT	sp|P30050-2|RL12_HUMAN	Isoform 2 of 60S ribosomal protein L12 OS=Homo sapiens OX=9606 GN=RPL12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	81-UNIMOD:267	0.12	40.0	4	1	0
PRT	sp|P52597|HNRPF_HUMAN	Heterogeneous nuclear ribonucleoprotein F OS=Homo sapiens OX=9606 GN=HNRNPF PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	40.0	null	114-UNIMOD:267	0.04	40.0	5	1	0
PRT	sp|P38117|ETFB_HUMAN	Electron transfer flavoprotein subunit beta OS=Homo sapiens OX=9606 GN=ETFB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	42-UNIMOD:4,51-UNIMOD:267,210-UNIMOD:188,221-UNIMOD:188	0.13	40.0	4	2	0
PRT	sp|P55795|HNRH2_HUMAN	Heterogeneous nuclear ribonucleoprotein H2 OS=Homo sapiens OX=9606 GN=HNRNPH2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	114-UNIMOD:267	0.04	40.0	3	1	0
PRT	sp|O43707|ACTN4_HUMAN	Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	499-UNIMOD:4,512-UNIMOD:267	0.02	40.0	4	1	0
PRT	sp|Q15435-5|PP1R7_HUMAN	Isoform 5 of Protein phosphatase 1 regulatory subunit 7 OS=Homo sapiens OX=9606 GN=PPP1R7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	138-UNIMOD:267	0.14	40.0	4	2	1
PRT	sp|Q13283|G3BP1_HUMAN	Ras GTPase-activating protein-binding protein 1 OS=Homo sapiens OX=9606 GN=G3BP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null	376-UNIMOD:188,393-UNIMOD:188,50-UNIMOD:188,59-UNIMOD:188	0.10	40.0	7	2	0
PRT	sp|P06493-2|CDK1_HUMAN	Isoform 2 of Cyclin-dependent kinase 1 OS=Homo sapiens OX=9606 GN=CDK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	36-UNIMOD:267,50-UNIMOD:267	0.14	40.0	5	2	0
PRT	sp|Q2VIR3-2|IF2GL_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 2 subunit 3B OS=Homo sapiens OX=9606 GN=EIF2S3B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	342-UNIMOD:188,17-UNIMOD:267	0.12	40.0	7	3	1
PRT	sp|P46783|RS10_HUMAN	40S ribosomal protein S10 OS=Homo sapiens OX=9606 GN=RPS10 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	139-UNIMOD:188,153-UNIMOD:267	0.10	40.0	3	1	0
PRT	sp|O00267-2|SPT5H_HUMAN	Isoform 2 of Transcription elongation factor SPT5 OS=Homo sapiens OX=9606 GN=SUPT5H	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	195-UNIMOD:188,209-UNIMOD:188	0.01	40.0	3	1	0
PRT	sp|Q12931-2|TRAP1_HUMAN	Isoform 2 of Heat shock protein 75 kDa, mitochondrial OS=Homo sapiens OX=9606 GN=TRAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	566-UNIMOD:267	0.05	40.0	4	2	1
PRT	sp|Q9P035-2|HACD3_HUMAN	Isoform 2 of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 3 OS=Homo sapiens OX=9606 GN=HACD3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.06	40.0	1	1	1
PRT	sp|P78406|RAE1L_HUMAN	mRNA export factor OS=Homo sapiens OX=9606 GN=RAE1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null	112-UNIMOD:35,131-UNIMOD:188	0.06	40.0	4	1	0
PRT	sp|P07737|PROF1_HUMAN	Profilin-1 OS=Homo sapiens OX=9606 GN=PFN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	40.0	null	71-UNIMOD:4,75-UNIMOD:267,86-UNIMOD:35,89-UNIMOD:267,71-UNIMOD:385	0.28	40.0	8	2	0
PRT	sp|Q12846|STX4_HUMAN	Syntaxin-4 OS=Homo sapiens OX=9606 GN=STX4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	140-UNIMOD:188,215-UNIMOD:267	0.09	40.0	5	2	0
PRT	sp|P35606-2|COPB2_HUMAN	Isoform 2 of Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	579-UNIMOD:188,586-UNIMOD:188	0.08	40.0	5	4	2
PRT	sp|P31943|HNRH1_HUMAN	Heterogeneous nuclear ribonucleoprotein H OS=Homo sapiens OX=9606 GN=HNRNPH1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	114-UNIMOD:267,34-UNIMOD:4	0.07	40.0	3	2	1
PRT	sp|P63096-2|GNAI1_HUMAN	Isoform 2 of Guanine nucleotide-binding protein G(i) subunit alpha-1 OS=Homo sapiens OX=9606 GN=GNAI1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	265-UNIMOD:188,273-UNIMOD:4,278-UNIMOD:188	0.06	39.0	2	1	0
PRT	sp|P49023-2|PAXI_HUMAN	Isoform Alpha of Paxillin OS=Homo sapiens OX=9606 GN=PXN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	93-UNIMOD:188,329-UNIMOD:188,341-UNIMOD:188	0.06	39.0	3	2	1
PRT	sp|P49419-4|AL7A1_HUMAN	Isoform 4 of Alpha-aminoadipic semialdehyde dehydrogenase OS=Homo sapiens OX=9606 GN=ALDH7A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	375-UNIMOD:188,388-UNIMOD:188	0.03	39.0	3	1	0
PRT	sp|Q8NE62|CHDH_HUMAN	Choline dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=CHDH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.03	39.0	1	1	1
PRT	sp|Q13509-2|TBB3_HUMAN	Isoform 2 of Tubulin beta-3 chain OS=Homo sapiens OX=9606 GN=TUBB3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	278-UNIMOD:188,49-UNIMOD:267	0.09	39.0	4	2	1
PRT	sp|P12268|IMDH2_HUMAN	Inosine-5'-monophosphate dehydrogenase 2 OS=Homo sapiens OX=9606 GN=IMPDH2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.07	39.0	2	2	2
PRT	sp|P26196|DDX6_HUMAN	Probable ATP-dependent RNA helicase DDX6 OS=Homo sapiens OX=9606 GN=DDX6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.05	39.0	2	1	0
PRT	sp|P19838|NFKB1_HUMAN	Nuclear factor NF-kappa-B p105 subunit OS=Homo sapiens OX=9606 GN=NFKB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	186-UNIMOD:267	0.02	39.0	3	1	0
PRT	sp|P25786|PSA1_HUMAN	Proteasome subunit alpha type-1 OS=Homo sapiens OX=9606 GN=PSMA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	182-UNIMOD:4,189-UNIMOD:188	0.06	39.0	2	1	0
PRT	sp|Q9NZ45|CISD1_HUMAN	CDGSH iron-sulfur domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CISD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.15	39.0	1	1	1
PRT	sp|Q9Y3C6|PPIL1_HUMAN	Peptidyl-prolyl cis-trans isomerase-like 1 OS=Homo sapiens OX=9606 GN=PPIL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.11	39.0	2	1	0
PRT	sp|P00558-2|PGK1_HUMAN	Isoform 2 of Phosphoglycerate kinase 1 OS=Homo sapiens OX=9606 GN=PGK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	148-UNIMOD:35,156-UNIMOD:188	0.08	39.0	6	2	0
PRT	sp|P34896-4|GLYC_HUMAN	Isoform 4 of Serine hydroxymethyltransferase, cytosolic OS=Homo sapiens OX=9606 GN=SHMT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	226-UNIMOD:267	0.05	39.0	2	1	0
PRT	sp|O00299|CLIC1_HUMAN	Chloride intracellular channel protein 1 OS=Homo sapiens OX=9606 GN=CLIC1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	166-UNIMOD:188,178-UNIMOD:4,183-UNIMOD:188	0.08	39.0	3	1	0
PRT	sp|Q9Y696|CLIC4_HUMAN	Chloride intracellular channel protein 4 OS=Homo sapiens OX=9606 GN=CLIC4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	177-UNIMOD:188,189-UNIMOD:4,194-UNIMOD:188,184-UNIMOD:35,124-UNIMOD:188	0.13	39.0	6	2	1
PRT	sp|Q8N392-2|RHG18_HUMAN	Isoform 2 of Rho GTPase-activating protein 18 OS=Homo sapiens OX=9606 GN=ARHGAP18	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	278-UNIMOD:4	0.06	39.0	3	2	1
PRT	sp|Q15126|PMVK_HUMAN	Phosphomevalonate kinase OS=Homo sapiens OX=9606 GN=PMVK PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.09	39.0	1	1	1
PRT	sp|Q6RFH5-2|WDR74_HUMAN	Isoform 2 of WD repeat-containing protein 74 OS=Homo sapiens OX=9606 GN=WDR74	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.04	39.0	1	1	1
PRT	sp|P23246-2|SFPQ_HUMAN	Isoform Short of Splicing factor, proline- and glutamine-rich OS=Homo sapiens OX=9606 GN=SFPQ	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	493-UNIMOD:267	0.07	39.0	6	3	1
PRT	sp|Q69YQ0-2|CYTSA_HUMAN	Isoform 2 of Cytospin-A OS=Homo sapiens OX=9606 GN=SPECC1L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	719-UNIMOD:188	0.01	39.0	3	1	0
PRT	sp|P61086-2|UBE2K_HUMAN	Isoform 2 of Ubiquitin-conjugating enzyme E2 K OS=Homo sapiens OX=9606 GN=UBE2K	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	113-UNIMOD:188	0.13	39.0	2	1	0
PRT	sp|P08621-3|RU17_HUMAN	Isoform 3 of U1 small nuclear ribonucleoprotein 70 kDa OS=Homo sapiens OX=9606 GN=SNRNP70	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	88-UNIMOD:35,103-UNIMOD:188	0.10	39.0	3	1	0
PRT	sp|Q96I24|FUBP3_HUMAN	Far upstream element-binding protein 3 OS=Homo sapiens OX=9606 GN=FUBP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	173-UNIMOD:188,196-UNIMOD:35,25-UNIMOD:267	0.10	39.0	5	3	1
PRT	sp|Q96ME7-2|ZN512_HUMAN	Isoform 2 of Zinc finger protein 512 OS=Homo sapiens OX=9606 GN=ZNF512	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	247-UNIMOD:4,249-UNIMOD:188	0.04	39.0	2	1	0
PRT	sp|Q92841|DDX17_HUMAN	Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens OX=9606 GN=DDX17 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	417-UNIMOD:188,420-UNIMOD:188,143-UNIMOD:267	0.06	39.0	7	3	1
PRT	sp|Q7Z7K6-2|CENPV_HUMAN	Isoform 2 of Centromere protein V OS=Homo sapiens OX=9606 GN=CENPV	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	83-UNIMOD:4,90-UNIMOD:267	0.17	39.0	1	1	1
PRT	sp|Q15654|TRIP6_HUMAN	Thyroid receptor-interacting protein 6 OS=Homo sapiens OX=9606 GN=TRIP6 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	137-UNIMOD:188,173-UNIMOD:188	0.09	39.0	1	1	1
PRT	sp|P62241|RS8_HUMAN	40S ribosomal protein S8 OS=Homo sapiens OX=9606 GN=RPS8 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	39.0	null	77-UNIMOD:267,92-UNIMOD:267,71-UNIMOD:4,72-UNIMOD:4	0.16	39.0	5	2	1
PRT	sp|P04843|RPN1_HUMAN	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Homo sapiens OX=9606 GN=RPN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	232-UNIMOD:267	0.03	39.0	2	1	0
PRT	sp|Q9Y2X3|NOP58_HUMAN	Nucleolar protein 58 OS=Homo sapiens OX=9606 GN=NOP58 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	353-UNIMOD:188,21-UNIMOD:188,30-UNIMOD:188	0.05	39.0	5	2	1
PRT	sp|Q12931|TRAP1_HUMAN	Heat shock protein 75 kDa, mitochondrial OS=Homo sapiens OX=9606 GN=TRAP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	619-UNIMOD:267	0.03	39.0	1	1	0
PRT	sp|P55060-4|XPO2_HUMAN	Isoform 4 of Exportin-2 OS=Homo sapiens OX=9606 GN=CSE1L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	109-UNIMOD:188	0.02	38.0	3	1	0
PRT	sp|P62195-2|PRS8_HUMAN	Isoform 2 of 26S proteasome regulatory subunit 8 OS=Homo sapiens OX=9606 GN=PSMC5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	250-UNIMOD:267	0.05	38.0	4	1	0
PRT	sp|P63104-2|1433Z_HUMAN	Isoform 2 of 14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	40-UNIMOD:188,45-UNIMOD:188	0.11	38.0	2	1	0
PRT	sp|P11586|C1TC_HUMAN	C-1-tetrahydrofolate synthase, cytoplasmic OS=Homo sapiens OX=9606 GN=MTHFD1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	152-UNIMOD:4,543-UNIMOD:188,553-UNIMOD:188,157-UNIMOD:188,166-UNIMOD:267,473-UNIMOD:188	0.04	38.0	7	3	0
PRT	sp|Q9Y3I0|RTCB_HUMAN	RNA-splicing ligase RtcB homolog OS=Homo sapiens OX=9606 GN=RTCB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	279-UNIMOD:188,255-UNIMOD:4,263-UNIMOD:267	0.06	38.0	4	2	1
PRT	sp|Q5T4S7-3|UBR4_HUMAN	Isoform 3 of E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	4877-UNIMOD:267,4891-UNIMOD:188	0.00	38.0	2	1	0
PRT	sp|Q13813-3|SPTN1_HUMAN	Isoform 3 of Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	627-UNIMOD:267,2284-UNIMOD:35,2068-UNIMOD:188,2078-UNIMOD:188,2295-UNIMOD:267	0.03	38.0	8	5	2
PRT	sp|P20645|MPRD_HUMAN	Cation-dependent mannose-6-phosphate receptor OS=Homo sapiens OX=9606 GN=M6PR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	161-UNIMOD:267	0.05	38.0	2	1	0
PRT	sp|Q27J81|INF2_HUMAN	Inverted formin-2 OS=Homo sapiens OX=9606 GN=INF2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.02	38.0	2	1	0
PRT	sp|P50479-2|PDLI4_HUMAN	Isoform 2 of PDZ and LIM domain protein 4 OS=Homo sapiens OX=9606 GN=PDLIM4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	117-UNIMOD:267	0.07	38.0	2	1	0
PRT	sp|P46109|CRKL_HUMAN	Crk-like protein OS=Homo sapiens OX=9606 GN=CRKL PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	104-UNIMOD:267	0.05	38.0	2	1	0
PRT	sp|Q6P1N0-2|C2D1A_HUMAN	Isoform 2 of Coiled-coil and C2 domain-containing protein 1A OS=Homo sapiens OX=9606 GN=CC2D1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	791-UNIMOD:267,805-UNIMOD:267	0.02	38.0	3	1	0
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	268-UNIMOD:267,156-UNIMOD:188,157-UNIMOD:188,292-UNIMOD:188,301-UNIMOD:188	0.11	38.0	10	4	1
PRT	sp|Q8WVM0|TFB1M_HUMAN	Dimethyladenosine transferase 1, mitochondrial OS=Homo sapiens OX=9606 GN=TFB1M PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.07	38.0	1	1	1
PRT	sp|P82650|RT22_HUMAN	28S ribosomal protein S22, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS22 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	67-UNIMOD:188,81-UNIMOD:188	0.04	38.0	4	1	0
PRT	sp|P42166|LAP2A_HUMAN	Lamina-associated polypeptide 2, isoform alpha OS=Homo sapiens OX=9606 GN=TMPO PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	684-UNIMOD:4,500-UNIMOD:188	0.05	38.0	2	2	2
PRT	sp|P55957|BID_HUMAN	BH3-interacting domain death agonist OS=Homo sapiens OX=9606 GN=BID PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	71-UNIMOD:267,84-UNIMOD:267	0.09	38.0	4	1	0
PRT	sp|Q9BQG0|MBB1A_HUMAN	Myb-binding protein 1A OS=Homo sapiens OX=9606 GN=MYBBP1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	178-UNIMOD:267	0.01	38.0	4	1	0
PRT	sp|Q9HA77|SYCM_HUMAN	Probable cysteine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=CARS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.03	38.0	1	1	1
PRT	sp|P35222|CTNB1_HUMAN	Catenin beta-1 OS=Homo sapiens OX=9606 GN=CTNNB1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	566-UNIMOD:35,573-UNIMOD:4,582-UNIMOD:267,486-UNIMOD:267	0.04	38.0	6	2	0
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	313-UNIMOD:35,315-UNIMOD:188,326-UNIMOD:188,257-UNIMOD:4,269-UNIMOD:35,272-UNIMOD:4,283-UNIMOD:35,113-UNIMOD:188,325-UNIMOD:35,284-UNIMOD:188,190-UNIMOD:35	0.21	38.0	13	4	0
PRT	sp|P42330|AK1C3_HUMAN	Aldo-keto reductase family 1 member C3 OS=Homo sapiens OX=9606 GN=AKR1C3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.16	38.0	3	3	3
PRT	sp|Q15019|SEPT2_HUMAN	Septin-2 OS=Homo sapiens OX=9606 GN=SEPTIN2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	29-UNIMOD:267,339-UNIMOD:35	0.14	38.0	3	2	1
PRT	sp|Q9UQE7|SMC3_HUMAN	Structural maintenance of chromosomes protein 3 OS=Homo sapiens OX=9606 GN=SMC3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null	774-UNIMOD:267	0.03	38.0	4	2	1
PRT	sp|P62316-2|SMD2_HUMAN	Isoform 2 of Small nuclear ribonucleoprotein Sm D2 OS=Homo sapiens OX=9606 GN=SNRPD2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.19	38.0	3	1	0
PRT	sp|Q15836|VAMP3_HUMAN	Vesicle-associated membrane protein 3 OS=Homo sapiens OX=9606 GN=VAMP3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	14-UNIMOD:267,30-UNIMOD:267	0.18	38.0	2	1	0
PRT	sp|O15213|WDR46_HUMAN	WD repeat-containing protein 46 OS=Homo sapiens OX=9606 GN=WDR46 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	515-UNIMOD:4	0.06	38.0	2	2	2
PRT	sp|P17706-3|PTN2_HUMAN	Isoform 3 of Tyrosine-protein phosphatase non-receptor type 2 OS=Homo sapiens OX=9606 GN=PTPN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.06	38.0	1	1	1
PRT	sp|Q9UGV2-3|NDRG3_HUMAN	Isoform 3 of Protein NDRG3 OS=Homo sapiens OX=9606 GN=NDRG3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.06	38.0	1	1	1
PRT	sp|P42765|THIM_HUMAN	3-ketoacyl-CoA thiolase, mitochondrial OS=Homo sapiens OX=9606 GN=ACAA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null	360-UNIMOD:267	0.05	38.0	3	1	0
PRT	sp|O00471|EXOC5_HUMAN	Exocyst complex component 5 OS=Homo sapiens OX=9606 GN=EXOC5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	111-UNIMOD:4,124-UNIMOD:267	0.02	38.0	3	1	0
PRT	sp|Q96IR7|HPDL_HUMAN	4-hydroxyphenylpyruvate dioxygenase-like protein OS=Homo sapiens OX=9606 GN=HPDL PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	168-UNIMOD:4,178-UNIMOD:267	0.05	38.0	3	1	0
PRT	sp|Q9Y277|VDAC3_HUMAN	Voltage-dependent anion-selective channel protein 3 OS=Homo sapiens OX=9606 GN=VDAC3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	163-UNIMOD:188,174-UNIMOD:188	0.12	38.0	3	2	1
PRT	sp|P33316|DUT_HUMAN	Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=DUT PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.08	37.0	1	1	1
PRT	sp|Q8WWQ0|PHIP_HUMAN	PH-interacting protein OS=Homo sapiens OX=9606 GN=PHIP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	1571-UNIMOD:267	0.01	37.0	1	1	1
PRT	sp|O60716|CTND1_HUMAN	Catenin delta-1 OS=Homo sapiens OX=9606 GN=CTNND1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	725-UNIMOD:267	0.03	37.0	4	2	1
PRT	sp|O60701-3|UGDH_HUMAN	Isoform 3 of UDP-glucose 6-dehydrogenase OS=Homo sapiens OX=9606 GN=UGDH	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	99-UNIMOD:4,108-UNIMOD:267	0.04	37.0	3	1	0
PRT	sp|P41250|GARS_HUMAN	Glycine--tRNA ligase OS=Homo sapiens OX=9606 GN=GARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	379-UNIMOD:188	0.02	37.0	2	1	0
PRT	sp|Q7L014|DDX46_HUMAN	Probable ATP-dependent RNA helicase DDX46 OS=Homo sapiens OX=9606 GN=DDX46 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null	903-UNIMOD:188,907-UNIMOD:188	0.04	37.0	4	3	2
PRT	sp|Q86XP3-2|DDX42_HUMAN	Isoform 2 of ATP-dependent RNA helicase DDX42 OS=Homo sapiens OX=9606 GN=DDX42	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	29-UNIMOD:267,43-UNIMOD:267	0.02	37.0	3	1	0
PRT	sp|P07814|SYEP_HUMAN	Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens OX=9606 GN=EPRS1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null	660-UNIMOD:4,542-UNIMOD:188,549-UNIMOD:188,1251-UNIMOD:35	0.05	37.0	8	5	2
PRT	sp|P62495|ERF1_HUMAN	Eukaryotic peptide chain release factor subunit 1 OS=Homo sapiens OX=9606 GN=ETF1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.05	37.0	1	1	1
PRT	sp|P11940-2|PABP1_HUMAN	Isoform 2 of Polyadenylate-binding protein 1 OS=Homo sapiens OX=9606 GN=PABPC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	312-UNIMOD:188,324-UNIMOD:188,153-UNIMOD:267	0.05	37.0	6	2	0
PRT	sp|O43143|DHX15_HUMAN	Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 OS=Homo sapiens OX=9606 GN=DHX15 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null	166-UNIMOD:188	0.04	37.0	3	2	1
PRT	sp|Q9H4L5-2|OSBL3_HUMAN	Isoform 1b of Oxysterol-binding protein-related protein 3 OS=Homo sapiens OX=9606 GN=OSBPL3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	384-UNIMOD:188,711-UNIMOD:267	0.04	37.0	3	2	1
PRT	sp|P28331-3|NDUS1_HUMAN	Isoform 3 of NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.03	37.0	2	1	0
PRT	sp|Q9UHD1|CHRD1_HUMAN	Cysteine and histidine-rich domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CHORDC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	306-UNIMOD:188,321-UNIMOD:188,59-UNIMOD:4,46-UNIMOD:267,61-UNIMOD:188	0.10	37.0	4	2	0
PRT	sp|Q5T1C6|THEM4_HUMAN	Acyl-coenzyme A thioesterase THEM4 OS=Homo sapiens OX=9606 GN=THEM4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	212-UNIMOD:4	0.06	37.0	1	1	1
PRT	sp|P78527-2|PRKDC_HUMAN	Isoform 2 of DNA-dependent protein kinase catalytic subunit OS=Homo sapiens OX=9606 GN=PRKDC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	3992-UNIMOD:188,4005-UNIMOD:188,478-UNIMOD:4,489-UNIMOD:267,2469-UNIMOD:4,2470-UNIMOD:267	0.02	37.0	7	5	3
PRT	sp|Q9BYG3|MK67I_HUMAN	MKI67 FHA domain-interacting nucleolar phosphoprotein OS=Homo sapiens OX=9606 GN=NIFK PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	179-UNIMOD:188,192-UNIMOD:188	0.05	37.0	3	1	0
PRT	sp|O75153|CLU_HUMAN	Clustered mitochondria protein homolog OS=Homo sapiens OX=9606 GN=CLUH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	184-UNIMOD:4,355-UNIMOD:267	0.03	37.0	3	2	1
PRT	sp|Q99729-3|ROAA_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein A/B OS=Homo sapiens OX=9606 GN=HNRNPAB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	155-UNIMOD:188,169-UNIMOD:188,83-UNIMOD:188,84-UNIMOD:188,72-UNIMOD:35	0.11	37.0	6	3	2
PRT	sp|Q93052|LPP_HUMAN	Lipoma-preferred partner OS=Homo sapiens OX=9606 GN=LPP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	364-UNIMOD:4	0.03	37.0	2	1	0
PRT	sp|Q08211|DHX9_HUMAN	ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	37.0	null	249-UNIMOD:28,264-UNIMOD:188,1099-UNIMOD:4,1104-UNIMOD:267,209-UNIMOD:267	0.07	37.0	13	6	3
PRT	sp|A4D1E9|GTPBA_HUMAN	GTP-binding protein 10 OS=Homo sapiens OX=9606 GN=GTPBP10 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	37.0	null	197-UNIMOD:28,214-UNIMOD:188	0.10	37.0	2	2	2
PRT	sp|O75521-2|ECI2_HUMAN	Isoform 2 of Enoyl-CoA delta isomerase 2, mitochondrial OS=Homo sapiens OX=9606 GN=ECI2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	333-UNIMOD:4,339-UNIMOD:267	0.04	37.0	4	1	0
PRT	sp|P49588|SYAC_HUMAN	Alanine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=AARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	880-UNIMOD:35	0.07	37.0	5	4	3
PRT	sp|Q96DI7|SNR40_HUMAN	U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens OX=9606 GN=SNRNP40 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	168-UNIMOD:4	0.05	37.0	1	1	1
PRT	sp|O75396|SC22B_HUMAN	Vesicle-trafficking protein SEC22b OS=Homo sapiens OX=9606 GN=SEC22B PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	133-UNIMOD:267,147-UNIMOD:267	0.07	37.0	2	1	0
PRT	sp|Q9BUJ2-3|HNRL1_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 OS=Homo sapiens OX=9606 GN=HNRNPUL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	307-UNIMOD:4,335-UNIMOD:188,347-UNIMOD:188	0.07	37.0	3	3	3
PRT	sp|Q9BZF1-3|OSBL8_HUMAN	Isoform 3 of Oxysterol-binding protein-related protein 8 OS=Homo sapiens OX=9606 GN=OSBPL8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	567-UNIMOD:188,575-UNIMOD:4,582-UNIMOD:188,499-UNIMOD:188,514-UNIMOD:267	0.04	37.0	4	2	0
PRT	sp|Q1KMD3|HNRL2_HUMAN	Heterogeneous nuclear ribonucleoprotein U-like protein 2 OS=Homo sapiens OX=9606 GN=HNRNPUL2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	518-UNIMOD:4,495-UNIMOD:35	0.04	37.0	3	2	1
PRT	sp|Q8N3U4|STAG2_HUMAN	Cohesin subunit SA-2 OS=Homo sapiens OX=9606 GN=STAG2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	640-UNIMOD:4	0.01	37.0	1	1	1
PRT	sp|Q9NUQ9-2|FA49B_HUMAN	Isoform 2 of Protein FAM49B OS=Homo sapiens OX=9606 GN=FAM49B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.11	37.0	2	1	0
PRT	sp|Q969G9|NKD1_HUMAN	Protein naked cuticle homolog 1 OS=Homo sapiens OX=9606 GN=NKD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null		0.06	37.0	1	1	1
PRT	sp|Q0VDF9|HSP7E_HUMAN	Heat shock 70 kDa protein 14 OS=Homo sapiens OX=9606 GN=HSPA14 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null		0.05	37.0	1	1	1
PRT	sp|Q15046|SYK_HUMAN	Lysine--tRNA ligase OS=Homo sapiens OX=9606 GN=KARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.07	36.0	3	2	1
PRT	sp|O00303|EIF3F_HUMAN	Eukaryotic translation initiation factor 3 subunit F OS=Homo sapiens OX=9606 GN=EIF3F PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	210-UNIMOD:267,256-UNIMOD:4	0.12	36.0	4	2	0
PRT	sp|Q9NP81|SYSM_HUMAN	Serine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=SARS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	64-UNIMOD:4,66-UNIMOD:4,77-UNIMOD:267	0.03	36.0	4	1	0
PRT	sp|O43598-2|DNPH1_HUMAN	Isoform 2 of 2'-deoxynucleoside 5'-phosphate N-hydrolase 1 OS=Homo sapiens OX=9606 GN=DNPH1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	65-UNIMOD:267	0.12	36.0	3	1	0
PRT	sp|Q96LD4|TRI47_HUMAN	E3 ubiquitin-protein ligase TRIM47 OS=Homo sapiens OX=9606 GN=TRIM47 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	468-UNIMOD:4	0.03	36.0	1	1	1
PRT	sp|Q14847-3|LASP1_HUMAN	Isoform 3 of LIM and SH3 domain protein 1 OS=Homo sapiens OX=9606 GN=LASP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.08	36.0	2	1	0
PRT	sp|P11142|HSP7C_HUMAN	Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	17-UNIMOD:4,25-UNIMOD:188,574-UNIMOD:4,342-UNIMOD:267,357-UNIMOD:188,361-UNIMOD:188,127-UNIMOD:35,128-UNIMOD:188,137-UNIMOD:188	0.14	36.0	10	6	2
PRT	sp|Q6IBS0|TWF2_HUMAN	Twinfilin-2 OS=Homo sapiens OX=9606 GN=TWF2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	141-UNIMOD:4,152-UNIMOD:267	0.05	36.0	3	1	0
PRT	sp|P51991-2|ROA3_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens OX=9606 GN=HNRNPA3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.09	36.0	3	2	1
PRT	sp|P24941-2|CDK2_HUMAN	Isoform 2 of Cyclin-dependent kinase 2 OS=Homo sapiens OX=9606 GN=CDK2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	36-UNIMOD:267,50-UNIMOD:267	0.06	36.0	2	1	0
PRT	sp|Q13442|HAP28_HUMAN	28 kDa heat- and acid-stable phosphoprotein OS=Homo sapiens OX=9606 GN=PDAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.08	36.0	1	1	1
PRT	sp|Q9H6R4-2|NOL6_HUMAN	Isoform 2 of Nucleolar protein 6 OS=Homo sapiens OX=9606 GN=NOL6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	777-UNIMOD:4,778-UNIMOD:267	0.01	36.0	3	1	0
PRT	sp|Q14204|DYHC1_HUMAN	Cytoplasmic dynein 1 heavy chain 1 OS=Homo sapiens OX=9606 GN=DYNC1H1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	81-UNIMOD:267,602-UNIMOD:267,611-UNIMOD:267,1912-UNIMOD:188,1917-UNIMOD:188,2068-UNIMOD:188,2074-UNIMOD:188	0.01	36.0	8	4	1
PRT	sp|Q06587-2|RING1_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase RING1 OS=Homo sapiens OX=9606 GN=RING1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.05	36.0	1	1	1
PRT	sp|Q13561|DCTN2_HUMAN	Dynactin subunit 2 OS=Homo sapiens OX=9606 GN=DCTN2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.05	36.0	1	1	1
PRT	sp|Q9NVI7-2|ATD3A_HUMAN	Isoform 2 of ATPase family AAA domain-containing protein 3A OS=Homo sapiens OX=9606 GN=ATAD3A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	310-UNIMOD:267,327-UNIMOD:267	0.08	36.0	3	2	1
PRT	sp|Q8N8A6|DDX51_HUMAN	ATP-dependent RNA helicase DDX51 OS=Homo sapiens OX=9606 GN=DDX51 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.03	36.0	1	1	1
PRT	sp|P49915-2|GUAA_HUMAN	Isoform 2 of GMP synthase [glutamine-hydrolyzing] OS=Homo sapiens OX=9606 GN=GMPS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	101-UNIMOD:188	0.03	36.0	2	1	0
PRT	sp|P33993-2|MCM7_HUMAN	Isoform 2 of DNA replication licensing factor MCM7 OS=Homo sapiens OX=9606 GN=MCM7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	237-UNIMOD:35,251-UNIMOD:267	0.04	36.0	2	1	0
PRT	sp|P61225|RAP2B_HUMAN	Ras-related protein Rap-2b OS=Homo sapiens OX=9606 GN=RAP2B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.08	36.0	1	1	1
PRT	sp|Q9HDC9-2|APMAP_HUMAN	Isoform 2 of Adipocyte plasma membrane-associated protein OS=Homo sapiens OX=9606 GN=APMAP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.07	36.0	2	1	0
PRT	sp|Q01085|TIAR_HUMAN	Nucleolysin TIAR OS=Homo sapiens OX=9606 GN=TIAL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	192-UNIMOD:267,203-UNIMOD:188	0.04	36.0	2	1	0
PRT	sp|Q15459-2|SF3A1_HUMAN	Isoform 2 of Splicing factor 3A subunit 1 OS=Homo sapiens OX=9606 GN=SF3A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	334-UNIMOD:188,354-UNIMOD:188	0.07	36.0	5	3	1
PRT	sp|P05783|K1C18_HUMAN	Keratin, type I cytoskeletal 18 OS=Homo sapiens OX=9606 GN=KRT18 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	36.0	null	301-UNIMOD:267,314-UNIMOD:267,313-UNIMOD:35,27-UNIMOD:267,45-UNIMOD:267,372-UNIMOD:188,381-UNIMOD:267,176-UNIMOD:28,186-UNIMOD:267,187-UNIMOD:188,167-UNIMOD:188,175-UNIMOD:267	0.21	36.0	23	7	2
PRT	sp|Q9P2J5|SYLC_HUMAN	Leucine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=LARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	795-UNIMOD:267,807-UNIMOD:188	0.03	36.0	3	2	1
PRT	sp|P62937|PPIA_HUMAN	Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	82-UNIMOD:188,91-UNIMOD:188,28-UNIMOD:188,31-UNIMOD:188,142-UNIMOD:35,136-UNIMOD:35	0.26	36.0	13	3	0
PRT	sp|P08133-2|ANXA6_HUMAN	Isoform 2 of Annexin A6 OS=Homo sapiens OX=9606 GN=ANXA6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	631-UNIMOD:188,466-UNIMOD:267,361-UNIMOD:267	0.08	36.0	3	3	3
PRT	sp|Q9BQ39|DDX50_HUMAN	ATP-dependent RNA helicase DDX50 OS=Homo sapiens OX=9606 GN=DDX50 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.02	36.0	1	1	1
PRT	sp|Q15233-2|NONO_HUMAN	Isoform 2 of Non-POU domain-containing octamer-binding protein OS=Homo sapiens OX=9606 GN=NONO	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	37-UNIMOD:188,46-UNIMOD:267	0.08	36.0	5	3	2
PRT	sp|Q9NUQ6-2|SPS2L_HUMAN	Isoform 2 of SPATS2-like protein OS=Homo sapiens OX=9606 GN=SPATS2L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	298-UNIMOD:4,314-UNIMOD:188	0.04	36.0	4	1	0
PRT	sp|Q8TEM1-2|PO210_HUMAN	Isoform 2 of Nuclear pore membrane glycoprotein 210 OS=Homo sapiens OX=9606 GN=NUP210	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	76-UNIMOD:4	0.03	36.0	1	1	1
PRT	sp|Q2VIR3|IF2GL_HUMAN	Eukaryotic translation initiation factor 2 subunit 3B OS=Homo sapiens OX=9606 GN=EIF2S3B PE=2 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	null	39-UNIMOD:28,54-UNIMOD:188	0.07	36.0	3	2	0
PRT	sp|Q53GQ0|DHB12_HUMAN	Very-long-chain 3-oxoacyl-CoA reductase OS=Homo sapiens OX=9606 GN=HSD17B12 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	36.0	null	223-UNIMOD:188,238-UNIMOD:188,215-UNIMOD:4,221-UNIMOD:267	0.11	36.0	6	2	0
PRT	sp|Q8TDP1|RNH2C_HUMAN	Ribonuclease H2 subunit C OS=Homo sapiens OX=9606 GN=RNASEH2C PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	34-UNIMOD:4,46-UNIMOD:267	0.15	35.0	2	1	0
PRT	sp|P60903|S10AA_HUMAN	Protein S100-A10 OS=Homo sapiens OX=9606 GN=S100A10 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	35.0	null	47-UNIMOD:188,54-UNIMOD:188,38-UNIMOD:27	0.30	35.0	6	2	1
PRT	sp|P09382|LEG1_HUMAN	Galectin-1 OS=Homo sapiens OX=9606 GN=LGALS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null	61-UNIMOD:4,64-UNIMOD:188,43-UNIMOD:4,49-UNIMOD:267	0.21	35.0	4	2	0
PRT	sp|P63244|RACK1_HUMAN	Receptor of activated protein C kinase 1 OS=Homo sapiens OX=9606 GN=RACK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null	168-UNIMOD:4,172-UNIMOD:188,175-UNIMOD:188,47-UNIMOD:267,57-UNIMOD:267,36-UNIMOD:267	0.24	35.0	7	4	2
PRT	sp|Q9UBQ5-2|EIF3K_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit K OS=Homo sapiens OX=9606 GN=EIF3K	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	20-UNIMOD:267,31-UNIMOD:267,85-UNIMOD:4,86-UNIMOD:188	0.15	35.0	4	2	1
PRT	sp|P38919|IF4A3_HUMAN	Eukaryotic initiation factor 4A-III OS=Homo sapiens OX=9606 GN=EIF4A3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	60-UNIMOD:188,67-UNIMOD:267,374-UNIMOD:188,382-UNIMOD:188	0.07	35.0	4	2	1
PRT	sp|Q13895|BYST_HUMAN	Bystin OS=Homo sapiens OX=9606 GN=BYSL PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.04	35.0	1	1	1
PRT	sp|Q9BZM4|ULBP3_HUMAN	UL16-binding protein 3 OS=Homo sapiens OX=9606 GN=ULBP3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	51-UNIMOD:4,60-UNIMOD:188	0.07	35.0	2	1	0
PRT	sp|P49916-4|DNLI3_HUMAN	Isoform 4 of DNA ligase 3 OS=Homo sapiens OX=9606 GN=LIG3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	355-UNIMOD:188	0.02	35.0	2	1	0
PRT	sp|P11172|UMPS_HUMAN	Uridine 5'-monophosphate synthase OS=Homo sapiens OX=9606 GN=UMPS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	352-UNIMOD:188,314-UNIMOD:188,323-UNIMOD:188,459-UNIMOD:267,467-UNIMOD:267	0.10	35.0	5	3	1
PRT	sp|Q9H0A0-2|NAT10_HUMAN	Isoform 2 of RNA cytidine acetyltransferase OS=Homo sapiens OX=9606 GN=NAT10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	571-UNIMOD:267	0.02	35.0	4	1	0
PRT	sp|P62136|PP1A_HUMAN	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Homo sapiens OX=9606 GN=PPP1CA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null	62-UNIMOD:4,74-UNIMOD:267,140-UNIMOD:4,127-UNIMOD:4	0.15	35.0	6	4	3
PRT	sp|Q93009-3|UBP7_HUMAN	Isoform 3 of Ubiquitin carboxyl-terminal hydrolase 7 OS=Homo sapiens OX=9606 GN=USP7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	945-UNIMOD:4	0.02	35.0	1	1	1
PRT	sp|P06576|ATPB_HUMAN	ATP synthase subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	145-UNIMOD:35	0.06	35.0	4	2	1
PRT	sp|O94925-3|GLSK_HUMAN	Isoform 3 of Glutaminase kidney isoform, mitochondrial OS=Homo sapiens OX=9606 GN=GLS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	203-UNIMOD:4	0.03	35.0	1	1	1
PRT	sp|Q99627-2|CSN8_HUMAN	Isoform 2 of COP9 signalosome complex subunit 8 OS=Homo sapiens OX=9606 GN=COPS8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	117-UNIMOD:188,129-UNIMOD:188	0.09	35.0	2	1	0
PRT	sp|P51116|FXR2_HUMAN	Fragile X mental retardation syndrome-related protein 2 OS=Homo sapiens OX=9606 GN=FXR2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	270-UNIMOD:4	0.03	35.0	2	1	0
PRT	sp|P46940|IQGA1_HUMAN	Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens OX=9606 GN=IQGAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	585-UNIMOD:267	0.02	35.0	5	2	1
PRT	sp|P49792|RBP2_HUMAN	E3 SUMO-protein ligase RanBP2 OS=Homo sapiens OX=9606 GN=RANBP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	1842-UNIMOD:188	0.01	35.0	3	2	1
PRT	sp|P48735-2|IDHP_HUMAN	Isoform 2 of Isocitrate dehydrogenase [NADP], mitochondrial OS=Homo sapiens OX=9606 GN=IDH2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.07	35.0	2	2	2
PRT	sp|Q9BSJ8|ESYT1_HUMAN	Extended synaptotagmin-1 OS=Homo sapiens OX=9606 GN=ESYT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	662-UNIMOD:188	0.05	35.0	4	3	2
PRT	sp|A0FGR8-6|ESYT2_HUMAN	Isoform 6 of Extended synaptotagmin-2 OS=Homo sapiens OX=9606 GN=ESYT2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	561-UNIMOD:188,562-UNIMOD:188	0.02	35.0	2	1	0
PRT	sp|P11233|RALA_HUMAN	Ras-related protein Ral-A OS=Homo sapiens OX=9606 GN=RALA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	145-UNIMOD:267,159-UNIMOD:188	0.08	35.0	2	1	0
PRT	sp|P52888|THOP1_HUMAN	Thimet oligopeptidase OS=Homo sapiens OX=9606 GN=THOP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null	644-UNIMOD:4,647-UNIMOD:267,659-UNIMOD:267	0.03	35.0	3	1	0
PRT	sp|Q9Y2B0|CNPY2_HUMAN	Protein canopy homolog 2 OS=Homo sapiens OX=9606 GN=CNPY2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	86-UNIMOD:4,88-UNIMOD:267	0.09	35.0	1	1	1
PRT	sp|Q86U90|YRDC_HUMAN	YrdC domain-containing protein, mitochondrial OS=Homo sapiens OX=9606 GN=YRDC PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.07	35.0	2	1	0
PRT	sp|Q92973-3|TNPO1_HUMAN	Isoform 3 of Transportin-1 OS=Homo sapiens OX=9606 GN=TNPO1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	155-UNIMOD:4,163-UNIMOD:267	0.02	35.0	3	1	0
PRT	sp|P51610-2|HCFC1_HUMAN	Isoform 2 of Host cell factor 1 OS=Homo sapiens OX=9606 GN=HCFC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	1850-UNIMOD:188,326-UNIMOD:4,333-UNIMOD:267	0.02	35.0	4	2	0
PRT	sp|Q9NYF8-3|BCLF1_HUMAN	Isoform 3 of Bcl-2-associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.04	35.0	3	2	1
PRT	sp|Q9H425-2|CA198_HUMAN	Isoform 2 of Uncharacterized protein C1orf198 OS=Homo sapiens OX=9606 GN=C1orf198	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.10	35.0	2	1	0
PRT	sp|O14908-2|GIPC1_HUMAN	Isoform 2 of PDZ domain-containing protein GIPC1 OS=Homo sapiens OX=9606 GN=GIPC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.08	35.0	1	1	1
PRT	sp|Q9NQS1|AVEN_HUMAN	Cell death regulator Aven OS=Homo sapiens OX=9606 GN=AVEN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	251-UNIMOD:4	0.06	35.0	1	1	1
PRT	sp|Q7Z6M1-2|RABEK_HUMAN	Isoform 2 of Rab9 effector protein with kelch motifs OS=Homo sapiens OX=9606 GN=RABEPK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	109-UNIMOD:267	0.07	35.0	2	1	0
PRT	sp|P12956|XRCC6_HUMAN	X-ray repair cross-complementing protein 6 OS=Homo sapiens OX=9606 GN=XRCC6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null	488-UNIMOD:267,203-UNIMOD:35,206-UNIMOD:188	0.10	35.0	7	4	2
PRT	sp|P33991|MCM4_HUMAN	DNA replication licensing factor MCM4 OS=Homo sapiens OX=9606 GN=MCM4 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.03	35.0	2	2	2
PRT	sp|Q92620|PRP16_HUMAN	Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Homo sapiens OX=9606 GN=DHX38 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.01	35.0	2	1	0
PRT	sp|P17980|PRS6A_HUMAN	26S proteasome regulatory subunit 6A OS=Homo sapiens OX=9606 GN=PSMC3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null	334-UNIMOD:267,344-UNIMOD:267	0.07	35.0	4	2	1
PRT	sp|Q9NR45|SIAS_HUMAN	Sialic acid synthase OS=Homo sapiens OX=9606 GN=NANS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	300-UNIMOD:188,315-UNIMOD:188	0.08	35.0	5	2	1
PRT	sp|Q8WUY1|THEM6_HUMAN	Protein THEM6 OS=Homo sapiens OX=9606 GN=THEM6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	69-UNIMOD:267	0.08	35.0	2	1	0
PRT	sp|Q676U5-5|A16L1_HUMAN	Isoform 5 of Autophagy-related protein 16-1 OS=Homo sapiens OX=9606 GN=ATG16L1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	153-UNIMOD:4	0.06	35.0	1	1	1
PRT	sp|P23786|CPT2_HUMAN	Carnitine O-palmitoyltransferase 2, mitochondrial OS=Homo sapiens OX=9606 GN=CPT2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	1	1	1
PRT	sp|P06733|ENOA_HUMAN	Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null	193-UNIMOD:188	0.09	35.0	5	3	1
PRT	sp|P60842|IF4A1_HUMAN	Eukaryotic initiation factor 4A-I OS=Homo sapiens OX=9606 GN=EIF4A1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null		0.04	35.0	1	1	0
PRT	sp|P13804|ETFA_HUMAN	Electron transfer flavoprotein subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=ETFA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	null	102-UNIMOD:28,109-UNIMOD:4,117-UNIMOD:188	0.05	35.0	2	1	0
PRT	sp|Q9H4Z3|CAPAM_HUMAN	mRNA (2'-O-methyladenosine-N(6)-)-methyltransferase OS=Homo sapiens OX=9606 GN=PCIF1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null		0.03	35.0	1	1	1
PRT	sp|P50502|F10A1_HUMAN	Hsc70-interacting protein OS=Homo sapiens OX=9606 GN=ST13 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.08	34.0	2	2	2
PRT	sp|P61923-5|COPZ1_HUMAN	Isoform 5 of Coatomer subunit zeta-1 OS=Homo sapiens OX=9606 GN=COPZ1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.10	34.0	1	1	1
PRT	sp|Q8IWS0-4|PHF6_HUMAN	Isoform 4 of PHD finger protein 6 OS=Homo sapiens OX=9606 GN=PHF6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	211-UNIMOD:4,214-UNIMOD:4,224-UNIMOD:267,82-UNIMOD:4,85-UNIMOD:4,87-UNIMOD:4,94-UNIMOD:4	0.11	34.0	5	2	1
PRT	sp|Q08J23-3|NSUN2_HUMAN	Isoform 3 of RNA cytosine C(5)-methyltransferase NSUN2 OS=Homo sapiens OX=9606 GN=NSUN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	148-UNIMOD:267	0.03	34.0	2	1	0
PRT	sp|Q01813-2|PFKAP_HUMAN	Isoform 2 of ATP-dependent 6-phosphofructokinase, platelet type OS=Homo sapiens OX=9606 GN=PFKP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	115-UNIMOD:4,392-UNIMOD:188,400-UNIMOD:188	0.06	34.0	4	3	2
PRT	sp|P62277|RS13_HUMAN	40S ribosomal protein S13 OS=Homo sapiens OX=9606 GN=RPS13 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	93-UNIMOD:188	0.11	34.0	2	1	0
PRT	sp|P62256-2|UBE2H_HUMAN	Isoform 2 of Ubiquitin-conjugating enzyme E2 H OS=Homo sapiens OX=9606 GN=UBE2H	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	37-UNIMOD:188	0.11	34.0	2	1	0
PRT	sp|P31942-2|HNRH3_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein H3 OS=Homo sapiens OX=9606 GN=HNRNPH3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.04	34.0	1	1	1
PRT	sp|Q9Y678|COPG1_HUMAN	Coatomer subunit gamma-1 OS=Homo sapiens OX=9606 GN=COPG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	325-UNIMOD:4,338-UNIMOD:267	0.03	34.0	3	1	0
PRT	sp|O00330-3|ODPX_HUMAN	Isoform 3 of Pyruvate dehydrogenase protein X component, mitochondrial OS=Homo sapiens OX=9606 GN=PDHX	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	193-UNIMOD:267	0.03	34.0	1	1	1
PRT	sp|O75436|VP26A_HUMAN	Vacuolar protein sorting-associated protein 26A OS=Homo sapiens OX=9606 GN=VPS26A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	51-UNIMOD:188	0.04	34.0	2	1	0
PRT	sp|Q8IV08|PLD3_HUMAN	5'-3' exonuclease PLD3 OS=Homo sapiens OX=9606 GN=PLD3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.06	34.0	1	1	1
PRT	sp|Q14103-4|HNRPD_HUMAN	Isoform 4 of Heterogeneous nuclear ribonucleoprotein D0 OS=Homo sapiens OX=9606 GN=HNRNPD	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	207-UNIMOD:4	0.11	34.0	4	3	2
PRT	sp|P13693|TCTP_HUMAN	Translationally-controlled tumor protein OS=Homo sapiens OX=9606 GN=TPT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	28-UNIMOD:4	0.09	34.0	2	1	0
PRT	sp|P53999|TCP4_HUMAN	Activated RNA polymerase II transcriptional coactivator p15 OS=Homo sapiens OX=9606 GN=SUB1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	101-UNIMOD:188,114-UNIMOD:188	0.12	34.0	1	1	1
PRT	sp|P63000|RAC1_HUMAN	Ras-related C3 botulinum toxin substrate 1 OS=Homo sapiens OX=9606 GN=RAC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	133-UNIMOD:188,147-UNIMOD:188	0.08	34.0	3	1	0
PRT	sp|P08670|VIME_HUMAN	Vimentin OS=Homo sapiens OX=9606 GN=VIM PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	223-UNIMOD:188,235-UNIMOD:188,139-UNIMOD:188,143-UNIMOD:188,45-UNIMOD:267,50-UNIMOD:267	0.09	34.0	5	3	1
PRT	sp|Q9Y6C9|MTCH2_HUMAN	Mitochondrial carrier homolog 2 OS=Homo sapiens OX=9606 GN=MTCH2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	79-UNIMOD:4,90-UNIMOD:188	0.05	34.0	2	1	0
PRT	sp|O75223-2|GGCT_HUMAN	Isoform 2 of Gamma-glutamylcyclotransferase OS=Homo sapiens OX=9606 GN=GGCT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	50-UNIMOD:188,59-UNIMOD:188	0.13	34.0	2	1	0
PRT	sp|P48739|PIPNB_HUMAN	Phosphatidylinositol transfer protein beta isoform OS=Homo sapiens OX=9606 GN=PITPNB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	86-UNIMOD:188,74-UNIMOD:35	0.05	34.0	3	1	0
PRT	sp|P36542-2|ATPG_HUMAN	Isoform Heart of ATP synthase subunit gamma, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.09	34.0	2	2	2
PRT	sp|O95347-2|SMC2_HUMAN	Isoform 2 of Structural maintenance of chromosomes protein 2 OS=Homo sapiens OX=9606 GN=SMC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.01	34.0	1	1	1
PRT	sp|Q01831-2|XPC_HUMAN	Isoform 2 of DNA repair protein complementing XP-C cells OS=Homo sapiens OX=9606 GN=XPC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	187-UNIMOD:4,203-UNIMOD:267	0.02	34.0	2	1	0
PRT	sp|O95858|TSN15_HUMAN	Tetraspanin-15 OS=Homo sapiens OX=9606 GN=TSPAN15 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	171-UNIMOD:4,179-UNIMOD:4,185-UNIMOD:4,186-UNIMOD:4	0.08	34.0	1	1	1
PRT	sp|O00154-6|BACH_HUMAN	Isoform 6 of Cytosolic acyl coenzyme A thioester hydrolase OS=Homo sapiens OX=9606 GN=ACOT7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	237-UNIMOD:4	0.08	34.0	2	2	2
PRT	sp|Q15149-7|PLEC_HUMAN	Isoform 7 of Plectin OS=Homo sapiens OX=9606 GN=PLEC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	2549-UNIMOD:267,2561-UNIMOD:267,595-UNIMOD:188,3188-UNIMOD:267,3199-UNIMOD:267,544-UNIMOD:267,555-UNIMOD:267,1687-UNIMOD:267,1697-UNIMOD:267,1181-UNIMOD:267,1195-UNIMOD:267,2884-UNIMOD:188,2888-UNIMOD:188,1581-UNIMOD:267,1590-UNIMOD:267,1469-UNIMOD:267,1477-UNIMOD:267,4076-UNIMOD:4,4085-UNIMOD:4,1017-UNIMOD:188,1032-UNIMOD:267	0.04	34.0	24	13	5
PRT	sp|P30405|PPIF_HUMAN	Peptidyl-prolyl cis-trans isomerase F, mitochondrial OS=Homo sapiens OX=9606 GN=PPIF PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null	104-UNIMOD:4,118-UNIMOD:188	0.18	34.0	2	2	2
PRT	sp|P16949|STMN1_HUMAN	Stathmin OS=Homo sapiens OX=9606 GN=STMN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	29-UNIMOD:188,41-UNIMOD:188	0.10	34.0	3	1	0
PRT	sp|Q9Y2H0-3|DLGP4_HUMAN	Isoform 3 of Disks large-associated protein 4 OS=Homo sapiens OX=9606 GN=DLGAP4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	197-UNIMOD:4,211-UNIMOD:267	0.04	34.0	2	1	0
PRT	sp|Q3ZCQ8-2|TIM50_HUMAN	Isoform 2 of Mitochondrial import inner membrane translocase subunit TIM50 OS=Homo sapiens OX=9606 GN=TIMM50	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	135-UNIMOD:267,146-UNIMOD:267	0.06	34.0	2	2	2
PRT	sp|P21399|ACOC_HUMAN	Cytoplasmic aconitate hydratase OS=Homo sapiens OX=9606 GN=ACO1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	2-UNIMOD:1,19-UNIMOD:188,20-UNIMOD:188	0.02	34.0	3	1	0
PRT	sp|Q14684-2|RRP1B_HUMAN	Isoform 2 of Ribosomal RNA processing protein 1 homolog B OS=Homo sapiens OX=9606 GN=RRP1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	658-UNIMOD:188	0.02	34.0	2	1	0
PRT	sp|P62491-2|RB11A_HUMAN	Isoform 2 of Ras-related protein Rab-11A OS=Homo sapiens OX=9606 GN=RAB11A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.10	34.0	1	1	1
PRT	sp|Q7KZ85|SPT6H_HUMAN	Transcription elongation factor SPT6 OS=Homo sapiens OX=9606 GN=SUPT6H PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.01	34.0	2	1	0
PRT	sp|P05976-2|MYL1_HUMAN	Isoform MLC3 of Myosin light chain 1/3, skeletal muscle isoform OS=Homo sapiens OX=9606 GN=MYL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.11	34.0	2	1	0
PRT	sp|Q9UHX1-4|PUF60_HUMAN	Isoform 4 of Poly(U)-binding-splicing factor PUF60 OS=Homo sapiens OX=9606 GN=PUF60	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	144-UNIMOD:267,163-UNIMOD:267,247-UNIMOD:35	0.11	34.0	4	2	1
PRT	sp|P04406-2|G3P_HUMAN	Isoform 2 of Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	97-UNIMOD:188,292-UNIMOD:188,75-UNIMOD:188,289-UNIMOD:35	0.24	34.0	11	5	2
PRT	sp|O60488-2|ACSL4_HUMAN	Isoform Short of Long-chain-fatty-acid--CoA ligase 4 OS=Homo sapiens OX=9606 GN=ACSL4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	107-UNIMOD:188,109-UNIMOD:188,172-UNIMOD:188,180-UNIMOD:4,182-UNIMOD:188,379-UNIMOD:4,385-UNIMOD:188,386-UNIMOD:188	0.07	34.0	3	3	3
PRT	sp|P55072|TERA_HUMAN	Transitional endoplasmic reticulum ATPase OS=Homo sapiens OX=9606 GN=VCP PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null	105-UNIMOD:4,46-UNIMOD:35	0.04	34.0	2	2	2
PRT	sp|O60506-4|HNRPQ_HUMAN	Isoform 4 of Heterogeneous nuclear ribonucleoprotein Q OS=Homo sapiens OX=9606 GN=SYNCRIP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	168-UNIMOD:188,171-UNIMOD:267	0.06	34.0	2	1	0
PRT	sp|O43390|HNRPR_HUMAN	Heterogeneous nuclear ribonucleoprotein R OS=Homo sapiens OX=9606 GN=HNRNPR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	292-UNIMOD:4,300-UNIMOD:188	0.06	34.0	3	2	1
PRT	sp|P35606|COPB2_HUMAN	Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	186-UNIMOD:188	0.02	34.0	1	1	0
PRT	sp|Q68CZ2|TENS3_HUMAN	Tensin-3 OS=Homo sapiens OX=9606 GN=TNS3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null		0.01	34.0	1	1	1
PRT	sp|Q9ULX3|NOB1_HUMAN	RNA-binding protein NOB1 OS=Homo sapiens OX=9606 GN=NOB1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	34.0	null	16-UNIMOD:267	0.06	34.0	2	2	2
PRT	sp|P02768|ALBU_HUMAN	Serum albumin OS=Homo sapiens OX=9606 GN=ALB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	34.0	null	224-UNIMOD:4	0.04	34.0	5	2	1
PRT	sp|P62851|RS25_HUMAN	40S ribosomal protein S25 OS=Homo sapiens OX=9606 GN=RPS25 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	43-UNIMOD:188,52-UNIMOD:188,94-UNIMOD:188,98-UNIMOD:188	0.21	33.0	3	2	1
PRT	sp|P61247|RS3A_HUMAN	40S ribosomal protein S3a OS=Homo sapiens OX=9606 GN=RPS3A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	201-UNIMOD:4,213-UNIMOD:267,96-UNIMOD:4,107-UNIMOD:267,85-UNIMOD:188,94-UNIMOD:188,240-UNIMOD:188	0.20	33.0	9	4	1
PRT	sp|Q9BSH5|HDHD3_HUMAN	Haloacid dehalogenase-like hydrolase domain-containing protein 3 OS=Homo sapiens OX=9606 GN=HDHD3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.07	33.0	1	1	1
PRT	sp|Q13423|NNTM_HUMAN	NAD(P) transhydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=NNT PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	2	2	2
PRT	sp|O00410-2|IPO5_HUMAN	Isoform 2 of Importin-5 OS=Homo sapiens OX=9606 GN=IPO5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	152-UNIMOD:188,50-UNIMOD:4	0.03	33.0	4	2	1
PRT	sp|Q9Y5L4|TIM13_HUMAN	Mitochondrial import inner membrane translocase subunit Tim13 OS=Homo sapiens OX=9606 GN=TIMM13 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	50-UNIMOD:4,53-UNIMOD:188,64-UNIMOD:188	0.17	33.0	2	1	0
PRT	sp|Q13435|SF3B2_HUMAN	Splicing factor 3B subunit 2 OS=Homo sapiens OX=9606 GN=SF3B2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	857-UNIMOD:188,870-UNIMOD:188	0.02	33.0	3	1	0
PRT	sp|P12429|ANXA3_HUMAN	Annexin A3 OS=Homo sapiens OX=9606 GN=ANXA3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null	120-UNIMOD:267	0.11	33.0	4	3	2
PRT	sp|P22626-2|ROA2_HUMAN	Isoform A2 of Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	156-UNIMOD:188,178-UNIMOD:267,188-UNIMOD:267	0.09	33.0	4	2	0
PRT	sp|Q07955|SRSF1_HUMAN	Serine/arginine-rich splicing factor 1 OS=Homo sapiens OX=9606 GN=SRSF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null	65-UNIMOD:267,74-UNIMOD:267,191-UNIMOD:267	0.14	33.0	5	2	0
PRT	sp|O00515|LAD1_HUMAN	Ladinin-1 OS=Homo sapiens OX=9606 GN=LAD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	428-UNIMOD:4	0.07	33.0	3	2	1
PRT	sp|Q8N1B4-2|VPS52_HUMAN	Isoform 2 of Vacuolar protein sorting-associated protein 52 homolog OS=Homo sapiens OX=9606 GN=VPS52	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	246-UNIMOD:267	0.04	33.0	2	1	0
PRT	sp|P12081-4|HARS1_HUMAN	Isoform 4 of Histidine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=HARS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	100-UNIMOD:188	0.03	33.0	1	1	1
PRT	sp|Q93008-1|USP9X_HUMAN	Isoform 2 of Probable ubiquitin carboxyl-terminal hydrolase FAF-X OS=Homo sapiens OX=9606 GN=USP9X	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	1759-UNIMOD:188	0.01	33.0	5	2	1
PRT	sp|Q9H0G5|NSRP1_HUMAN	Nuclear speckle splicing regulatory protein 1 OS=Homo sapiens OX=9606 GN=NSRP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	199-UNIMOD:188	0.03	33.0	2	1	0
PRT	sp|Q9UBQ7|GRHPR_HUMAN	Glyoxylate reductase/hydroxypyruvate reductase OS=Homo sapiens OX=9606 GN=GRHPR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	286-UNIMOD:188	0.08	33.0	3	1	0
PRT	sp|Q92945|FUBP2_HUMAN	Far upstream element-binding protein 2 OS=Homo sapiens OX=9606 GN=KHSRP PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	359-UNIMOD:188,368-UNIMOD:188	0.05	33.0	3	2	1
PRT	sp|P61978-3|HNRPK_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	160-UNIMOD:4,161-UNIMOD:4,167-UNIMOD:267,37-UNIMOD:267,46-UNIMOD:267,42-UNIMOD:35,195-UNIMOD:188,197-UNIMOD:267	0.09	33.0	7	3	0
PRT	sp|Q92530|PSMF1_HUMAN	Proteasome inhibitor PI31 subunit OS=Homo sapiens OX=9606 GN=PSMF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	148-UNIMOD:188	0.06	33.0	2	1	0
PRT	sp|P23526|SAHH_HUMAN	Adenosylhomocysteinase OS=Homo sapiens OX=9606 GN=AHCY PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null	167-UNIMOD:35,174-UNIMOD:188,186-UNIMOD:188,33-UNIMOD:35,20-UNIMOD:188,34-UNIMOD:267,29-UNIMOD:35	0.09	33.0	14	2	0
PRT	sp|P16403|H12_HUMAN	Histone H1.2 OS=Homo sapiens OX=9606 GN=H1-2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	34-UNIMOD:188,46-UNIMOD:188	0.07	33.0	6	1	0
PRT	sp|O94905|ERLN2_HUMAN	Erlin-2 OS=Homo sapiens OX=9606 GN=ERLIN2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.04	33.0	1	1	1
PRT	sp|Q96JJ7-2|TMX3_HUMAN	Isoform 2 of Protein disulfide-isomerase TMX3 OS=Homo sapiens OX=9606 GN=TMX3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.08	33.0	1	1	1
PRT	sp|O43159|RRP8_HUMAN	Ribosomal RNA-processing protein 8 OS=Homo sapiens OX=9606 GN=RRP8 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	282-UNIMOD:267	0.03	33.0	3	1	0
PRT	sp|P53004|BIEA_HUMAN	Biliverdin reductase A OS=Homo sapiens OX=9606 GN=BLVRA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	269-UNIMOD:188,275-UNIMOD:188	0.05	33.0	2	1	0
PRT	sp|P33992|MCM5_HUMAN	DNA replication licensing factor MCM5 OS=Homo sapiens OX=9606 GN=MCM5 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	243-UNIMOD:267,696-UNIMOD:188	0.04	33.0	4	2	0
PRT	sp|Q9UQ80|PA2G4_HUMAN	Proliferation-associated protein 2G4 OS=Homo sapiens OX=9606 GN=PA2G4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	158-UNIMOD:188,172-UNIMOD:188,149-UNIMOD:4,155-UNIMOD:267	0.10	33.0	7	3	1
PRT	sp|Q9NR19|ACSA_HUMAN	Acetyl-coenzyme A synthetase, cytoplasmic OS=Homo sapiens OX=9606 GN=ACSS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null	227-UNIMOD:188,236-UNIMOD:188,638-UNIMOD:188,656-UNIMOD:188	0.05	33.0	7	2	0
PRT	sp|O75643|U520_HUMAN	U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens OX=9606 GN=SNRNP200 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	1166-UNIMOD:267	0.01	33.0	4	2	1
PRT	sp|P09327|VILI_HUMAN	Villin-1 OS=Homo sapiens OX=9606 GN=VIL1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	268-UNIMOD:267,624-UNIMOD:4,223-UNIMOD:35	0.05	33.0	6	3	1
PRT	sp|P23193|TCEA1_HUMAN	Transcription elongation factor A protein 1 OS=Homo sapiens OX=9606 GN=TCEA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	29-UNIMOD:188,32-UNIMOD:188	0.05	33.0	2	1	0
PRT	sp|Q9Y3B4|SF3B6_HUMAN	Splicing factor 3B subunit 6 OS=Homo sapiens OX=9606 GN=SF3B6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	74-UNIMOD:4,83-UNIMOD:4,85-UNIMOD:267	0.12	33.0	2	1	0
PRT	sp|Q96C19|EFHD2_HUMAN	EF-hand domain-containing protein D2 OS=Homo sapiens OX=9606 GN=EFHD2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.07	33.0	1	1	1
PRT	sp|Q15185-3|TEBP_HUMAN	Isoform 3 of Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	35-UNIMOD:188,40-UNIMOD:4,48-UNIMOD:188	0.21	33.0	5	2	1
PRT	sp|P78371-2|TCPB_HUMAN	Isoform 2 of T-complex protein 1 subunit beta OS=Homo sapiens OX=9606 GN=CCT2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	348-UNIMOD:4,355-UNIMOD:188	0.03	33.0	2	1	0
PRT	sp|P16989-2|YBOX3_HUMAN	Isoform 2 of Y-box-binding protein 3 OS=Homo sapiens OX=9606 GN=YBX3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.17	33.0	1	1	1
PRT	sp|Q8N9N8|EIF1A_HUMAN	Probable RNA-binding protein EIF1AD OS=Homo sapiens OX=9606 GN=EIF1AD PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	48-UNIMOD:267	0.10	33.0	3	1	0
PRT	sp|P07910-4|HNRPC_HUMAN	Isoform 4 of Heterogeneous nuclear ribonucleoproteins C1/C2 OS=Homo sapiens OX=9606 GN=HNRNPC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	29-UNIMOD:188,30-UNIMOD:188	0.06	33.0	2	1	0
PRT	sp|P07686|HEXB_HUMAN	Beta-hexosaminidase subunit beta OS=Homo sapiens OX=9606 GN=HEXB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	300-UNIMOD:188	0.03	33.0	2	1	0
PRT	sp|Q9NPA0|EMC7_HUMAN	ER membrane protein complex subunit 7 OS=Homo sapiens OX=9606 GN=EMC7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	79-UNIMOD:188	0.06	33.0	2	1	0
PRT	sp|P08237-2|PFKAM_HUMAN	Isoform 2 of ATP-dependent 6-phosphofructokinase, muscle type OS=Homo sapiens OX=9606 GN=PFKM	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	414-UNIMOD:188	0.02	33.0	2	1	0
PRT	sp|Q8IZ83|A16A1_HUMAN	Aldehyde dehydrogenase family 16 member A1 OS=Homo sapiens OX=9606 GN=ALDH16A1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	1	1	1
PRT	sp|P46777|RL5_HUMAN	60S ribosomal protein L5 OS=Homo sapiens OX=9606 GN=RPL5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	62-UNIMOD:4	0.05	33.0	1	1	1
PRT	sp|P45880-2|VDAC2_HUMAN	Isoform 2 of Voltage-dependent anion-selective channel protein 2 OS=Homo sapiens OX=9606 GN=VDAC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	65-UNIMOD:4,63-UNIMOD:188,74-UNIMOD:188	0.05	33.0	2	1	0
PRT	sp|P41240|CSK_HUMAN	Tyrosine-protein kinase CSK OS=Homo sapiens OX=9606 GN=CSK PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	31-UNIMOD:4	0.04	33.0	1	1	1
PRT	sp|Q9UPN3-2|MACF1_HUMAN	Isoform 2 of Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	null	3534-UNIMOD:28,3548-UNIMOD:267	0.00	33.0	1	1	1
PRT	sp|Q9UKX7|NUP50_HUMAN	Nuclear pore complex protein Nup50 OS=Homo sapiens OX=9606 GN=NUP50 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null		0.07	33.0	1	1	1
PRT	sp|P17987|TCPA_HUMAN	T-complex protein 1 subunit alpha OS=Homo sapiens OX=9606 GN=TCP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	480-UNIMOD:267,397-UNIMOD:4,400-UNIMOD:188	0.07	32.0	4	3	2
PRT	sp|Q9NNW5|WDR6_HUMAN	WD repeat-containing protein 6 OS=Homo sapiens OX=9606 GN=WDR6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	569-UNIMOD:188	0.03	32.0	1	1	1
PRT	sp|Q99808|S29A1_HUMAN	Equilibrative nucleoside transporter 1 OS=Homo sapiens OX=9606 GN=SLC29A1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.05	32.0	2	1	0
PRT	sp|Q5VSL9-2|STRP1_HUMAN	Isoform 2 of Striatin-interacting protein 1 OS=Homo sapiens OX=9606 GN=STRIP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	703-UNIMOD:4,711-UNIMOD:267	0.03	32.0	2	1	0
PRT	sp|Q14498-3|RBM39_HUMAN	Isoform 3 of RNA-binding protein 39 OS=Homo sapiens OX=9606 GN=RBM39	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|P36543-2|VATE1_HUMAN	Isoform 2 of V-type proton ATPase subunit E 1 OS=Homo sapiens OX=9606 GN=ATP6V1E1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.07	32.0	2	1	0
PRT	sp|Q92769-3|HDAC2_HUMAN	Isoform 2 of Histone deacetylase 2 OS=Homo sapiens OX=9606 GN=HDAC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	1	1	1
PRT	sp|Q96AE4|FUBP1_HUMAN	Far upstream element-binding protein 1 OS=Homo sapiens OX=9606 GN=FUBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	332-UNIMOD:4,344-UNIMOD:267,332-UNIMOD:385	0.04	32.0	5	2	1
PRT	sp|P32969|RL9_HUMAN	60S ribosomal protein L9 OS=Homo sapiens OX=9606 GN=RPL9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	50-UNIMOD:188,174-UNIMOD:188,184-UNIMOD:188	0.14	32.0	3	2	1
PRT	sp|Q9Y2Q3-4|GSTK1_HUMAN	Isoform 4 of Glutathione S-transferase kappa 1 OS=Homo sapiens OX=9606 GN=GSTK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	73-UNIMOD:188	0.09	32.0	2	1	0
PRT	sp|Q9C0C9|UBE2O_HUMAN	(E3-independent) E2 ubiquitin-conjugating enzyme OS=Homo sapiens OX=9606 GN=UBE2O PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	942-UNIMOD:188	0.01	32.0	2	1	0
PRT	sp|Q13526|PIN1_HUMAN	Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 OS=Homo sapiens OX=9606 GN=PIN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.10	32.0	2	1	0
PRT	sp|P61160|ARP2_HUMAN	Actin-related protein 2 OS=Homo sapiens OX=9606 GN=ACTR2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	214-UNIMOD:267	0.07	32.0	5	2	1
PRT	sp|P55786-2|PSA_HUMAN	Isoform 2 of Puromycin-sensitive aminopeptidase OS=Homo sapiens OX=9606 GN=NPEPPS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	685-UNIMOD:188	0.02	32.0	2	1	0
PRT	sp|P20839-2|IMDH1_HUMAN	Isoform 2 of Inosine-5'-monophosphate dehydrogenase 1 OS=Homo sapiens OX=9606 GN=IMPDH1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	1	1	1
PRT	sp|Q06203|PUR1_HUMAN	Amidophosphoribosyltransferase OS=Homo sapiens OX=9606 GN=PPAT PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	130-UNIMOD:267,271-UNIMOD:267	0.08	32.0	4	3	2
PRT	sp|Q15084-3|PDIA6_HUMAN	Isoform 3 of Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 GN=PDIA6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	213-UNIMOD:188,228-UNIMOD:267,107-UNIMOD:267,115-UNIMOD:267	0.10	32.0	6	3	0
PRT	sp|P16401|H15_HUMAN	Histone H1.5 OS=Homo sapiens OX=9606 GN=H1-5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	37-UNIMOD:188,49-UNIMOD:188,66-UNIMOD:188,67-UNIMOD:188	0.11	32.0	6	2	0
PRT	sp|Q9BRR8|GPTC1_HUMAN	G patch domain-containing protein 1 OS=Homo sapiens OX=9606 GN=GPATCH1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|Q8WXX5|DNJC9_HUMAN	DnaJ homolog subfamily C member 9 OS=Homo sapiens OX=9606 GN=DNAJC9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	107-UNIMOD:188,118-UNIMOD:188	0.05	32.0	2	1	0
PRT	sp|Q9Y4W6|AFG32_HUMAN	AFG3-like protein 2 OS=Homo sapiens OX=9606 GN=AFG3L2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	525-UNIMOD:4,543-UNIMOD:188	0.05	32.0	2	2	2
PRT	sp|P12814-2|ACTN1_HUMAN	Isoform 2 of Alpha-actinin-1 OS=Homo sapiens OX=9606 GN=ACTN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	577-UNIMOD:188	0.01	32.0	2	1	0
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	1185-UNIMOD:188	0.03	32.0	4	2	0
PRT	sp|Q9NR30-2|DDX21_HUMAN	Isoform 2 of Nucleolar RNA helicase 2 OS=Homo sapiens OX=9606 GN=DDX21	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	2	2	2
PRT	sp|O43809|CPSF5_HUMAN	Cleavage and polyadenylation specificity factor subunit 5 OS=Homo sapiens OX=9606 GN=NUDT21 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.08	32.0	1	1	1
PRT	sp|Q12800-2|TFCP2_HUMAN	Isoform 2 of Alpha-globin transcription factor CP2 OS=Homo sapiens OX=9606 GN=TFCP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	311-UNIMOD:267,318-UNIMOD:4,325-UNIMOD:267	0.04	32.0	1	1	1
PRT	sp|Q9H2U1|DHX36_HUMAN	ATP-dependent DNA/RNA helicase DHX36 OS=Homo sapiens OX=9606 GN=DHX36 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	108-UNIMOD:188,131-UNIMOD:188,91-UNIMOD:267,105-UNIMOD:188	0.04	32.0	4	2	1
PRT	sp|P08473|NEP_HUMAN	Neprilysin OS=Homo sapiens OX=9606 GN=MME PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|Q9UPN3-4|MACF1_HUMAN	Isoform 5 of Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.00	32.0	1	1	1
PRT	sp|Q9NXF1-2|TEX10_HUMAN	Isoform 2 of Testis-expressed protein 10 OS=Homo sapiens OX=9606 GN=TEX10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	586-UNIMOD:267	0.02	32.0	2	1	0
PRT	sp|Q14008-2|CKAP5_HUMAN	Isoform 2 of Cytoskeleton-associated protein 5 OS=Homo sapiens OX=9606 GN=CKAP5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.01	32.0	2	1	0
PRT	sp|P61289|PSME3_HUMAN	Proteasome activator complex subunit 3 OS=Homo sapiens OX=9606 GN=PSME3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	92-UNIMOD:4	0.06	32.0	2	1	0
PRT	sp|O43615|TIM44_HUMAN	Mitochondrial import inner membrane translocase subunit TIM44 OS=Homo sapiens OX=9606 GN=TIMM44 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	90-UNIMOD:267,101-UNIMOD:267,282-UNIMOD:188,293-UNIMOD:188	0.07	32.0	3	2	1
PRT	sp|Q9NRH3|TBG2_HUMAN	Tubulin gamma-2 chain OS=Homo sapiens OX=9606 GN=TUBG2 PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	201-UNIMOD:4	0.04	32.0	1	1	1
PRT	sp|P10644-2|KAP0_HUMAN	Isoform 2 of cAMP-dependent protein kinase type I-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	306-UNIMOD:267,317-UNIMOD:267	0.08	32.0	3	2	1
PRT	sp|Q9HB07|MYG1_HUMAN	UPF0160 protein MYG1, mitochondrial OS=Homo sapiens OX=9606 GN=C12orf10 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	123-UNIMOD:188,128-UNIMOD:188	0.05	32.0	2	1	0
PRT	sp|Q9NUL7|DDX28_HUMAN	Probable ATP-dependent RNA helicase DDX28 OS=Homo sapiens OX=9606 GN=DDX28 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|O75533|SF3B1_HUMAN	Splicing factor 3B subunit 1 OS=Homo sapiens OX=9606 GN=SF3B1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	700-UNIMOD:188	0.01	32.0	3	1	0
PRT	sp|Q7L5N1|CSN6_HUMAN	COP9 signalosome complex subunit 6 OS=Homo sapiens OX=9606 GN=COPS6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.05	32.0	1	1	1
PRT	sp|Q9Y2V2|CHSP1_HUMAN	Calcium-regulated heat-stable protein 1 OS=Homo sapiens OX=9606 GN=CARHSP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	2-UNIMOD:1	0.17	32.0	1	1	1
PRT	sp|Q8N0Y7|PGAM4_HUMAN	Probable phosphoglycerate mutase 4 OS=Homo sapiens OX=9606 GN=PGAM4 PE=3 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	138-UNIMOD:188,126-UNIMOD:35,176-UNIMOD:188,179-UNIMOD:188	0.16	32.0	7	2	0
PRT	sp|Q01082-3|SPTB2_HUMAN	Isoform 2 of Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	190-UNIMOD:267	0.02	32.0	4	2	0
PRT	sp|O75116|ROCK2_HUMAN	Rho-associated protein kinase 2 OS=Homo sapiens OX=9606 GN=ROCK2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	647-UNIMOD:267	0.01	32.0	2	1	0
PRT	sp|O95573|ACSL3_HUMAN	Long-chain-fatty-acid--CoA ligase 3 OS=Homo sapiens OX=9606 GN=ACSL3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|O95470|SGPL1_HUMAN	Sphingosine-1-phosphate lyase 1 OS=Homo sapiens OX=9606 GN=SGPL1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	247-UNIMOD:188	0.03	32.0	3	1	0
PRT	sp|Q9Y6M4-6|KC1G3_HUMAN	Isoform 6 of Casein kinase I isoform gamma-3 OS=Homo sapiens OX=9606 GN=CSNK1G3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	77-UNIMOD:188	0.05	32.0	1	1	1
PRT	sp|P50552|VASP_HUMAN	Vasodilator-stimulated phosphoprotein OS=Homo sapiens OX=9606 GN=VASP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	1	1	1
PRT	sp|Q9Y697-2|NFS1_HUMAN	Isoform Cytoplasmic of Cysteine desulfurase, mitochondrial OS=Homo sapiens OX=9606 GN=NFS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	1	1	1
PRT	sp|O43491-2|E41L2_HUMAN	Isoform 2 of Band 4.1-like protein 2 OS=Homo sapiens OX=9606 GN=EPB41L2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	663-UNIMOD:188	0.02	32.0	1	1	1
PRT	sp|Q9BV20-2|MTNA_HUMAN	Isoform 2 of Methylthioribose-1-phosphate isomerase OS=Homo sapiens OX=9606 GN=MRI1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.05	32.0	1	1	1
PRT	sp|Q6ZNB6|NFXL1_HUMAN	NF-X1-type zinc finger protein NFXL1 OS=Homo sapiens OX=9606 GN=NFXL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	null	269-UNIMOD:385,269-UNIMOD:4,273-UNIMOD:4,278-UNIMOD:4,281-UNIMOD:4,283-UNIMOD:188,779-UNIMOD:385,779-UNIMOD:4,783-UNIMOD:4,788-UNIMOD:4,792-UNIMOD:4	0.04	32.0	3	2	1
PRT	sp|O75694|NU155_HUMAN	Nuclear pore complex protein Nup155 OS=Homo sapiens OX=9606 GN=NUP155 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	1201-UNIMOD:4	0.01	32.0	1	1	1
PRT	sp|P62258|1433E_HUMAN	14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null		0.07	32.0	2	1	0
PRT	sp|P36578|RL4_HUMAN	60S ribosomal protein L4 OS=Homo sapiens OX=9606 GN=RPL4 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null		0.06	32.0	1	1	1
PRT	sp|Q8NI36|WDR36_HUMAN	WD repeat-containing protein 36 OS=Homo sapiens OX=9606 GN=WDR36 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|Q9H7Z3|NRDE2_HUMAN	Nuclear exosome regulator NRDE2 OS=Homo sapiens OX=9606 GN=NRDE2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	772-UNIMOD:188,777-UNIMOD:4,781-UNIMOD:4,784-UNIMOD:188	0.01	32.0	1	1	1
PRT	sp|Q7KZF4|SND1_HUMAN	Staphylococcal nuclease domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SND1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null	899-UNIMOD:267,910-UNIMOD:267	0.04	31.0	5	2	1
PRT	sp|P24928|RPB1_HUMAN	DNA-directed RNA polymerase II subunit RPB1 OS=Homo sapiens OX=9606 GN=POLR2A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	734-UNIMOD:267	0.01	31.0	2	1	0
PRT	sp|P0DMV8-2|HS71A_HUMAN	Isoform 2 of Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	287-UNIMOD:267	0.03	31.0	2	1	0
PRT	sp|Q96P11-3|NSUN5_HUMAN	Isoform 3 of Probable 28S rRNA (cytosine-C(5))-methyltransferase OS=Homo sapiens OX=9606 GN=NSUN5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	159-UNIMOD:4,177-UNIMOD:4	0.15	31.0	2	2	2
PRT	sp|Q00341-2|VIGLN_HUMAN	Isoform 2 of Vigilin OS=Homo sapiens OX=9606 GN=HDLBP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	123-UNIMOD:267,344-UNIMOD:267,157-UNIMOD:188	0.04	31.0	6	3	1
PRT	sp|O94776-2|MTA2_HUMAN	Isoform 2 of Metastasis-associated protein MTA2 OS=Homo sapiens OX=9606 GN=MTA2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	67-UNIMOD:267	0.03	31.0	3	1	0
PRT	sp|P09960-4|LKHA4_HUMAN	Isoform 4 of Leukotriene A-4 hydrolase OS=Homo sapiens OX=9606 GN=LTA4H	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	486-UNIMOD:267	0.03	31.0	1	1	1
PRT	sp|Q9UPP1-5|PHF8_HUMAN	Isoform 5 of Histone lysine demethylase PHF8 OS=Homo sapiens OX=9606 GN=PHF8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|Q9NQG5|RPR1B_HUMAN	Regulation of nuclear pre-mRNA domain-containing protein 1B OS=Homo sapiens OX=9606 GN=RPRD1B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	94-UNIMOD:267	0.05	31.0	2	1	0
PRT	sp|Q96FQ6|S10AG_HUMAN	Protein S100-A16 OS=Homo sapiens OX=9606 GN=S100A16 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	56-UNIMOD:267	0.13	31.0	2	1	0
PRT	sp|O14828-2|SCAM3_HUMAN	Isoform 2 of Secretory carrier-associated membrane protein 3 OS=Homo sapiens OX=9606 GN=SCAMP3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	105-UNIMOD:267	0.04	31.0	2	1	0
PRT	sp|P26641|EF1G_HUMAN	Elongation factor 1-gamma OS=Homo sapiens OX=9606 GN=EEF1G PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	428-UNIMOD:188	0.09	31.0	4	3	2
PRT	sp|P49589-2|SYCC_HUMAN	Isoform 2 of Cysteine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=CARS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	640-UNIMOD:188	0.04	31.0	3	2	1
PRT	sp|Q6PKG0-3|LARP1_HUMAN	Isoform 2 of La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.04	31.0	3	2	1
PRT	sp|O14562|UBFD1_HUMAN	Ubiquitin domain-containing protein UBFD1 OS=Homo sapiens OX=9606 GN=UBFD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.06	31.0	1	1	1
PRT	sp|P31040-2|SDHA_HUMAN	Isoform 2 of Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Homo sapiens OX=9606 GN=SDHA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	190-UNIMOD:4	0.02	31.0	1	1	1
PRT	sp|Q96T51-3|RUFY1_HUMAN	Isoform 3 of RUN and FYVE domain-containing protein 1 OS=Homo sapiens OX=9606 GN=RUFY1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	320-UNIMOD:4,328-UNIMOD:188	0.03	31.0	1	1	1
PRT	sp|Q9NV31|IMP3_HUMAN	U3 small nucleolar ribonucleoprotein protein IMP3 OS=Homo sapiens OX=9606 GN=IMP3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null	177-UNIMOD:267	0.09	31.0	3	1	0
PRT	sp|P47895|AL1A3_HUMAN	Aldehyde dehydrogenase family 1 member A3 OS=Homo sapiens OX=9606 GN=ALDH1A3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	409-UNIMOD:188,421-UNIMOD:188,44-UNIMOD:188	0.05	31.0	4	2	1
PRT	sp|P36969-2|GPX4_HUMAN	Isoform Cytoplasmic of Phospholipid hydroperoxide glutathione peroxidase OS=Homo sapiens OX=9606 GN=GPX4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	107-UNIMOD:4,118-UNIMOD:188	0.08	31.0	2	1	0
PRT	sp|P26599|PTBP1_HUMAN	Polypyrimidine tract-binding protein 1 OS=Homo sapiens OX=9606 GN=PTBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|P50416-2|CPT1A_HUMAN	Isoform 2 of Carnitine O-palmitoyltransferase 1, liver isoform OS=Homo sapiens OX=9606 GN=CPT1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	329-UNIMOD:267	0.02	31.0	2	1	0
PRT	sp|Q9UBQ0|VPS29_HUMAN	Vacuolar protein sorting-associated protein 29 OS=Homo sapiens OX=9606 GN=VPS29 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null	36-UNIMOD:4,41-UNIMOD:4	0.08	31.0	3	1	0
PRT	sp|P02545-2|LMNA_HUMAN	Isoform C of Prelamin-A/C OS=Homo sapiens OX=9606 GN=LMNA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	135-UNIMOD:188,144-UNIMOD:188,62-UNIMOD:267,72-UNIMOD:267,166-UNIMOD:267	0.11	31.0	8	5	2
PRT	sp|P62805|H4_HUMAN	Histone H4 OS=Homo sapiens OX=9606 GN=H4C1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.27	31.0	3	3	3
PRT	sp|Q96BS2-2|CHP3_HUMAN	Isoform 2 of Calcineurin B homologous protein 3 OS=Homo sapiens OX=9606 GN=TESC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.10	31.0	1	1	1
PRT	sp|Q15424-2|SAFB1_HUMAN	Isoform 2 of Scaffold attachment factor B1 OS=Homo sapiens OX=9606 GN=SAFB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	293-UNIMOD:4	0.02	31.0	1	1	1
PRT	sp|Q969G3-6|SMCE1_HUMAN	Isoform 6 of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 OS=Homo sapiens OX=9606 GN=SMARCE1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.09	31.0	2	2	2
PRT	sp|P55769|NH2L1_HUMAN	NHP2-like protein 1 OS=Homo sapiens OX=9606 GN=SNU13 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	21-UNIMOD:188,30-UNIMOD:4,33-UNIMOD:188	0.11	31.0	2	1	0
PRT	sp|Q13011|ECH1_HUMAN	Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial OS=Homo sapiens OX=9606 GN=ECH1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.05	31.0	1	1	1
PRT	sp|O15347|HMGB3_HUMAN	High mobility group protein B3 OS=Homo sapiens OX=9606 GN=HMGB3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null	30-UNIMOD:188,43-UNIMOD:188	0.08	31.0	2	1	0
PRT	sp|P22314-2|UBA1_HUMAN	Isoform 2 of Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	553-UNIMOD:188,564-UNIMOD:188,328-UNIMOD:267,28-UNIMOD:188,370-UNIMOD:35	0.07	31.0	7	4	1
PRT	sp|P17096|HMGA1_HUMAN	High mobility group protein HMG-I/HMG-Y OS=Homo sapiens OX=9606 GN=HMGA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	31-UNIMOD:188,46-UNIMOD:188	0.16	31.0	3	1	0
PRT	sp|P18858|DNLI1_HUMAN	DNA ligase 1 OS=Homo sapiens OX=9606 GN=LIG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	493-UNIMOD:188,504-UNIMOD:188	0.01	31.0	1	1	1
PRT	sp|Q13426-3|XRCC4_HUMAN	Isoform 3 of DNA repair protein XRCC4 OS=Homo sapiens OX=9606 GN=XRCC4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.06	31.0	2	1	0
PRT	sp|Q9Y221-2|NIP7_HUMAN	Isoform 2 of 60S ribosome subunit biogenesis protein NIP7 homolog OS=Homo sapiens OX=9606 GN=NIP7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	94-UNIMOD:188	0.11	31.0	2	1	0
PRT	sp|P20585|MSH3_HUMAN	DNA mismatch repair protein Msh3 OS=Homo sapiens OX=9606 GN=MSH3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	141-UNIMOD:4,142-UNIMOD:4	0.01	31.0	1	1	1
PRT	sp|Q96HC4-3|PDLI5_HUMAN	Isoform 3 of PDZ and LIM domain protein 5 OS=Homo sapiens OX=9606 GN=PDLIM5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	22-UNIMOD:188,34-UNIMOD:188,149-UNIMOD:267,151-UNIMOD:267	0.14	31.0	2	2	2
PRT	sp|P62070-3|RRAS2_HUMAN	Isoform 3 of Ras-related protein R-Ras2 OS=Homo sapiens OX=9606 GN=RRAS2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	138-UNIMOD:267	0.20	31.0	3	2	1
PRT	sp|Q53H12|AGK_HUMAN	Acylglycerol kinase, mitochondrial OS=Homo sapiens OX=9606 GN=AGK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	99-UNIMOD:188	0.04	31.0	2	1	0
PRT	sp|Q96H20-2|SNF8_HUMAN	Isoform 2 of Vacuolar-sorting protein SNF8 OS=Homo sapiens OX=9606 GN=SNF8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	130-UNIMOD:188	0.07	31.0	2	1	0
PRT	sp|Q9H7B2|RPF2_HUMAN	Ribosome production factor 2 homolog OS=Homo sapiens OX=9606 GN=RPF2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	265-UNIMOD:267	0.05	31.0	2	1	0
PRT	sp|P40926|MDHM_HUMAN	Malate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=MDH2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null	307-UNIMOD:188,314-UNIMOD:188,185-UNIMOD:188,191-UNIMOD:267,89-UNIMOD:4,93-UNIMOD:4	0.17	31.0	5	3	2
PRT	sp|P30086|PEBP1_HUMAN	Phosphatidylethanolamine-binding protein 1 OS=Homo sapiens OX=9606 GN=PEBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.09	31.0	1	1	1
PRT	sp|P62269|RS18_HUMAN	40S ribosomal protein S18 OS=Homo sapiens OX=9606 GN=RPS18 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	55-UNIMOD:267,66-UNIMOD:267	0.09	31.0	2	1	0
PRT	sp|Q92616|GCN1_HUMAN	eIF-2-alpha kinase activator GCN1 OS=Homo sapiens OX=9606 GN=GCN1 PE=1 SV=6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	68-UNIMOD:267,87-UNIMOD:188	0.01	31.0	3	1	0
PRT	sp|Q6UN15-4|FIP1_HUMAN	Isoform 4 of Pre-mRNA 3'-end-processing factor FIP1 OS=Homo sapiens OX=9606 GN=FIP1L1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.04	31.0	1	1	1
PRT	sp|P49755|TMEDA_HUMAN	Transmembrane emp24 domain-containing protein 10 OS=Homo sapiens OX=9606 GN=TMED10 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	168-UNIMOD:35	0.16	31.0	4	2	0
PRT	sp|Q12905|ILF2_HUMAN	Interleukin enhancer-binding factor 2 OS=Homo sapiens OX=9606 GN=ILF2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.06	31.0	1	1	1
PRT	sp|P42704|LPPRC_HUMAN	Leucine-rich PPR motif-containing protein, mitochondrial OS=Homo sapiens OX=9606 GN=LRPPRC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	130-UNIMOD:4,1049-UNIMOD:188,1059-UNIMOD:188,1347-UNIMOD:188	0.03	31.0	4	3	2
PRT	sp|P53621|COPA_HUMAN	Coatomer subunit alpha OS=Homo sapiens OX=9606 GN=COPA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	380-UNIMOD:4,453-UNIMOD:4	0.04	31.0	2	2	2
PRT	sp|P46013-2|KI67_HUMAN	Isoform Short of Proliferation marker protein Ki-67 OS=Homo sapiens OX=9606 GN=MKI67	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	1876-UNIMOD:188,1880-UNIMOD:188	0.01	31.0	4	2	1
PRT	sp|O76024|WFS1_HUMAN	Wolframin OS=Homo sapiens OX=9606 GN=WFS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	26-UNIMOD:267,37-UNIMOD:267	0.02	31.0	2	1	0
PRT	sp|P09651-3|ROA1_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.06	31.0	1	1	1
PRT	sp|Q99832|TCPH_HUMAN	T-complex protein 1 subunit eta OS=Homo sapiens OX=9606 GN=CCT7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.07	31.0	3	3	3
PRT	sp|P50995-2|ANX11_HUMAN	Isoform 2 of Annexin A11 OS=Homo sapiens OX=9606 GN=ANXA11	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	171-UNIMOD:267,177-UNIMOD:267	0.08	31.0	3	2	1
PRT	sp|P01116-2|RASK_HUMAN	Isoform 2B of GTPase KRas OS=Homo sapiens OX=9606 GN=KRAS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.08	31.0	1	1	1
PRT	sp|P38606-2|VATA_HUMAN	Isoform 2 of V-type proton ATPase catalytic subunit A OS=Homo sapiens OX=9606 GN=ATP6V1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	23-UNIMOD:267	0.05	31.0	3	2	1
PRT	sp|P23469-3|PTPRE_HUMAN	Isoform 3 of Receptor-type tyrosine-protein phosphatase epsilon OS=Homo sapiens OX=9606 GN=PTPRE	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|Q9H9Y6-4|RPA2_HUMAN	Isoform 4 of DNA-directed RNA polymerase I subunit RPA2 OS=Homo sapiens OX=9606 GN=POLR1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	595-UNIMOD:188,607-UNIMOD:188	0.02	31.0	2	1	0
PRT	sp|Q8WUM4|PDC6I_HUMAN	Programmed cell death 6-interacting protein OS=Homo sapiens OX=9606 GN=PDCD6IP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	327-UNIMOD:188,334-UNIMOD:188	0.01	31.0	2	1	0
PRT	sp|P78347-2|GTF2I_HUMAN	Isoform 2 of General transcription factor II-I OS=Homo sapiens OX=9606 GN=GTF2I	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	80-UNIMOD:4	0.03	31.0	2	2	1
PRT	sp|P63267|ACTH_HUMAN	Actin, gamma-enteric smooth muscle OS=Homo sapiens OX=9606 GN=ACTG2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	85-UNIMOD:188	0.05	31.0	2	1	0
PRT	sp|P19525-2|E2AK2_HUMAN	Isoform 2 of Interferon-induced, double-stranded RNA-activated protein kinase OS=Homo sapiens OX=9606 GN=EIF2AK2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	39-UNIMOD:267	0.03	31.0	2	1	0
PRT	sp|P04406|G3P_HUMAN	Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	31.0	null	227-UNIMOD:188,234-UNIMOD:267,80-UNIMOD:267,84-UNIMOD:188	0.10	31.0	4	2	0
PRT	sp|P07355|ANXA2_HUMAN	Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	49-UNIMOD:188,63-UNIMOD:267	0.05	31.0	1	1	0
PRT	sp|Q9Y266|NUDC_HUMAN	Nuclear migration protein nudC OS=Homo sapiens OX=9606 GN=NUDC PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	31.0	null	160-UNIMOD:188,173-UNIMOD:267	0.09	31.0	5	2	1
PRT	sp|P54577|SYYC_HUMAN	Tyrosine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=YARS1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	31.0	null	2-UNIMOD:1,10-UNIMOD:188,16-UNIMOD:267	0.07	31.0	5	2	1
PRT	sp|O60264|SMCA5_HUMAN	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Homo sapiens OX=9606 GN=SMARCA5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	31.0	null	98-UNIMOD:28,112-UNIMOD:188	0.03	31.0	6	2	0
PRT	sp|P38159|RBMX_HUMAN	RNA-binding motif protein, X chromosome OS=Homo sapiens OX=9606 GN=RBMX PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.05	31.0	1	1	1
PRT	sp|P50416|CPT1A_HUMAN	Carnitine O-palmitoyltransferase 1, liver isoform OS=Homo sapiens OX=9606 GN=CPT1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	329-UNIMOD:267	0.02	31.0	1	1	0
PRT	sp|Q9H089|LSG1_HUMAN	Large subunit GTPase 1 homolog OS=Homo sapiens OX=9606 GN=LSG1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	null	587-UNIMOD:28,594-UNIMOD:188,603-UNIMOD:267	0.03	31.0	1	1	1
PRT	sp|P16615-5|AT2A2_HUMAN	Isoform 5 of Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Homo sapiens OX=9606 GN=ATP2A2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	236-UNIMOD:267,246-UNIMOD:267,655-UNIMOD:267,666-UNIMOD:267	0.03	30.0	5	2	0
PRT	sp|P05023-2|AT1A1_HUMAN	Isoform 2 of Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens OX=9606 GN=ATP1A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	518-UNIMOD:4,526-UNIMOD:188	0.04	30.0	2	2	2
PRT	sp|Q6FI81|CPIN1_HUMAN	Anamorsin OS=Homo sapiens OX=9606 GN=CIAPIN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	285-UNIMOD:4,288-UNIMOD:4,297-UNIMOD:188,301-UNIMOD:188	0.06	30.0	2	1	0
PRT	sp|O95865|DDAH2_HUMAN	N(G),N(G)-dimethylarginine dimethylaminohydrolase 2 OS=Homo sapiens OX=9606 GN=DDAH2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	276-UNIMOD:4,282-UNIMOD:267	0.13	30.0	3	2	1
PRT	sp|Q9Y4E1-5|WAC2C_HUMAN	Isoform 5 of WASH complex subunit 2C OS=Homo sapiens OX=9606 GN=WASHC2C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|Q6Y7W6-4|GGYF2_HUMAN	Isoform 3 of GRB10-interacting GYF protein 2 OS=Homo sapiens OX=9606 GN=GIGYF2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	179-UNIMOD:267,192-UNIMOD:267	0.01	30.0	3	1	0
PRT	sp|O95373|IPO7_HUMAN	Importin-7 OS=Homo sapiens OX=9606 GN=IPO7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	107-UNIMOD:267	0.02	30.0	1	1	1
PRT	sp|P35579|MYH9_HUMAN	Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	1107-UNIMOD:267,1124-UNIMOD:267,1445-UNIMOD:188,1454-UNIMOD:188,1191-UNIMOD:267	0.04	30.0	10	6	3
PRT	sp|P51570|GALK1_HUMAN	Galactokinase OS=Homo sapiens OX=9606 GN=GALK1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.04	30.0	1	1	1
PRT	sp|P35610-3|SOAT1_HUMAN	Isoform 3 of Sterol O-acyltransferase 1 OS=Homo sapiens OX=9606 GN=SOAT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.04	30.0	1	1	1
PRT	sp|P41252|SYIC_HUMAN	Isoleucine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=IARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	87-UNIMOD:4,98-UNIMOD:188	0.01	30.0	2	1	0
PRT	sp|P09417-2|DHPR_HUMAN	Isoform 2 of Dihydropteridine reductase OS=Homo sapiens OX=9606 GN=QDPR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	130-UNIMOD:4,136-UNIMOD:188	0.07	30.0	2	1	0
PRT	sp|P09429|HMGB1_HUMAN	High mobility group protein B1 OS=Homo sapiens OX=9606 GN=HMGB1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	127-UNIMOD:188,43-UNIMOD:188	0.13	30.0	4	2	0
PRT	sp|Q13685|AAMP_HUMAN	Angio-associated migratory cell protein OS=Homo sapiens OX=9606 GN=AAMP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	410-UNIMOD:188	0.03	30.0	1	1	1
PRT	sp|P15311|EZRI_HUMAN	Ezrin OS=Homo sapiens OX=9606 GN=EZR PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	184-UNIMOD:188,193-UNIMOD:188	0.02	30.0	1	1	1
PRT	sp|Q9Y230-2|RUVB2_HUMAN	Isoform 2 of RuvB-like 2 OS=Homo sapiens OX=9606 GN=RUVBL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	308-UNIMOD:267	0.09	30.0	3	2	1
PRT	sp|Q9H8S9-2|MOB1A_HUMAN	Isoform 2 of MOB kinase activator 1A OS=Homo sapiens OX=9606 GN=MOB1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	42-UNIMOD:267	0.09	30.0	2	1	0
PRT	sp|P52948-6|NUP98_HUMAN	Isoform 6 of Nuclear pore complex protein Nup98-Nup96 OS=Homo sapiens OX=9606 GN=NUP98	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	1487-UNIMOD:4,1498-UNIMOD:188	0.01	30.0	2	1	0
PRT	sp|P60981-2|DEST_HUMAN	Isoform 2 of Destrin OS=Homo sapiens OX=9606 GN=DSTN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	118-UNIMOD:4,128-UNIMOD:267,98-UNIMOD:35	0.18	30.0	3	2	1
PRT	sp|Q9P0L0|VAPA_HUMAN	Vesicle-associated membrane protein-associated protein A OS=Homo sapiens OX=9606 GN=VAPA PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	30.0	null	24-UNIMOD:188,155-UNIMOD:28	0.14	30.0	2	2	2
PRT	sp|P52789|HXK2_HUMAN	Hexokinase-2 OS=Homo sapiens OX=9606 GN=HK2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	254-UNIMOD:267	0.03	30.0	3	2	1
PRT	sp|Q5JSH3-4|WDR44_HUMAN	Isoform 4 of WD repeat-containing protein 44 OS=Homo sapiens OX=9606 GN=WDR44	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	204-UNIMOD:188	0.02	30.0	2	1	0
PRT	sp|Q9BZK7|TBL1R_HUMAN	F-box-like/WD repeat-containing protein TBL1XR1 OS=Homo sapiens OX=9606 GN=TBL1XR1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	455-UNIMOD:267	0.03	30.0	3	1	0
PRT	sp|Q13347|EIF3I_HUMAN	Eukaryotic translation initiation factor 3 subunit I OS=Homo sapiens OX=9606 GN=EIF3I PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	76-UNIMOD:4,77-UNIMOD:267	0.04	30.0	2	1	0
PRT	sp|Q9NYL9|TMOD3_HUMAN	Tropomodulin-3 OS=Homo sapiens OX=9606 GN=TMOD3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.06	30.0	2	1	0
PRT	sp|Q14254|FLOT2_HUMAN	Flotillin-2 OS=Homo sapiens OX=9606 GN=FLOT2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	253-UNIMOD:267,264-UNIMOD:267	0.03	30.0	1	1	1
PRT	sp|Q96PK6|RBM14_HUMAN	RNA-binding protein 14 OS=Homo sapiens OX=9606 GN=RBM14 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	153-UNIMOD:188,164-UNIMOD:188	0.02	30.0	2	1	0
PRT	sp|P24666-4|PPAC_HUMAN	Isoform 4 of Low molecular weight phosphotyrosine protein phosphatase OS=Homo sapiens OX=9606 GN=ACP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.13	30.0	2	1	0
PRT	sp|P05787|K2C8_HUMAN	Keratin, type II cytoskeletal 8 OS=Homo sapiens OX=9606 GN=KRT8 PE=1 SV=7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	30.0	null	225-UNIMOD:267,264-UNIMOD:188,370-UNIMOD:28,328-UNIMOD:267,148-UNIMOD:267,149-UNIMOD:267,372-UNIMOD:267,378-UNIMOD:35,381-UNIMOD:188	0.23	30.0	16	9	5
PRT	sp|O00567|NOP56_HUMAN	Nucleolar protein 56 OS=Homo sapiens OX=9606 GN=NOP56 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	320-UNIMOD:188,87-UNIMOD:188	0.04	30.0	3	2	1
PRT	sp|P20700|LMNB1_HUMAN	Lamin-B1 OS=Homo sapiens OX=9606 GN=LMNB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	457-UNIMOD:188,473-UNIMOD:267,102-UNIMOD:188,109-UNIMOD:188	0.07	30.0	5	3	1
PRT	sp|Q92900-2|RENT1_HUMAN	Isoform 2 of Regulator of nonsense transcripts 1 OS=Homo sapiens OX=9606 GN=UPF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	1	1	0
PRT	sp|P63279|UBC9_HUMAN	SUMO-conjugating enzyme UBC9 OS=Homo sapiens OX=9606 GN=UBE2I PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	65-UNIMOD:188,74-UNIMOD:188,62-UNIMOD:35	0.09	30.0	4	1	0
PRT	sp|P06748|NPM_HUMAN	Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	278-UNIMOD:35,251-UNIMOD:35,257-UNIMOD:188,263-UNIMOD:188	0.10	30.0	2	2	2
PRT	sp|P20618|PSB1_HUMAN	Proteasome subunit beta type-1 OS=Homo sapiens OX=9606 GN=PSMB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	198-UNIMOD:267	0.06	30.0	1	1	1
PRT	sp|Q53GS9-2|SNUT2_HUMAN	Isoform 2 of U4/U6.U5 tri-snRNP-associated protein 2 OS=Homo sapiens OX=9606 GN=USP39	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.05	30.0	1	1	1
PRT	sp|P53396|ACLY_HUMAN	ATP-citrate synthase OS=Homo sapiens OX=9606 GN=ACLY PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	780-UNIMOD:188,788-UNIMOD:267	0.04	30.0	4	3	2
PRT	sp|P62314|SMD1_HUMAN	Small nuclear ribonucleoprotein Sm D1 OS=Homo sapiens OX=9606 GN=SNRPD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	50-UNIMOD:267,61-UNIMOD:267	0.12	30.0	2	1	0
PRT	sp|Q53GG5-3|PDLI3_HUMAN	Isoform 3 of PDZ and LIM domain protein 3 OS=Homo sapiens OX=9606 GN=PDLIM3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	16-UNIMOD:267	0.08	30.0	1	1	1
PRT	sp|Q9Y3F4|STRAP_HUMAN	Serine-threonine kinase receptor-associated protein OS=Homo sapiens OX=9606 GN=STRAP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	30.0	null	59-UNIMOD:188,45-UNIMOD:28	0.05	30.0	4	1	0
PRT	sp|Q9UMY1|NOL7_HUMAN	Nucleolar protein 7 OS=Homo sapiens OX=9606 GN=NOL7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.08	30.0	2	1	0
PRT	sp|O94979-5|SC31A_HUMAN	Isoform 5 of Protein transport protein Sec31A OS=Homo sapiens OX=9606 GN=SEC31A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	192-UNIMOD:267	0.03	30.0	2	1	0
PRT	sp|Q9UFC0|LRWD1_HUMAN	Leucine-rich repeat and WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=LRWD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	2	1	0
PRT	sp|O15116|LSM1_HUMAN	U6 snRNA-associated Sm-like protein LSm1 OS=Homo sapiens OX=9606 GN=LSM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.13	30.0	2	1	0
PRT	sp|P61224-2|RAP1B_HUMAN	Isoform 2 of Ras-related protein Rap-1b OS=Homo sapiens OX=9606 GN=RAP1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.11	30.0	2	1	0
PRT	sp|P09661|RU2A_HUMAN	U2 small nuclear ribonucleoprotein A' OS=Homo sapiens OX=9606 GN=SNRPA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	179-UNIMOD:188,191-UNIMOD:188	0.12	30.0	2	2	2
PRT	sp|Q13761|RUNX3_HUMAN	Runt-related transcription factor 3 OS=Homo sapiens OX=9606 GN=RUNX3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	68-UNIMOD:267	0.04	30.0	1	1	1
PRT	sp|Q01196-6|RUNX1_HUMAN	Isoform AML-1FB of Runt-related transcription factor 1 OS=Homo sapiens OX=9606 GN=RUNX1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	64-UNIMOD:267	0.09	30.0	2	1	0
PRT	sp|Q9NUQ3-2|TXLNG_HUMAN	Isoform 2 of Gamma-taxilin OS=Homo sapiens OX=9606 GN=TXLNG	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	374-UNIMOD:188	0.07	30.0	2	2	2
PRT	sp|P61106|RAB14_HUMAN	Ras-related protein Rab-14 OS=Homo sapiens OX=9606 GN=RAB14 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	26-UNIMOD:4,34-UNIMOD:188,110-UNIMOD:267	0.12	30.0	4	2	0
PRT	sp|Q86Y56-2|DAAF5_HUMAN	Isoform 2 of Dynein assembly factor 5, axonemal OS=Homo sapiens OX=9606 GN=DNAAF5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	253-UNIMOD:267	0.02	30.0	2	1	0
PRT	sp|Q86WR0-2|CCD25_HUMAN	Isoform 2 of Coiled-coil domain-containing protein 25 OS=Homo sapiens OX=9606 GN=CCDC25	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.10	30.0	1	1	1
PRT	sp|Q9NTZ6|RBM12_HUMAN	RNA-binding protein 12 OS=Homo sapiens OX=9606 GN=RBM12 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	545-UNIMOD:4,557-UNIMOD:188	0.02	30.0	2	1	0
PRT	sp|Q08257-3|QOR_HUMAN	Isoform 3 of Quinone oxidoreductase OS=Homo sapiens OX=9606 GN=CRYZ	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	45-UNIMOD:4,55-UNIMOD:267	0.05	30.0	1	1	0
PRT	sp|P13646-2|K1C13_HUMAN	Isoform 2 of Keratin, type I cytoskeletal 13 OS=Homo sapiens OX=9606 GN=KRT13	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	266-UNIMOD:267,275-UNIMOD:267	0.05	30.0	2	1	0
PRT	sp|Q8NFH4|NUP37_HUMAN	Nucleoporin Nup37 OS=Homo sapiens OX=9606 GN=NUP37 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	311-UNIMOD:4,318-UNIMOD:188	0.10	30.0	3	2	1
PRT	sp|P11216|PYGB_HUMAN	Glycogen phosphorylase, brain form OS=Homo sapiens OX=9606 GN=PYGB PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|P18206-2|VINC_HUMAN	Isoform 1 of Vinculin OS=Homo sapiens OX=9606 GN=VCL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	512-UNIMOD:267,520-UNIMOD:267	0.02	30.0	1	1	1
PRT	sp|O60701|UGDH_HUMAN	UDP-glucose 6-dehydrogenase OS=Homo sapiens OX=9606 GN=UGDH PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	177-UNIMOD:267,190-UNIMOD:267	0.04	30.0	2	1	0
PRT	sp|Q9NPD3|EXOS4_HUMAN	Exosome complex component RRP41 OS=Homo sapiens OX=9606 GN=EXOSC4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	30.0	null	105-UNIMOD:28,118-UNIMOD:267	0.06	30.0	2	1	0
PRT	sp|Q9H2W6|RM46_HUMAN	39S ribosomal protein L46, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL46 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null		0.09	30.0	1	1	1
PRT	sp|P05976|MYL1_HUMAN	Myosin light chain 1/3, skeletal muscle isoform OS=Homo sapiens OX=9606 GN=MYL1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	141-UNIMOD:188,153-UNIMOD:267	0.09	30.0	1	1	0
PRT	sp|Q92900|RENT1_HUMAN	Regulator of nonsense transcripts 1 OS=Homo sapiens OX=9606 GN=UPF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	467-UNIMOD:188	0.01	30.0	1	1	0
PRT	sp|Q9Y265|RUVB1_HUMAN	RuvB-like 1 OS=Homo sapiens OX=9606 GN=RUVBL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	null	169-UNIMOD:28,171-UNIMOD:188,182-UNIMOD:188	0.03	30.0	2	1	0
PRT	sp|Q8N465|D2HDH_HUMAN	D-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=D2HGDH PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	198-UNIMOD:4,212-UNIMOD:267	0.03	30.0	1	1	1
PRT	sp|Q8TDB8-3|GTR14_HUMAN	Isoform 3 of Solute carrier family 2, facilitated glucose transporter member 14 OS=Homo sapiens OX=9606 GN=SLC2A14	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	139-UNIMOD:267	0.07	29.0	2	1	0
PRT	sp|P49773|HINT1_HUMAN	Histidine triad nucleotide-binding protein 1 OS=Homo sapiens OX=9606 GN=HINT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	21-UNIMOD:188	0.12	29.0	3	1	0
PRT	sp|P0CW19-2|LIMS3_HUMAN	Isoform 2 of LIM and senescent cell antigen-like-containing domain protein 3 OS=Homo sapiens OX=9606 GN=LIMS3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	8-UNIMOD:267,10-UNIMOD:4,20-UNIMOD:267,200-UNIMOD:4,212-UNIMOD:188	0.12	29.0	2	2	2
PRT	sp|Q02878|RL6_HUMAN	60S ribosomal protein L6 OS=Homo sapiens OX=9606 GN=RPL6 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null	285-UNIMOD:188	0.14	29.0	5	3	2
PRT	sp|P62906|RL10A_HUMAN	60S ribosomal protein L10a OS=Homo sapiens OX=9606 GN=RPL10A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	91-UNIMOD:188	0.06	29.0	2	1	0
PRT	sp|P55212|CASP6_HUMAN	Caspase-6 OS=Homo sapiens OX=9606 GN=CASP6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	29.0	null	87-UNIMOD:4,92-UNIMOD:188,99-UNIMOD:188,87-UNIMOD:385	0.05	29.0	3	1	0
PRT	sp|Q49A26-5|GLYR1_HUMAN	Isoform 5 of Putative oxidoreductase GLYR1 OS=Homo sapiens OX=9606 GN=GLYR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	405-UNIMOD:4,414-UNIMOD:188,420-UNIMOD:188	0.04	29.0	1	1	0
PRT	sp|P50991-2|TCPD_HUMAN	Isoform 2 of T-complex protein 1 subunit delta OS=Homo sapiens OX=9606 GN=CCT4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	289-UNIMOD:188	0.05	29.0	3	2	1
PRT	sp|P37802|TAGL2_HUMAN	Transgelin-2 OS=Homo sapiens OX=9606 GN=TAGLN2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	153-UNIMOD:188,154-UNIMOD:188	0.08	29.0	2	1	0
PRT	sp|P45974-2|UBP5_HUMAN	Isoform Short of Ubiquitin carboxyl-terminal hydrolase 5 OS=Homo sapiens OX=9606 GN=USP5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|P07384|CAN1_HUMAN	Calpain-1 catalytic subunit OS=Homo sapiens OX=9606 GN=CAPN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	351-UNIMOD:4	0.02	29.0	1	1	1
PRT	sp|P68104|EF1A1_HUMAN	Elongation factor 1-alpha 1 OS=Homo sapiens OX=9606 GN=EEF1A1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null	146-UNIMOD:188,96-UNIMOD:267	0.06	29.0	4	2	0
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	319-UNIMOD:188	0.05	29.0	4	3	2
PRT	sp|P14314-2|GLU2B_HUMAN	Isoform 2 of Glucosidase 2 subunit beta OS=Homo sapiens OX=9606 GN=PRKCSH	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	124-UNIMOD:267,135-UNIMOD:267	0.05	29.0	2	2	2
PRT	sp|P67812-2|SC11A_HUMAN	Isoform 2 of Signal peptidase complex catalytic subunit SEC11A OS=Homo sapiens OX=9606 GN=SEC11A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.09	29.0	1	1	1
PRT	sp|Q9Y5M8|SRPRB_HUMAN	Signal recognition particle receptor subunit beta OS=Homo sapiens OX=9606 GN=SRPRB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	125-UNIMOD:267	0.06	29.0	2	1	0
PRT	sp|Q8N357|S35F6_HUMAN	Solute carrier family 35 member F6 OS=Homo sapiens OX=9606 GN=SLC35F6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.04	29.0	1	1	1
PRT	sp|O76054-5|S14L2_HUMAN	Isoform 3 of SEC14-like protein 2 OS=Homo sapiens OX=9606 GN=SEC14L2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	218-UNIMOD:4,221-UNIMOD:267	0.06	29.0	1	1	1
PRT	sp|Q9NZB2-2|F120A_HUMAN	Isoform B of Constitutive coactivator of PPAR-gamma-like protein 1 OS=Homo sapiens OX=9606 GN=FAM120A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	14-UNIMOD:4	0.02	29.0	1	1	1
PRT	sp|P06744-2|G6PI_HUMAN	Isoform 2 of Glucose-6-phosphate isomerase OS=Homo sapiens OX=9606 GN=GPI	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	263-UNIMOD:188	0.05	29.0	3	2	1
PRT	sp|P19367-4|HXK1_HUMAN	Isoform 4 of Hexokinase-1 OS=Homo sapiens OX=9606 GN=HK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	242-UNIMOD:267	0.01	29.0	2	1	0
PRT	sp|O60271-5|JIP4_HUMAN	Isoform 5 of C-Jun-amino-terminal kinase-interacting protein 4 OS=Homo sapiens OX=9606 GN=SPAG9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	312-UNIMOD:267	0.01	29.0	2	1	0
PRT	sp|Q6P1N9|TATD1_HUMAN	Putative deoxyribonuclease TATDN1 OS=Homo sapiens OX=9606 GN=TATDN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	38-UNIMOD:267	0.04	29.0	2	1	0
PRT	sp|O15371-2|EIF3D_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit D OS=Homo sapiens OX=9606 GN=EIF3D	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	187-UNIMOD:267	0.03	29.0	4	1	0
PRT	sp|P24752|THIL_HUMAN	Acetyl-CoA acetyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=ACAT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	196-UNIMOD:4,202-UNIMOD:188	0.03	29.0	2	1	0
PRT	sp|P06753|TPM3_HUMAN	Tropomyosin alpha-3 chain OS=Homo sapiens OX=9606 GN=TPM3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.04	29.0	1	1	1
PRT	sp|P27708|PYR1_HUMAN	CAD protein OS=Homo sapiens OX=9606 GN=CAD PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	1313-UNIMOD:188,1323-UNIMOD:188	0.01	29.0	2	1	0
PRT	sp|O14776-2|TCRG1_HUMAN	Isoform 2 of Transcription elongation regulator 1 OS=Homo sapiens OX=9606 GN=TCERG1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	934-UNIMOD:188	0.01	29.0	1	1	0
PRT	sp|O43670-3|ZN207_HUMAN	Isoform 3 of BUB3-interacting and GLEBS motif-containing protein ZNF207 OS=Homo sapiens OX=9606 GN=ZNF207	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	292-UNIMOD:267	0.04	29.0	2	1	0
PRT	sp|Q96AB3-3|ISOC2_HUMAN	Isoform 3 of Isochorismatase domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ISOC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.18	29.0	1	1	1
PRT	sp|P61158|ARP3_HUMAN	Actin-related protein 3 OS=Homo sapiens OX=9606 GN=ACTR3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	1	1	1
PRT	sp|Q7Z6Z7-2|HUWE1_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens OX=9606 GN=HUWE1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	2618-UNIMOD:267	0.00	29.0	2	1	0
PRT	sp|Q15075|EEA1_HUMAN	Early endosome antigen 1 OS=Homo sapiens OX=9606 GN=EEA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	1	1	1
PRT	sp|P29590-14|PML_HUMAN	Isoform PML-14 of Protein PML OS=Homo sapiens OX=9606 GN=PML	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	360-UNIMOD:267,372-UNIMOD:267,272-UNIMOD:267,280-UNIMOD:267	0.06	29.0	4	2	0
PRT	sp|P19174|PLCG1_HUMAN	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 OS=Homo sapiens OX=9606 GN=PLCG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	1	1	1
PRT	sp|P04908|H2A1B_HUMAN	Histone H2A type 1-B/E OS=Homo sapiens OX=9606 GN=H2AC4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.24	29.0	2	2	2
PRT	sp|P47897-2|SYQ_HUMAN	Isoform 2 of Glutamine--tRNA ligase OS=Homo sapiens OX=9606 GN=QARS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	169-UNIMOD:188,98-UNIMOD:267	0.04	29.0	3	2	1
PRT	sp|P54727|RD23B_HUMAN	UV excision repair protein RAD23 homolog B OS=Homo sapiens OX=9606 GN=RAD23B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	76-UNIMOD:188,78-UNIMOD:188	0.03	29.0	1	1	1
PRT	sp|P13647|K2C5_HUMAN	Keratin, type II cytoskeletal 5 OS=Homo sapiens OX=9606 GN=KRT5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	431-UNIMOD:188,441-UNIMOD:188,343-UNIMOD:188	0.04	29.0	4	2	1
PRT	sp|P13804-2|ETFA_HUMAN	Isoform 2 of Electron transfer flavoprotein subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=ETFA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	60-UNIMOD:4,68-UNIMOD:188	0.06	29.0	3	1	0
PRT	sp|Q9BT78-2|CSN4_HUMAN	Isoform 2 of COP9 signalosome complex subunit 4 OS=Homo sapiens OX=9606 GN=COPS4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	70-UNIMOD:4,82-UNIMOD:188	0.06	29.0	2	1	0
PRT	sp|Q9UJZ1-2|STML2_HUMAN	Isoform 2 of Stomatin-like protein 2, mitochondrial OS=Homo sapiens OX=9606 GN=STOML2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	156-UNIMOD:267,166-UNIMOD:267	0.04	29.0	2	1	0
PRT	sp|Q9BZE9|ASPC1_HUMAN	Tether containing UBX domain for GLUT4 OS=Homo sapiens OX=9606 GN=ASPSCR1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	48-UNIMOD:4	0.02	29.0	1	1	1
PRT	sp|Q6ZMI0-5|PPR21_HUMAN	Isoform 5 of Protein phosphatase 1 regulatory subunit 21 OS=Homo sapiens OX=9606 GN=PPP1R21	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	72-UNIMOD:267,86-UNIMOD:267	0.02	29.0	1	1	1
PRT	sp|Q9UBU9-2|NXF1_HUMAN	Isoform 2 of Nuclear RNA export factor 1 OS=Homo sapiens OX=9606 GN=NXF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.08	29.0	2	2	2
PRT	sp|P40925-2|MDHC_HUMAN	Isoform 2 of Malate dehydrogenase, cytoplasmic OS=Homo sapiens OX=9606 GN=MDH1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	65-UNIMOD:4	0.07	29.0	1	1	1
PRT	sp|P23284|PPIB_HUMAN	Peptidyl-prolyl cis-trans isomerase B OS=Homo sapiens OX=9606 GN=PPIB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.13	29.0	3	2	1
PRT	sp|P63092-3|GNAS2_HUMAN	Isoform 3 of Guanine nucleotide-binding protein G(s) subunit alpha isoforms short OS=Homo sapiens OX=9606 GN=GNAS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	1	1	1
PRT	sp|Q86V81|THOC4_HUMAN	THO complex subunit 4 OS=Homo sapiens OX=9606 GN=ALYREF PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	155-UNIMOD:267	0.05	29.0	2	1	0
PRT	sp|Q10570|CPSF1_HUMAN	Cleavage and polyadenylation specificity factor subunit 1 OS=Homo sapiens OX=9606 GN=CPSF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	1	1	1
PRT	sp|Q13884-2|SNTB1_HUMAN	Isoform 2 of Beta-1-syntrophin OS=Homo sapiens OX=9606 GN=SNTB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.04	29.0	1	1	1
PRT	sp|P49736|MCM2_HUMAN	DNA replication licensing factor MCM2 OS=Homo sapiens OX=9606 GN=MCM2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	522-UNIMOD:4	0.02	29.0	1	1	1
PRT	sp|P61604|CH10_HUMAN	10 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPE1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	56-UNIMOD:188,66-UNIMOD:188	0.25	29.0	2	2	2
PRT	sp|P48643|TCPE_HUMAN	T-complex protein 1 subunit epsilon OS=Homo sapiens OX=9606 GN=CCT5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	null	503-UNIMOD:28,513-UNIMOD:188,514-UNIMOD:188	0.02	29.0	7	2	0
PRT	sp|P26038|MOES_HUMAN	Moesin OS=Homo sapiens OX=9606 GN=MSN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	29.0	null	151-UNIMOD:188,156-UNIMOD:267	0.02	29.0	2	1	0
PRT	sp|P09417|DHPR_HUMAN	Dihydropteridine reductase OS=Homo sapiens OX=9606 GN=QDPR PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	221-UNIMOD:267,236-UNIMOD:267	0.07	29.0	2	1	0
PRT	sp|P78347|GTF2I_HUMAN	General transcription factor II-I OS=Homo sapiens OX=9606 GN=GTF2I PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	715-UNIMOD:188,717-UNIMOD:267	0.02	29.0	2	1	0
PRT	sp|P42766|RL35_HUMAN	60S ribosomal protein L35 OS=Homo sapiens OX=9606 GN=RPL35 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	null	20-UNIMOD:28,25-UNIMOD:188,32-UNIMOD:267	0.11	29.0	2	1	0
PRT	sp|Q9BTC0|DIDO1_HUMAN	Death-inducer obliterator 1 OS=Homo sapiens OX=9606 GN=DIDO1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	2040-UNIMOD:267,2071-UNIMOD:267	0.02	29.0	1	1	1
PRT	sp|Q9H553|ALG2_HUMAN	Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Homo sapiens OX=9606 GN=ALG2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null		0.04	29.0	1	1	1
PRT	sp|Q9Y2S6|TMA7_HUMAN	Translation machinery-associated protein 7 OS=Homo sapiens OX=9606 GN=TMA7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	50-UNIMOD:188,59-UNIMOD:188	0.22	28.0	1	1	1
PRT	sp|Q96S44|PRPK_HUMAN	EKC/KEOPS complex subunit TP53RK OS=Homo sapiens OX=9606 GN=TP53RK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	223-UNIMOD:188	0.08	28.0	2	1	0
PRT	sp|Q9BQ52-3|RNZ2_HUMAN	Isoform 3 of Zinc phosphodiesterase ELAC protein 2 OS=Homo sapiens OX=9606 GN=ELAC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	409-UNIMOD:267,410-UNIMOD:267	0.03	28.0	2	1	0
PRT	sp|Q8WWC4|MAIP1_HUMAN	m-AAA protease-interacting protein 1, mitochondrial OS=Homo sapiens OX=9606 GN=MAIP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.05	28.0	1	1	1
PRT	sp|O76003|GLRX3_HUMAN	Glutaredoxin-3 OS=Homo sapiens OX=9606 GN=GLRX3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.04	28.0	1	1	1
PRT	sp|P49591|SYSC_HUMAN	Serine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=SARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|P46087-2|NOP2_HUMAN	Isoform 2 of Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase OS=Homo sapiens OX=9606 GN=NOP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	336-UNIMOD:188,339-UNIMOD:188	0.03	28.0	2	2	2
PRT	sp|P60842-2|IF4A1_HUMAN	Isoform 2 of Eukaryotic initiation factor 4A-I OS=Homo sapiens OX=9606 GN=EIF4A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.04	28.0	1	1	1
PRT	sp|P09543-2|CN37_HUMAN	Isoform CNPI of 2',3'-cyclic-nucleotide 3'-phosphodiesterase OS=Homo sapiens OX=9606 GN=CNP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	340-UNIMOD:267,349-UNIMOD:267	0.03	28.0	2	1	0
PRT	sp|P33121|ACSL1_HUMAN	Long-chain-fatty-acid--CoA ligase 1 OS=Homo sapiens OX=9606 GN=ACSL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	521-UNIMOD:188,525-UNIMOD:188	0.04	28.0	3	2	1
PRT	sp|P05455|LA_HUMAN	Lupus La protein OS=Homo sapiens OX=9606 GN=SSB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	165-UNIMOD:188,166-UNIMOD:188,232-UNIMOD:4,176-UNIMOD:188,185-UNIMOD:188	0.13	28.0	6	4	2
PRT	sp|Q9BXS5|AP1M1_HUMAN	AP-1 complex subunit mu-1 OS=Homo sapiens OX=9606 GN=AP1M1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|Q9UBF2-2|COPG2_HUMAN	Isoform 2 of Coatomer subunit gamma-2 OS=Homo sapiens OX=9606 GN=COPG2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	325-UNIMOD:4,338-UNIMOD:267	0.03	28.0	2	1	0
PRT	sp|Q07065|CKAP4_HUMAN	Cytoskeleton-associated protein 4 OS=Homo sapiens OX=9606 GN=CKAP4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	405-UNIMOD:188	0.02	28.0	1	1	1
PRT	sp|Q00169|PIPNA_HUMAN	Phosphatidylinositol transfer protein alpha isoform OS=Homo sapiens OX=9606 GN=PITPNA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null	146-UNIMOD:267	0.05	28.0	2	1	0
PRT	sp|Q9NX46|ARHL2_HUMAN	ADP-ribose glycohydrolase ARH3 OS=Homo sapiens OX=9606 GN=ADPRHL2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.05	28.0	1	1	1
PRT	sp|P06396-2|GELS_HUMAN	Isoform 2 of Gelsolin OS=Homo sapiens OX=9606 GN=GSN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	137-UNIMOD:267	0.02	28.0	2	1	0
PRT	sp|P26639|SYTC_HUMAN	Threonine--tRNA ligase 1, cytoplasmic OS=Homo sapiens OX=9606 GN=TARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|P60891|PRPS1_HUMAN	Ribose-phosphate pyrophosphokinase 1 OS=Homo sapiens OX=9606 GN=PRPS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.04	28.0	1	1	1
PRT	sp|P62263|RS14_HUMAN	40S ribosomal protein S14 OS=Homo sapiens OX=9606 GN=RPS14 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	128-UNIMOD:267,141-UNIMOD:267	0.11	28.0	2	1	0
PRT	sp|P17931|LEG3_HUMAN	Galectin-3 OS=Homo sapiens OX=9606 GN=LGALS3 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	210-UNIMOD:188	0.05	28.0	1	1	1
PRT	sp|P22059|OSBP1_HUMAN	Oxysterol-binding protein 1 OS=Homo sapiens OX=9606 GN=OSBP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|Q9BXP5-5|SRRT_HUMAN	Isoform 5 of Serrate RNA effector molecule homolog OS=Homo sapiens OX=9606 GN=SRRT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	627-UNIMOD:188,442-UNIMOD:4	0.03	28.0	2	2	1
PRT	sp|P10606|COX5B_HUMAN	Cytochrome c oxidase subunit 5B, mitochondrial OS=Homo sapiens OX=9606 GN=COX5B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	57-UNIMOD:188,68-UNIMOD:188	0.10	28.0	2	1	0
PRT	sp|P61586|RHOA_HUMAN	Transforming protein RhoA OS=Homo sapiens OX=9606 GN=RHOA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	16-UNIMOD:4,7-UNIMOD:188,18-UNIMOD:188	0.07	28.0	2	1	0
PRT	sp|O15160-2|RPAC1_HUMAN	Isoform 2 of DNA-directed RNA polymerases I and III subunit RPAC1 OS=Homo sapiens OX=9606 GN=POLR1C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.06	28.0	1	1	1
PRT	sp|P48444-2|COPD_HUMAN	Isoform 2 of Coatomer subunit delta OS=Homo sapiens OX=9606 GN=ARCN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.04	28.0	1	1	1
PRT	sp|P54886-2|P5CS_HUMAN	Isoform Short of Delta-1-pyrroline-5-carboxylate synthase OS=Homo sapiens OX=9606 GN=ALDH18A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	88-UNIMOD:4	0.02	28.0	2	1	0
PRT	sp|Q96Q11-2|TRNT1_HUMAN	Isoform 2 of CCA tRNA nucleotidyltransferase 1, mitochondrial OS=Homo sapiens OX=9606 GN=TRNT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	126-UNIMOD:267	0.03	28.0	1	1	1
PRT	sp|Q9BWF3|RBM4_HUMAN	RNA-binding protein 4 OS=Homo sapiens OX=9606 GN=RBM4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	89-UNIMOD:4,92-UNIMOD:188	0.04	28.0	2	1	0
PRT	sp|Q13418-3|ILK_HUMAN	Isoform 3 of Integrin-linked protein kinase OS=Homo sapiens OX=9606 GN=ILK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	75-UNIMOD:188	0.04	28.0	2	1	0
PRT	sp|Q9Y2W1|TR150_HUMAN	Thyroid hormone receptor-associated protein 3 OS=Homo sapiens OX=9606 GN=THRAP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	573-UNIMOD:35	0.02	28.0	1	1	1
PRT	sp|P07437|TBB5_HUMAN	Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	321-UNIMOD:35,324-UNIMOD:188,336-UNIMOD:188	0.04	28.0	1	1	1
PRT	sp|P60002|ELOF1_HUMAN	Transcription elongation factor 1 homolog OS=Homo sapiens OX=9606 GN=ELOF1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	16-UNIMOD:35,26-UNIMOD:4,29-UNIMOD:4	0.23	28.0	1	1	1
PRT	sp|Q13107-2|UBP4_HUMAN	Isoform 2 of Ubiquitin carboxyl-terminal hydrolase 4 OS=Homo sapiens OX=9606 GN=USP4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	409-UNIMOD:188	0.02	28.0	2	1	0
PRT	sp|Q9BZK3|NACP4_HUMAN	Putative nascent polypeptide-associated complex subunit alpha-like protein OS=Homo sapiens OX=9606 GN=NACA4P PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	107-UNIMOD:188,112-UNIMOD:188	0.07	28.0	2	1	0
PRT	sp|P68366-2|TBA4A_HUMAN	Isoform 2 of Tubulin alpha-4A chain OS=Homo sapiens OX=9606 GN=TUBA4A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	206-UNIMOD:267,214-UNIMOD:267	0.03	28.0	1	1	1
PRT	sp|Q9BZZ5-1|API5_HUMAN	Isoform 1 of Apoptosis inhibitor 5 OS=Homo sapiens OX=9606 GN=API5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.04	28.0	1	1	0
PRT	sp|P33176|KINH_HUMAN	Kinesin-1 heavy chain OS=Homo sapiens OX=9606 GN=KIF5B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	831-UNIMOD:188,844-UNIMOD:188	0.03	28.0	2	2	2
PRT	sp|P61764|STXB1_HUMAN	Syntaxin-binding protein 1 OS=Homo sapiens OX=9606 GN=STXBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	305-UNIMOD:267,110-UNIMOD:4,120-UNIMOD:188	0.09	28.0	3	3	3
PRT	sp|Q9UDT6-2|CLIP2_HUMAN	Isoform 2 of CAP-Gly domain-containing linker protein 2 OS=Homo sapiens OX=9606 GN=CLIP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|P43243|MATR3_HUMAN	Matrin-3 OS=Homo sapiens OX=9606 GN=MATR3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.05	28.0	3	3	3
PRT	sp|P27797|CALR_HUMAN	Calreticulin OS=Homo sapiens OX=9606 GN=CALR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	48-UNIMOD:188,55-UNIMOD:188	0.03	28.0	3	1	0
PRT	sp|P13010|XRCC5_HUMAN	X-ray repair cross-complementing protein 5 OS=Homo sapiens OX=9606 GN=XRCC5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null	155-UNIMOD:188	0.02	28.0	3	1	0
PRT	sp|Q6L8Q7-2|PDE12_HUMAN	Isoform 2 of 2',5'-phosphodiesterase 12 OS=Homo sapiens OX=9606 GN=PDE12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	99-UNIMOD:267,108-UNIMOD:4,119-UNIMOD:4,124-UNIMOD:188	0.05	28.0	1	1	1
PRT	sp|Q00059|TFAM_HUMAN	Transcription factor A, mitochondrial OS=Homo sapiens OX=9606 GN=TFAM PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.05	28.0	1	1	1
PRT	sp|Q9H3U1-2|UN45A_HUMAN	Isoform 2 of Protein unc-45 homolog A OS=Homo sapiens OX=9606 GN=UNC45A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	208-UNIMOD:4,214-UNIMOD:267	0.01	28.0	2	1	0
PRT	sp|P60866|RS20_HUMAN	40S ribosomal protein S20 OS=Homo sapiens OX=9606 GN=RPS20 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null	19-UNIMOD:267,70-UNIMOD:4,75-UNIMOD:188,79-UNIMOD:267	0.21	28.0	5	2	1
PRT	sp|Q9NX24|NHP2_HUMAN	H/ACA ribonucleoprotein complex subunit 2 OS=Homo sapiens OX=9606 GN=NHP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	41-UNIMOD:267,42-UNIMOD:267	0.14	28.0	1	1	1
PRT	sp|P35250-2|RFC2_HUMAN	Isoform 2 of Replication factor C subunit 2 OS=Homo sapiens OX=9606 GN=RFC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	221-UNIMOD:4,230-UNIMOD:188	0.04	28.0	2	1	0
PRT	sp|O00422|SAP18_HUMAN	Histone deacetylase complex subunit SAP18 OS=Homo sapiens OX=9606 GN=SAP18 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.08	28.0	1	1	1
PRT	sp|P49757-8|NUMB_HUMAN	Isoform 8 of Protein numb homolog OS=Homo sapiens OX=9606 GN=NUMB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	53-UNIMOD:267	0.03	28.0	1	1	1
PRT	sp|Q86TX2|ACOT1_HUMAN	Acyl-coenzyme A thioesterase 1 OS=Homo sapiens OX=9606 GN=ACOT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|P14866|HNRPL_HUMAN	Heterogeneous nuclear ribonucleoprotein L OS=Homo sapiens OX=9606 GN=HNRNPL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|P23246|SFPQ_HUMAN	Splicing factor, proline- and glutamine-rich OS=Homo sapiens OX=9606 GN=SFPQ PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null		0.03	28.0	1	1	0
PRT	sp|Q9BW04|SARG_HUMAN	Specifically androgen-regulated gene protein OS=Homo sapiens OX=9606 GN=SARG PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	408-UNIMOD:188	0.05	28.0	1	1	1
PRT	sp|P69905|HBA_HUMAN	Hemoglobin subunit alpha OS=Homo sapiens OX=9606 GN=HBA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null		0.11	28.0	3	1	0
PRT	sp|Q9HBU6|EKI1_HUMAN	Ethanolamine kinase 1 OS=Homo sapiens OX=9606 GN=ETNK1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null		0.04	28.0	1	1	1
PRT	sp|P62736|ACTA_HUMAN	Actin, aortic smooth muscle OS=Homo sapiens OX=9606 GN=ACTA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	115-UNIMOD:188	0.05	28.0	1	1	1
PRT	sp|P53384|NUBP1_HUMAN	Cytosolic Fe-S cluster assembly factor NUBP1 OS=Homo sapiens OX=9606 GN=NUBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	307-UNIMOD:4	0.06	28.0	1	1	1
PRT	sp|Q6NXS1|IPP2B_HUMAN	Protein phosphatase inhibitor 2 family member B OS=Homo sapiens OX=9606 GN=PPP1R2B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1	0.06	27.0	1	1	1
PRT	sp|P61970|NTF2_HUMAN	Nuclear transport factor 2 OS=Homo sapiens OX=9606 GN=NUTF2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.13	27.0	1	1	1
PRT	sp|Q9Y2R4|DDX52_HUMAN	Probable ATP-dependent RNA helicase DDX52 OS=Homo sapiens OX=9606 GN=DDX52 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|Q00688|FKBP3_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP3 OS=Homo sapiens OX=9606 GN=FKBP3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	73-UNIMOD:188,80-UNIMOD:188	0.11	27.0	3	2	1
PRT	sp|Q14149|MORC3_HUMAN	MORC family CW-type zinc finger protein 3 OS=Homo sapiens OX=9606 GN=MORC3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	180-UNIMOD:188	0.02	27.0	1	1	1
PRT	sp|P62633-7|CNBP_HUMAN	Isoform 7 of Cellular nucleic acid-binding protein OS=Homo sapiens OX=9606 GN=CNBP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	102-UNIMOD:4,105-UNIMOD:4,113-UNIMOD:188,144-UNIMOD:4,152-UNIMOD:267	0.14	27.0	3	2	1
PRT	sp|O95881|TXD12_HUMAN	Thioredoxin domain-containing protein 12 OS=Homo sapiens OX=9606 GN=TXNDC12 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	63-UNIMOD:188	0.09	27.0	2	1	0
PRT	sp|Q9Y314|NOSIP_HUMAN	Nitric oxide synthase-interacting protein OS=Homo sapiens OX=9606 GN=NOSIP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	78-UNIMOD:188	0.09	27.0	3	2	1
PRT	sp|Q9UJX3-2|APC7_HUMAN	Isoform 2 of Anaphase-promoting complex subunit 7 OS=Homo sapiens OX=9606 GN=ANAPC7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	329-UNIMOD:4	0.03	27.0	1	1	1
PRT	sp|P37837|TALDO_HUMAN	Transaldolase OS=Homo sapiens OX=9606 GN=TALDO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null	321-UNIMOD:188,324-UNIMOD:267	0.03	27.0	2	1	0
PRT	sp|P51571|SSRD_HUMAN	Translocon-associated protein subunit delta OS=Homo sapiens OX=9606 GN=SSR4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	139-UNIMOD:267	0.19	27.0	2	2	2
PRT	sp|Q7L2J0|MEPCE_HUMAN	7SK snRNA methylphosphate capping enzyme OS=Homo sapiens OX=9606 GN=MEPCE PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	99-UNIMOD:267	0.02	27.0	2	1	0
PRT	sp|P49257|LMAN1_HUMAN	Protein ERGIC-53 OS=Homo sapiens OX=9606 GN=LMAN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	329-UNIMOD:267	0.04	27.0	2	1	0
PRT	sp|Q12797-10|ASPH_HUMAN	Isoform 10 of Aspartyl/asparaginyl beta-hydroxylase OS=Homo sapiens OX=9606 GN=ASPH	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|Q56VL3|OCAD2_HUMAN	OCIA domain-containing protein 2 OS=Homo sapiens OX=9606 GN=OCIAD2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	130-UNIMOD:4,134-UNIMOD:4,137-UNIMOD:4,138-UNIMOD:188	0.17	27.0	2	2	2
PRT	sp|Q9Y5Y0-2|FLVC1_HUMAN	Isoform 2 of Feline leukemia virus subgroup C receptor-related protein 1 OS=Homo sapiens OX=9606 GN=FLVCR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	254-UNIMOD:188	0.05	27.0	2	1	0
PRT	sp|P06239-3|LCK_HUMAN	Isoform 3 of Tyrosine-protein kinase Lck OS=Homo sapiens OX=9606 GN=LCK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	217-UNIMOD:4	0.02	27.0	1	1	1
PRT	sp|Q01780-2|EXOSX_HUMAN	Isoform 2 of Exosome component 10 OS=Homo sapiens OX=9606 GN=EXOSC10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	554-UNIMOD:4,555-UNIMOD:4	0.03	27.0	1	1	0
PRT	sp|P63173|RL38_HUMAN	60S ribosomal protein L38 OS=Homo sapiens OX=9606 GN=RPL38 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.19	27.0	1	1	1
PRT	sp|Q9GZZ1-2|NAA50_HUMAN	Isoform 2 of N-alpha-acetyltransferase 50 OS=Homo sapiens OX=9606 GN=NAA50	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	17-UNIMOD:188	0.16	27.0	1	1	1
PRT	sp|P39023|RL3_HUMAN	60S ribosomal protein L3 OS=Homo sapiens OX=9606 GN=RPL3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	294-UNIMOD:188,297-UNIMOD:188	0.03	27.0	2	1	0
PRT	sp|O14976-2|GAK_HUMAN	Isoform 2 of Cyclin-G-associated kinase OS=Homo sapiens OX=9606 GN=GAK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	2	1	0
PRT	sp|Q9H2U2|IPYR2_HUMAN	Inorganic pyrophosphatase 2, mitochondrial OS=Homo sapiens OX=9606 GN=PPA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	180-UNIMOD:4,187-UNIMOD:188	0.04	27.0	2	1	0
PRT	sp|Q16851-2|UGPA_HUMAN	Isoform 2 of UTP--glucose-1-phosphate uridylyltransferase OS=Homo sapiens OX=9606 GN=UGP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	187-UNIMOD:188,195-UNIMOD:188	0.02	27.0	1	1	1
PRT	sp|Q6P2E9-2|EDC4_HUMAN	Isoform 2 of Enhancer of mRNA-decapping protein 4 OS=Homo sapiens OX=9606 GN=EDC4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	208-UNIMOD:188,210-UNIMOD:188,578-UNIMOD:267,593-UNIMOD:267	0.05	27.0	6	3	0
PRT	sp|Q9ULV4|COR1C_HUMAN	Coronin-1C OS=Homo sapiens OX=9606 GN=CORO1C PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	343-UNIMOD:4	0.03	27.0	1	1	1
PRT	sp|P08727|K1C19_HUMAN	Keratin, type I cytoskeletal 19 OS=Homo sapiens OX=9606 GN=KRT19 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.08	27.0	3	3	3
PRT	sp|Q9UBS4|DJB11_HUMAN	DnaJ homolog subfamily B member 11 OS=Homo sapiens OX=9606 GN=DNAJB11 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	302-UNIMOD:188,315-UNIMOD:188	0.04	27.0	1	1	1
PRT	sp|Q9NW13-2|RBM28_HUMAN	Isoform 2 of RNA-binding protein 28 OS=Homo sapiens OX=9606 GN=RBM28	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	364-UNIMOD:188,374-UNIMOD:188	0.02	27.0	2	1	0
PRT	sp|Q9P289-3|STK26_HUMAN	Isoform 3 of Serine/threonine-protein kinase 26 OS=Homo sapiens OX=9606 GN=STK26	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|P09874|PARP1_HUMAN	Poly [ADP-ribose] polymerase 1 OS=Homo sapiens OX=9606 GN=PARP1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	418-UNIMOD:188,425-UNIMOD:188	0.01	27.0	2	1	0
PRT	sp|O15382-2|BCAT2_HUMAN	Isoform B of Branched-chain-amino-acid aminotransferase, mitochondrial OS=Homo sapiens OX=9606 GN=BCAT2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.06	27.0	1	1	1
PRT	sp|Q9GZY4|COA1_HUMAN	Cytochrome c oxidase assembly factor 1 homolog OS=Homo sapiens OX=9606 GN=COA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.10	27.0	1	1	1
PRT	sp|Q8WUQ7|CATIN_HUMAN	Cactin OS=Homo sapiens OX=9606 GN=CACTIN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	469-UNIMOD:188,484-UNIMOD:188	0.02	27.0	2	1	0
PRT	sp|Q13573|SNW1_HUMAN	SNW domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SNW1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null	76-UNIMOD:35,78-UNIMOD:267	0.05	27.0	3	1	0
PRT	sp|O15020-2|SPTN2_HUMAN	Isoform 2 of Spectrin beta chain, non-erythrocytic 2 OS=Homo sapiens OX=9606 GN=SPTBN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	2	1	0
PRT	sp|Q9Y4L1|HYOU1_HUMAN	Hypoxia up-regulated protein 1 OS=Homo sapiens OX=9606 GN=HYOU1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	883-UNIMOD:188,889-UNIMOD:188	0.01	27.0	2	1	0
PRT	sp|Q14166|TTL12_HUMAN	Tubulin--tyrosine ligase-like protein 12 OS=Homo sapiens OX=9606 GN=TTLL12 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	361-UNIMOD:4	0.04	27.0	1	1	1
PRT	sp|P50914|RL14_HUMAN	60S ribosomal protein L14 OS=Homo sapiens OX=9606 GN=RPL14 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	35-UNIMOD:267,23-UNIMOD:188	0.17	27.0	5	3	1
PRT	sp|Q16658|FSCN1_HUMAN	Fascin OS=Homo sapiens OX=9606 GN=FSCN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	205-UNIMOD:267,217-UNIMOD:267	0.03	27.0	3	1	0
PRT	sp|P67936|TPM4_HUMAN	Tropomyosin alpha-4 chain OS=Homo sapiens OX=9606 GN=TPM4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.06	27.0	1	1	1
PRT	sp|Q15437|SC23B_HUMAN	Protein transport protein Sec23B OS=Homo sapiens OX=9606 GN=SEC23B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	172-UNIMOD:35,180-UNIMOD:4,185-UNIMOD:188	0.06	27.0	3	3	3
PRT	sp|P43034|LIS1_HUMAN	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens OX=9606 GN=PAFAH1B1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	252-UNIMOD:4,241-UNIMOD:267,259-UNIMOD:267	0.05	27.0	3	1	0
PRT	sp|Q9BRR6-2|ADPGK_HUMAN	Isoform 2 of ADP-dependent glucokinase OS=Homo sapiens OX=9606 GN=ADPGK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null	49-UNIMOD:267,60-UNIMOD:267	0.02	27.0	4	1	0
PRT	sp|Q04446|GLGB_HUMAN	1,4-alpha-glucan-branching enzyme OS=Homo sapiens OX=9606 GN=GBE1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|O00116|ADAS_HUMAN	Alkyldihydroxyacetonephosphate synthase, peroxisomal OS=Homo sapiens OX=9606 GN=AGPS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	337-UNIMOD:188	0.02	27.0	2	1	0
PRT	sp|P46776|RL27A_HUMAN	60S ribosomal protein L27a OS=Homo sapiens OX=9606 GN=RPL27A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.09	27.0	2	1	0
PRT	sp|Q92820|GGH_HUMAN	Gamma-glutamyl hydrolase OS=Homo sapiens OX=9606 GN=GGH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	266-UNIMOD:188	0.04	27.0	2	1	0
PRT	sp|Q96AT1|K1143_HUMAN	Uncharacterized protein KIAA1143 OS=Homo sapiens OX=9606 GN=KIAA1143 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.11	27.0	1	1	1
PRT	sp|Q9P2I0|CPSF2_HUMAN	Cleavage and polyadenylation specificity factor subunit 2 OS=Homo sapiens OX=9606 GN=CPSF2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	577-UNIMOD:4,578-UNIMOD:4	0.03	27.0	1	1	1
PRT	sp|P62877|RBX1_HUMAN	E3 ubiquitin-protein ligase RBX1 OS=Homo sapiens OX=9606 GN=RBX1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	94-UNIMOD:4	0.14	27.0	1	1	1
PRT	sp|Q9H0U3|MAGT1_HUMAN	Magnesium transporter protein 1 OS=Homo sapiens OX=9606 GN=MAGT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	150-UNIMOD:267,159-UNIMOD:267	0.03	27.0	2	1	0
PRT	sp|Q15291-2|RBBP5_HUMAN	Isoform 2 of Retinoblastoma-binding protein 5 OS=Homo sapiens OX=9606 GN=RBBP5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	2356-UNIMOD:267	0.01	27.0	2	1	0
PRT	sp|P48047|ATPO_HUMAN	ATP synthase subunit O, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5PO PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.07	27.0	1	1	1
PRT	sp|Q9P2D3-2|HTR5B_HUMAN	Isoform 2 of HEAT repeat-containing protein 5B OS=Homo sapiens OX=9606 GN=HEATR5B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	625-UNIMOD:4,635-UNIMOD:267	0.02	27.0	1	1	1
PRT	sp|Q9Y4Z0|LSM4_HUMAN	U6 snRNA-associated Sm-like protein LSm4 OS=Homo sapiens OX=9606 GN=LSM4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	20-UNIMOD:188	0.09	27.0	2	1	0
PRT	sp|Q9H078-5|CLPB_HUMAN	Isoform 5 of Caseinolytic peptidase B protein homolog OS=Homo sapiens OX=9606 GN=CLPB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|P48681|NEST_HUMAN	Nestin OS=Homo sapiens OX=9606 GN=NES PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|O60832-2|DKC1_HUMAN	Isoform 3 of H/ACA ribonucleoprotein complex subunit DKC1 OS=Homo sapiens OX=9606 GN=DKC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	46-UNIMOD:188,57-UNIMOD:188	0.04	27.0	2	1	0
PRT	sp|O75380|NDUS6_HUMAN	NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFS6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	87-UNIMOD:4	0.13	27.0	1	1	1
PRT	sp|Q14692|BMS1_HUMAN	Ribosome biogenesis protein BMS1 homolog OS=Homo sapiens OX=9606 GN=BMS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|P31689|DNJA1_HUMAN	DnaJ homolog subfamily A member 1 OS=Homo sapiens OX=9606 GN=DNAJA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.05	27.0	1	1	1
PRT	sp|Q5QJE6|TDIF2_HUMAN	Deoxynucleotidyltransferase terminal-interacting protein 2 OS=Homo sapiens OX=9606 GN=DNTTIP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	704-UNIMOD:267	0.03	27.0	2	1	0
PRT	sp|Q15149|PLEC_HUMAN	Plectin OS=Homo sapiens OX=9606 GN=PLEC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	27.0	null	1186-UNIMOD:188,1201-UNIMOD:267,2546-UNIMOD:28,2553-UNIMOD:188,2556-UNIMOD:267	0.01	27.0	2	2	1
PRT	sp|O14776|TCRG1_HUMAN	Transcription elongation regulator 1 OS=Homo sapiens OX=9606 GN=TCERG1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.01	27.0	1	1	0
PRT	sp|P06744|G6PI_HUMAN	Glucose-6-phosphate isomerase OS=Homo sapiens OX=9606 GN=GPI PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	27.0	null	84-UNIMOD:35,89-UNIMOD:188,96-UNIMOD:267	0.03	27.0	3	1	0
PRT	sp|Q9BXP5|SRRT_HUMAN	Serrate RNA effector molecule homolog OS=Homo sapiens OX=9606 GN=SRRT PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	476-UNIMOD:188,479-UNIMOD:4,486-UNIMOD:267	0.02	27.0	1	1	0
PRT	sp|Q12788|TBL3_HUMAN	Transducin beta-like protein 3 OS=Homo sapiens OX=9606 GN=TBL3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null	654-UNIMOD:28,358-UNIMOD:4,360-UNIMOD:188,664-UNIMOD:188,665-UNIMOD:267	0.04	27.0	4	2	0
PRT	sp|Q6UB35|C1TM_HUMAN	Monofunctional C1-tetrahydrofolate synthase, mitochondrial OS=Homo sapiens OX=9606 GN=MTHFD1L PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	27.0	null	906-UNIMOD:4,586-UNIMOD:188,596-UNIMOD:188	0.03	27.0	2	2	2
PRT	sp|Q99536|VAT1_HUMAN	Synaptic vesicle membrane protein VAT-1 homolog OS=Homo sapiens OX=9606 GN=VAT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	295-UNIMOD:188,296-UNIMOD:267	0.04	27.0	1	1	1
PRT	sp|Q9BZZ5|API5_HUMAN	Apoptosis inhibitor 5 OS=Homo sapiens OX=9606 GN=API5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	null	81-UNIMOD:28	0.03	27.0	1	1	0
PRT	sp|Q08257|QOR_HUMAN	Quinone oxidoreductase OS=Homo sapiens OX=9606 GN=CRYZ PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	45-UNIMOD:4	0.05	27.0	1	1	0
PRT	sp|P55209|NP1L1_HUMAN	Nucleosome assembly protein 1-like 1 OS=Homo sapiens OX=9606 GN=NAP1L1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	105-UNIMOD:188,116-UNIMOD:188	0.03	27.0	2	1	0
PRT	sp|Q9NVV4|PAPD1_HUMAN	Poly(A) RNA polymerase, mitochondrial OS=Homo sapiens OX=9606 GN=MTPAP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	324-UNIMOD:4	0.03	27.0	1	1	1
PRT	sp|Q9Y2T2|AP3M1_HUMAN	AP-3 complex subunit mu-1 OS=Homo sapiens OX=9606 GN=AP3M1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	288-UNIMOD:4	0.04	27.0	1	1	1
PRT	sp|Q9Y6R4|M3K4_HUMAN	Mitogen-activated protein kinase kinase kinase 4 OS=Homo sapiens OX=9606 GN=MAP3K4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	null	1225-UNIMOD:267	0.01	27.0	1	1	1
PRT	sp|O95394|AGM1_HUMAN	Phosphoacetylglucosamine mutase OS=Homo sapiens OX=9606 GN=PGM3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	496-UNIMOD:267,505-UNIMOD:267	0.03	26.0	2	1	0
PRT	sp|Q92979|NEP1_HUMAN	Ribosomal RNA small subunit methyltransferase NEP1 OS=Homo sapiens OX=9606 GN=EMG1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	114-UNIMOD:188	0.05	26.0	2	1	0
PRT	sp|Q12765-2|SCRN1_HUMAN	Isoform 2 of Secernin-1 OS=Homo sapiens OX=9606 GN=SCRN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	38-UNIMOD:188,46-UNIMOD:188	0.03	26.0	2	1	0
PRT	sp|P25325|THTM_HUMAN	3-mercaptopyruvate sulfurtransferase OS=Homo sapiens OX=9606 GN=MPST PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	284-UNIMOD:267,293-UNIMOD:267	0.04	26.0	2	1	0
PRT	sp|P35998|PRS7_HUMAN	26S proteasome regulatory subunit 7 OS=Homo sapiens OX=9606 GN=PSMC2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	232-UNIMOD:267,236-UNIMOD:4,239-UNIMOD:267	0.03	26.0	1	1	1
PRT	sp|Q99798|ACON_HUMAN	Aconitate hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=ACO2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	592-UNIMOD:4	0.05	26.0	2	2	2
PRT	sp|Q13362-2|2A5G_HUMAN	Isoform Gamma-1 of Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform OS=Homo sapiens OX=9606 GN=PPP2R5C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	334-UNIMOD:4	0.06	26.0	2	2	2
PRT	sp|Q71RC2-6|LARP4_HUMAN	Isoform 6 of La-related protein 4 OS=Homo sapiens OX=9606 GN=LARP4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|Q9NX01|TXN4B_HUMAN	Thioredoxin-like protein 4B OS=Homo sapiens OX=9606 GN=TXNL4B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	38-UNIMOD:4	0.13	26.0	1	1	1
PRT	sp|P43487-2|RANG_HUMAN	Isoform 2 of Ran-specific GTPase-activating protein OS=Homo sapiens OX=9606 GN=RANBP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.13	26.0	2	2	2
PRT	sp|Q9NYK5|RM39_HUMAN	39S ribosomal protein L39, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL39 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	131-UNIMOD:188,133-UNIMOD:4,140-UNIMOD:188	0.04	26.0	1	1	1
PRT	sp|P52788-2|SPSY_HUMAN	Isoform 2 of Spermine synthase OS=Homo sapiens OX=9606 GN=SMS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.05	26.0	1	1	1
PRT	sp|P49189-2|AL9A1_HUMAN	Isoform 2 of 4-trimethylaminobutyraldehyde dehydrogenase OS=Homo sapiens OX=9606 GN=ALDH9A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|P52735-3|VAV2_HUMAN	Isoform 3 of Guanine nucleotide exchange factor VAV2 OS=Homo sapiens OX=9606 GN=VAV2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|P61011-2|SRP54_HUMAN	Isoform 2 of Signal recognition particle 54 kDa protein OS=Homo sapiens OX=9606 GN=SRP54	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.04	26.0	1	1	1
PRT	sp|Q9NTJ3-2|SMC4_HUMAN	Isoform 2 of Structural maintenance of chromosomes protein 4 OS=Homo sapiens OX=9606 GN=SMC4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	598-UNIMOD:188,607-UNIMOD:188,522-UNIMOD:188	0.02	26.0	3	2	1
PRT	sp|P13798|ACPH_HUMAN	Acylamino-acid-releasing enzyme OS=Homo sapiens OX=9606 GN=APEH PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	30-UNIMOD:4	0.04	26.0	1	1	1
PRT	sp|O75390|CISY_HUMAN	Citrate synthase, mitochondrial OS=Homo sapiens OX=9606 GN=CS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	92-UNIMOD:267,94-UNIMOD:267	0.04	26.0	2	1	0
PRT	sp|P08574|CY1_HUMAN	Cytochrome c1, heme protein, mitochondrial OS=Homo sapiens OX=9606 GN=CYC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	219-UNIMOD:4	0.08	26.0	1	1	1
PRT	sp|P07900-2|HS90A_HUMAN	Isoform 2 of Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	621-UNIMOD:188,651-UNIMOD:4,656-UNIMOD:188	0.04	26.0	3	2	1
PRT	sp|Q9H0P0-3|5NT3A_HUMAN	Isoform 4 of Cytosolic 5'-nucleotidase 3A OS=Homo sapiens OX=9606 GN=NT5C3A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.05	26.0	2	1	0
PRT	sp|P18124|RL7_HUMAN	60S ribosomal protein L7 OS=Homo sapiens OX=9606 GN=RPL7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	77-UNIMOD:188,88-UNIMOD:188	0.05	26.0	2	1	0
PRT	sp|Q9UHY7-2|ENOPH_HUMAN	Isoform 2 of Enolase-phosphatase E1 OS=Homo sapiens OX=9606 GN=ENOPH1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	56-UNIMOD:4	0.19	26.0	1	1	1
PRT	sp|Q9UIA9|XPO7_HUMAN	Exportin-7 OS=Homo sapiens OX=9606 GN=XPO7 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	559-UNIMOD:188,568-UNIMOD:188	0.01	26.0	2	1	0
PRT	sp|P12270|TPR_HUMAN	Nucleoprotein TPR OS=Homo sapiens OX=9606 GN=TPR PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	1299-UNIMOD:188,1317-UNIMOD:188	0.01	26.0	2	1	0
PRT	sp|Q99538-3|LGMN_HUMAN	Isoform 3 of Legumain OS=Homo sapiens OX=9606 GN=LGMN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|Q9BX66-4|SRBS1_HUMAN	Isoform 4 of Sorbin and SH3 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SORBS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	510-UNIMOD:188,525-UNIMOD:188	0.02	26.0	1	1	1
PRT	sp|Q9UNH7-2|SNX6_HUMAN	Isoform 2 of Sorting nexin-6 OS=Homo sapiens OX=9606 GN=SNX6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.04	26.0	1	1	1
PRT	sp|O95456-2|PSMG1_HUMAN	Isoform 2 of Proteasome assembly chaperone 1 OS=Homo sapiens OX=9606 GN=PSMG1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	148-UNIMOD:4	0.04	26.0	1	1	1
PRT	sp|Q8NC51-4|PAIRB_HUMAN	Isoform 4 of Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	289-UNIMOD:188,299-UNIMOD:188	0.03	26.0	2	1	0
PRT	sp|P78346|RPP30_HUMAN	Ribonuclease P protein subunit p30 OS=Homo sapiens OX=9606 GN=RPP30 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	236-UNIMOD:188,246-UNIMOD:188	0.04	26.0	1	1	1
PRT	sp|P51114-3|FXR1_HUMAN	Isoform 3 of Fragile X mental retardation syndrome-related protein 1 OS=Homo sapiens OX=9606 GN=FXR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	161-UNIMOD:188,178-UNIMOD:267	0.04	26.0	2	1	0
PRT	sp|P48643-2|TCPE_HUMAN	Isoform 2 of T-complex protein 1 subunit epsilon OS=Homo sapiens OX=9606 GN=CCT5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	275-UNIMOD:188,277-UNIMOD:188,420-UNIMOD:188	0.07	26.0	4	2	0
PRT	sp|Q58FF3|ENPLL_HUMAN	Putative endoplasmin-like protein OS=Homo sapiens OX=9606 GN=HSP90B2P PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	160-UNIMOD:267	0.03	26.0	2	1	0
PRT	sp|P28482-2|MK01_HUMAN	Isoform 2 of Mitogen-activated protein kinase 1 OS=Homo sapiens OX=9606 GN=MAPK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.04	26.0	1	1	1
PRT	sp|P38646|GRP75_HUMAN	Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	513-UNIMOD:267	0.02	26.0	3	1	0
PRT	sp|P19447|ERCC3_HUMAN	General transcription and DNA repair factor IIH helicase subunit XPB OS=Homo sapiens OX=9606 GN=ERCC3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q9Y6M1-5|IF2B2_HUMAN	Isoform 5 of Insulin-like growth factor 2 mRNA-binding protein 2 OS=Homo sapiens OX=9606 GN=IGF2BP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	88-UNIMOD:188	0.03	26.0	1	1	1
PRT	sp|P98171|RHG04_HUMAN	Rho GTPase-activating protein 4 OS=Homo sapiens OX=9606 GN=ARHGAP4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	141-UNIMOD:267	0.01	26.0	2	1	0
PRT	sp|Q9BY42|RTF2_HUMAN	Replication termination factor 2 OS=Homo sapiens OX=9606 GN=RTF2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.05	26.0	2	1	0
PRT	sp|Q9NQW7-2|XPP1_HUMAN	Isoform 2 of Xaa-Pro aminopeptidase 1 OS=Homo sapiens OX=9606 GN=XPNPEP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	95-UNIMOD:35	0.04	26.0	1	1	1
PRT	sp|Q6ZN28|MACC1_HUMAN	Metastasis-associated in colon cancer protein 1 OS=Homo sapiens OX=9606 GN=MACC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	104-UNIMOD:4	0.02	26.0	1	1	1
PRT	sp|Q16629-3|SRSF7_HUMAN	Isoform 3 of Serine/arginine-rich splicing factor 7 OS=Homo sapiens OX=9606 GN=SRSF7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	106-UNIMOD:4,109-UNIMOD:4	0.28	26.0	2	2	1
PRT	sp|Q2M389-2|WASC4_HUMAN	Isoform 2 of WASH complex subunit 4 OS=Homo sapiens OX=9606 GN=WASHC4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	293-UNIMOD:267	0.02	26.0	1	1	0
PRT	sp|Q08752|PPID_HUMAN	Peptidyl-prolyl cis-trans isomerase D OS=Homo sapiens OX=9606 GN=PPID PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	145-UNIMOD:188	0.06	26.0	2	1	0
PRT	sp|O95478|NSA2_HUMAN	Ribosome biogenesis protein NSA2 homolog OS=Homo sapiens OX=9606 GN=NSA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	11-UNIMOD:267	0.04	26.0	1	1	1
PRT	sp|P31321|KAP1_HUMAN	cAMP-dependent protein kinase type I-beta regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR1B PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	306-UNIMOD:267,317-UNIMOD:267	0.03	26.0	2	1	0
PRT	sp|O75934|SPF27_HUMAN	Pre-mRNA-splicing factor SPF27 OS=Homo sapiens OX=9606 GN=BCAS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.06	26.0	2	1	0
PRT	sp|O43399-6|TPD54_HUMAN	Isoform 6 of Tumor protein D54 OS=Homo sapiens OX=9606 GN=TPD52L2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.07	26.0	1	1	1
PRT	sp|Q03519-2|TAP2_HUMAN	Isoform 2 of Antigen peptide transporter 2 OS=Homo sapiens OX=9606 GN=TAP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	353-UNIMOD:4,354-UNIMOD:267	0.02	26.0	2	1	0
PRT	sp|P25788-2|PSA3_HUMAN	Isoform 2 of Proteasome subunit alpha type-3 OS=Homo sapiens OX=9606 GN=PSMA3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	93-UNIMOD:267,100-UNIMOD:267	0.06	26.0	2	1	0
PRT	sp|P49411|EFTU_HUMAN	Elongation factor Tu, mitochondrial OS=Homo sapiens OX=9606 GN=TUFM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	315-UNIMOD:267,327-UNIMOD:267	0.04	26.0	1	1	1
PRT	sp|P17844-2|DDX5_HUMAN	Isoform 2 of Probable ATP-dependent RNA helicase DDX5 OS=Homo sapiens OX=9606 GN=DDX5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|Q92621|NU205_HUMAN	Nuclear pore complex protein Nup205 OS=Homo sapiens OX=9606 GN=NUP205 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|Q8N1F7|NUP93_HUMAN	Nuclear pore complex protein Nup93 OS=Homo sapiens OX=9606 GN=NUP93 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|Q8N9N7|LRC57_HUMAN	Leucine-rich repeat-containing protein 57 OS=Homo sapiens OX=9606 GN=LRRC57 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null	49-UNIMOD:188,60-UNIMOD:188	0.08	26.0	2	1	0
PRT	sp|Q5VYK3|ECM29_HUMAN	Proteasome adapter and scaffold protein ECM29 OS=Homo sapiens OX=9606 GN=ECPAS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	1459-UNIMOD:4,1468-UNIMOD:267	0.01	26.0	1	1	1
PRT	sp|Q9Y5X3|SNX5_HUMAN	Sorting nexin-5 OS=Homo sapiens OX=9606 GN=SNX5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	149-UNIMOD:267	0.03	26.0	2	1	0
PRT	sp|Q9P0J0|NDUAD_HUMAN	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 OS=Homo sapiens OX=9606 GN=NDUFA13 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	115-UNIMOD:267	0.08	26.0	1	1	1
PRT	sp|Q9NQX7-2|ITM2C_HUMAN	Isoform 2 of Integral membrane protein 2C OS=Homo sapiens OX=9606 GN=ITM2C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.06	26.0	1	1	1
PRT	sp|O60925|PFD1_HUMAN	Prefoldin subunit 1 OS=Homo sapiens OX=9606 GN=PFDN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.11	26.0	1	1	1
PRT	sp|O95831-6|AIFM1_HUMAN	Isoform 6 of Apoptosis-inducing factor 1, mitochondrial OS=Homo sapiens OX=9606 GN=AIFM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.08	26.0	1	1	1
PRT	sp|P84103-2|SRSF3_HUMAN	Isoform 2 of Serine/arginine-rich splicing factor 3 OS=Homo sapiens OX=9606 GN=SRSF3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.09	26.0	1	1	1
PRT	sp|Q9BV38|WDR18_HUMAN	WD repeat-containing protein 18 OS=Homo sapiens OX=9606 GN=WDR18 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null	401-UNIMOD:267,410-UNIMOD:267	0.03	26.0	2	1	0
PRT	sp|P18621|RL17_HUMAN	60S ribosomal protein L17 OS=Homo sapiens OX=9606 GN=RPL17 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.07	26.0	1	1	1
PRT	sp|Q9P015|RM15_HUMAN	39S ribosomal protein L15, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL15 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.09	26.0	2	2	2
PRT	sp|O75534-2|CSDE1_HUMAN	Isoform 2 of Cold shock domain-containing protein E1 OS=Homo sapiens OX=9606 GN=CSDE1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	286-UNIMOD:267	0.01	26.0	2	1	0
PRT	sp|P23396|RS3_HUMAN	40S ribosomal protein S3 OS=Homo sapiens OX=9606 GN=RPS3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	45-UNIMOD:267,54-UNIMOD:267	0.06	26.0	2	1	0
PRT	sp|Q14980|NUMA1_HUMAN	Nuclear mitotic apparatus protein 1 OS=Homo sapiens OX=9606 GN=NUMA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	null		0.01	26.0	1	1	0
PRT	sp|P18206|VINC_HUMAN	Vinculin OS=Homo sapiens OX=9606 GN=VCL PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	null	545-UNIMOD:385,545-UNIMOD:4,179-UNIMOD:28,188-UNIMOD:267	0.03	26.0	3	2	1
PRT	sp|Q01780|EXOSX_HUMAN	Exosome component 10 OS=Homo sapiens OX=9606 GN=EXOSC10 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	554-UNIMOD:4,555-UNIMOD:4	0.03	26.0	1	1	0
PRT	sp|Q96EV2|RBM33_HUMAN	RNA-binding protein 33 OS=Homo sapiens OX=9606 GN=RBM33 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	2	2	2
PRT	sp|Q9NRX1|PNO1_HUMAN	RNA-binding protein PNO1 OS=Homo sapiens OX=9606 GN=PNO1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	191-UNIMOD:188,199-UNIMOD:267	0.04	26.0	1	1	1
PRT	sp|Q15717|ELAV1_HUMAN	ELAV-like protein 1 OS=Homo sapiens OX=9606 GN=ELAVL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.08	26.0	1	1	1
PRT	sp|Q16629|SRSF7_HUMAN	Serine/arginine-rich splicing factor 7 OS=Homo sapiens OX=9606 GN=SRSF7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	58-UNIMOD:267,65-UNIMOD:267	0.09	26.0	2	1	0
PRT	sp|Q92925|SMRD2_HUMAN	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2 OS=Homo sapiens OX=9606 GN=SMARCD2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	null	298-UNIMOD:385,298-UNIMOD:4	0.03	26.0	1	1	1
PRT	sp|Q6KB66|K2C80_HUMAN	Keratin, type II cytoskeletal 80 OS=Homo sapiens OX=9606 GN=KRT80 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	93-UNIMOD:188,100-UNIMOD:188	0.03	26.0	2	1	0
PRT	sp|P62753|RS6_HUMAN	40S ribosomal protein S6 OS=Homo sapiens OX=9606 GN=RPS6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.05	26.0	1	1	1
PRT	sp|Q8IVS2|FABD_HUMAN	Malonyl-CoA-acyl carrier protein transacylase, mitochondrial OS=Homo sapiens OX=9606 GN=MCAT PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	246-UNIMOD:267	0.03	26.0	1	1	1
PRT	sp|Q9NVD7|PARVA_HUMAN	Alpha-parvin OS=Homo sapiens OX=9606 GN=PARVA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	null	229-UNIMOD:28	0.05	26.0	1	1	1
PRT	sp|Q9BYT8|NEUL_HUMAN	Neurolysin, mitochondrial OS=Homo sapiens OX=9606 GN=NLN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	153-UNIMOD:4	0.02	26.0	1	1	1
PRT	sp|O75150|BRE1B_HUMAN	E3 ubiquitin-protein ligase BRE1B OS=Homo sapiens OX=9606 GN=RNF40 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|P06493|CDK1_HUMAN	Cyclin-dependent kinase 1 OS=Homo sapiens OX=9606 GN=CDK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.06	26.0	1	1	0
PRT	sp|P46379-2|BAG6_HUMAN	Isoform 2 of Large proline-rich protein BAG6 OS=Homo sapiens OX=9606 GN=BAG6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	1071-UNIMOD:267,1081-UNIMOD:267	0.01	25.0	1	1	1
PRT	sp|P15927|RFA2_HUMAN	Replication protein A 32 kDa subunit OS=Homo sapiens OX=9606 GN=RPA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	219-UNIMOD:4	0.06	25.0	1	1	1
PRT	sp|Q9BR76|COR1B_HUMAN	Coronin-1B OS=Homo sapiens OX=9606 GN=CORO1B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	345-UNIMOD:4	0.06	25.0	2	2	2
PRT	sp|P09496-5|CLCA_HUMAN	Isoform 5 of Clathrin light chain A OS=Homo sapiens OX=9606 GN=CLTA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.07	25.0	1	1	1
PRT	sp|Q9UNF0-2|PACN2_HUMAN	Isoform 2 of Protein kinase C and casein kinase substrate in neurons protein 2 OS=Homo sapiens OX=9606 GN=PACSIN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	275-UNIMOD:267,38-UNIMOD:4,44-UNIMOD:4,48-UNIMOD:267	0.06	25.0	3	2	1
PRT	sp|Q96C01|F136A_HUMAN	Protein FAM136A OS=Homo sapiens OX=9606 GN=FAM136A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	57-UNIMOD:4,74-UNIMOD:188	0.14	25.0	1	1	1
PRT	sp|P61019-2|RAB2A_HUMAN	Isoform 2 of Ras-related protein Rab-2A OS=Homo sapiens OX=9606 GN=RAB2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	81-UNIMOD:267	0.08	25.0	1	1	1
PRT	sp|Q9NZL4-2|HPBP1_HUMAN	Isoform 2 of Hsp70-binding protein 1 OS=Homo sapiens OX=9606 GN=HSPBP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	207-UNIMOD:4,208-UNIMOD:267,219-UNIMOD:267	0.06	25.0	2	1	0
PRT	sp|Q9UKF6|CPSF3_HUMAN	Cleavage and polyadenylation specificity factor subunit 3 OS=Homo sapiens OX=9606 GN=CPSF3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	223-UNIMOD:4	0.02	25.0	1	1	1
PRT	sp|P05388-2|RLA0_HUMAN	Isoform 2 of 60S acidic ribosomal protein P0 OS=Homo sapiens OX=9606 GN=RPLP0	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	77-UNIMOD:188	0.05	25.0	1	1	1
PRT	sp|P11310|ACADM_HUMAN	Medium-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ACADM PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	256-UNIMOD:188,259-UNIMOD:188	0.03	25.0	2	1	0
PRT	sp|Q9Y5Q8-2|TF3C5_HUMAN	Isoform 2 of General transcription factor 3C polypeptide 5 OS=Homo sapiens OX=9606 GN=GTF3C5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	329-UNIMOD:188	0.02	25.0	2	1	0
PRT	sp|P23368|MAOM_HUMAN	NAD-dependent malic enzyme, mitochondrial OS=Homo sapiens OX=9606 GN=ME2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	496-UNIMOD:188	0.02	25.0	2	1	0
PRT	sp|Q6UXV4|MIC27_HUMAN	MICOS complex subunit MIC27 OS=Homo sapiens OX=9606 GN=APOOL PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	232-UNIMOD:188	0.06	25.0	2	1	0
PRT	sp|Q9BUQ8|DDX23_HUMAN	Probable ATP-dependent RNA helicase DDX23 OS=Homo sapiens OX=9606 GN=DDX23 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|P35573|GDE_HUMAN	Glycogen debranching enzyme OS=Homo sapiens OX=9606 GN=AGL PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	17-UNIMOD:188,20-UNIMOD:188	0.01	25.0	2	1	0
PRT	sp|O43813|LANC1_HUMAN	Glutathione S-transferase LANCL1 OS=Homo sapiens OX=9606 GN=LANCL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	183-UNIMOD:4,195-UNIMOD:267	0.06	25.0	1	1	1
PRT	sp|Q16881-7|TRXR1_HUMAN	Isoform 7 of Thioredoxin reductase 1, cytoplasmic OS=Homo sapiens OX=9606 GN=TXNRD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q9H2G2-2|SLK_HUMAN	Isoform 2 of STE20-like serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=SLK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|O60493-2|SNX3_HUMAN	Isoform 2 of Sorting nexin-3 OS=Homo sapiens OX=9606 GN=SNX3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	87-UNIMOD:188,96-UNIMOD:188	0.08	25.0	2	1	0
PRT	sp|Q13200-2|PSMD2_HUMAN	Isoform 2 of 26S proteasome non-ATPase regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PSMD2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	614-UNIMOD:188	0.01	25.0	1	1	0
PRT	sp|Q5T447|HECD3_HUMAN	E3 ubiquitin-protein ligase HECTD3 OS=Homo sapiens OX=9606 GN=HECTD3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	193-UNIMOD:267,206-UNIMOD:267	0.02	25.0	2	1	0
PRT	sp|Q8WZA0|LZIC_HUMAN	Protein LZIC OS=Homo sapiens OX=9606 GN=LZIC PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.06	25.0	1	1	1
PRT	sp|P35270|SPRE_HUMAN	Sepiapterin reductase OS=Homo sapiens OX=9606 GN=SPR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.05	25.0	1	1	1
PRT	sp|Q13586-2|STIM1_HUMAN	Isoform 2 of Stromal interaction molecule 1 OS=Homo sapiens OX=9606 GN=STIM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	514-UNIMOD:267	0.02	25.0	2	1	0
PRT	sp|P20042|IF2B_HUMAN	Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	302-UNIMOD:4,305-UNIMOD:4,308-UNIMOD:267	0.04	25.0	2	1	0
PRT	sp|Q8TEQ6|GEMI5_HUMAN	Gem-associated protein 5 OS=Homo sapiens OX=9606 GN=GEMIN5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	152-UNIMOD:267	0.01	25.0	1	1	1
PRT	sp|P49069|CAMLG_HUMAN	Calcium signal-modulating cyclophilin ligand OS=Homo sapiens OX=9606 GN=CAMLG PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	136-UNIMOD:267,146-UNIMOD:267	0.04	25.0	2	1	0
PRT	sp|Q5VWX1|KHDR2_HUMAN	KH domain-containing, RNA-binding, signal transduction-associated protein 2 OS=Homo sapiens OX=9606 GN=KHDRBS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.06	25.0	2	2	2
PRT	sp|Q8WWI1-3|LMO7_HUMAN	Isoform 3 of LIM domain only protein 7 OS=Homo sapiens OX=9606 GN=LMO7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|P25205|MCM3_HUMAN	DNA replication licensing factor MCM3 OS=Homo sapiens OX=9606 GN=MCM3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|P46060|RAGP1_HUMAN	Ran GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RANGAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	413-UNIMOD:188,445-UNIMOD:188,169-UNIMOD:4	0.10	25.0	3	3	3
PRT	sp|P07237|PDIA1_HUMAN	Protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	42-UNIMOD:188	0.02	25.0	2	1	0
PRT	sp|P15880|RS2_HUMAN	40S ribosomal protein S2 OS=Homo sapiens OX=9606 GN=RPS2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	212-UNIMOD:188,222-UNIMOD:4,227-UNIMOD:267	0.10	25.0	2	2	2
PRT	sp|O00186|STXB3_HUMAN	Syntaxin-binding protein 3 OS=Homo sapiens OX=9606 GN=STXBP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	90-UNIMOD:4	0.02	25.0	1	1	1
PRT	sp|Q9H2C0|GAN_HUMAN	Gigaxonin OS=Homo sapiens OX=9606 GN=GAN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	452-UNIMOD:4	0.02	25.0	1	1	1
PRT	sp|Q05639|EF1A2_HUMAN	Elongation factor 1-alpha 2 OS=Homo sapiens OX=9606 GN=EEF1A2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	276-UNIMOD:35	0.05	25.0	2	1	0
PRT	sp|Q9Y383-3|LC7L2_HUMAN	Isoform 3 of Putative RNA-binding protein Luc7-like 2 OS=Homo sapiens OX=9606 GN=LUC7L2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|O00231|PSD11_HUMAN	26S proteasome non-ATPase regulatory subunit 11 OS=Homo sapiens OX=9606 GN=PSMD11 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	355-UNIMOD:188	0.03	25.0	1	1	1
PRT	sp|Q8N163-2|CCAR2_HUMAN	Isoform 2 of Cell cycle and apoptosis regulator protein 2 OS=Homo sapiens OX=9606 GN=CCAR2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|Q13263-2|TIF1B_HUMAN	Isoform 2 of Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q13148|TADBP_HUMAN	TAR DNA-binding protein 43 OS=Homo sapiens OX=9606 GN=TARDBP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	173-UNIMOD:4,175-UNIMOD:4,176-UNIMOD:188,181-UNIMOD:188	0.03	25.0	2	1	0
PRT	sp|Q9GZL7|WDR12_HUMAN	Ribosome biogenesis protein WDR12 OS=Homo sapiens OX=9606 GN=WDR12 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.05	25.0	1	1	1
PRT	sp|P43490|NAMPT_HUMAN	Nicotinamide phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=NAMPT PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	117-UNIMOD:188	0.02	25.0	1	1	1
PRT	sp|Q9Y6E2|BZW2_HUMAN	Basic leucine zipper and W2 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=BZW2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.04	25.0	1	1	1
PRT	sp|Q13451|FKBP5_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Homo sapiens OX=9606 GN=FKBP5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|O43795-2|MYO1B_HUMAN	Isoform 2 of Unconventional myosin-Ib OS=Homo sapiens OX=9606 GN=MYO1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|Q13126-7|MTAP_HUMAN	Isoform 7 of S-methyl-5'-thioadenosine phosphorylase OS=Homo sapiens OX=9606 GN=MTAP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.08	25.0	2	1	0
PRT	sp|P50395|GDIB_HUMAN	Rab GDP dissociation inhibitor beta OS=Homo sapiens OX=9606 GN=GDI2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	414-UNIMOD:4	0.05	25.0	1	1	0
PRT	sp|Q15029|U5S1_HUMAN	116 kDa U5 small nuclear ribonucleoprotein component OS=Homo sapiens OX=9606 GN=EFTUD2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	578-UNIMOD:267,581-UNIMOD:188	0.01	25.0	1	1	1
PRT	sp|Q15459|SF3A1_HUMAN	Splicing factor 3A subunit 1 OS=Homo sapiens OX=9606 GN=SF3A1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	473-UNIMOD:267,486-UNIMOD:188	0.02	25.0	1	1	0
PRT	sp|P25788|PSA3_HUMAN	Proteasome subunit alpha type-3 OS=Homo sapiens OX=9606 GN=PSMA3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.06	25.0	1	1	0
PRT	sp|O15042|SR140_HUMAN	U2 snRNP-associated SURP motif-containing protein OS=Homo sapiens OX=9606 GN=U2SURP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	647-UNIMOD:188	0.01	25.0	1	1	1
PRT	sp|Q9BT78|CSN4_HUMAN	COP9 signalosome complex subunit 4 OS=Homo sapiens OX=9606 GN=COPS4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	null	64-UNIMOD:28,70-UNIMOD:4	0.05	25.0	1	1	0
PRT	sp|Q13200|PSMD2_HUMAN	26S proteasome non-ATPase regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PSMD2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.01	25.0	1	1	0
PRT	sp|Q96KG9|SCYL1_HUMAN	N-terminal kinase-like protein OS=Homo sapiens OX=9606 GN=SCYL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	241-UNIMOD:4	0.02	25.0	1	1	1
PRT	sp|O96008|TOM40_HUMAN	Mitochondrial import receptor subunit TOM40 homolog OS=Homo sapiens OX=9606 GN=TOMM40 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	null	90-UNIMOD:385,90-UNIMOD:4,91-UNIMOD:188,102-UNIMOD:188	0.04	25.0	1	1	1
PRT	sp|Q00610|CLH1_HUMAN	Clathrin heavy chain 1 OS=Homo sapiens OX=9606 GN=CLTC PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	951-UNIMOD:188,967-UNIMOD:267	0.01	25.0	1	1	0
PRT	sp|P31948-2|STIP1_HUMAN	Isoform 2 of Stress-induced-phosphoprotein 1 OS=Homo sapiens OX=9606 GN=STIP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	2	2	2
PRT	sp|Q9Y3B7-3|RM11_HUMAN	Isoform 3 of 39S ribosomal protein L11, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL11	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.10	24.0	1	1	1
PRT	sp|P51617-4|IRAK1_HUMAN	Isoform 4 of Interleukin-1 receptor-associated kinase 1 OS=Homo sapiens OX=9606 GN=IRAK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	501-UNIMOD:267	0.04	24.0	1	1	1
PRT	sp|P40227-2|TCPZ_HUMAN	Isoform 2 of T-complex protein 1 subunit zeta OS=Homo sapiens OX=9606 GN=CCT6A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|O00764-3|PDXK_HUMAN	Isoform 3 of Pyridoxal kinase OS=Homo sapiens OX=9606 GN=PDXK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.08	24.0	1	1	1
PRT	sp|Q13459-2|MYO9B_HUMAN	Isoform Short of Unconventional myosin-IXb OS=Homo sapiens OX=9606 GN=MYO9B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q96QK1|VPS35_HUMAN	Vacuolar protein sorting-associated protein 35 OS=Homo sapiens OX=9606 GN=VPS35 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	24.0	null	640-UNIMOD:4,640-UNIMOD:385	0.02	24.0	2	1	0
PRT	sp|P48163-2|MAOX_HUMAN	Isoform 2 of NADP-dependent malic enzyme OS=Homo sapiens OX=9606 GN=ME1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|P08243-3|ASNS_HUMAN	Isoform 3 of Asparagine synthetase [glutamine-hydrolyzing] OS=Homo sapiens OX=9606 GN=ASNS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	334-UNIMOD:267	0.05	24.0	2	2	2
PRT	sp|Q96ME1-4|FXL18_HUMAN	Isoform 4 of F-box/LRR-repeat protein 18 OS=Homo sapiens OX=9606 GN=FBXL18	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|P62857|RS28_HUMAN	40S ribosomal protein S28 OS=Homo sapiens OX=9606 GN=RPS28 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.23	24.0	1	1	1
PRT	sp|P49321-2|NASP_HUMAN	Isoform 2 of Nuclear autoantigenic sperm protein OS=Homo sapiens OX=9606 GN=NASP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|P52292|IMA1_HUMAN	Importin subunit alpha-1 OS=Homo sapiens OX=9606 GN=KPNA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q9UJU6|DBNL_HUMAN	Drebrin-like protein OS=Homo sapiens OX=9606 GN=DBNL PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.05	24.0	1	1	1
PRT	sp|P62993-2|GRB2_HUMAN	Isoform 2 of Growth factor receptor-bound protein 2 OS=Homo sapiens OX=9606 GN=GRB2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.07	24.0	1	1	1
PRT	sp|O43719|HTSF1_HUMAN	HIV Tat-specific factor 1 OS=Homo sapiens OX=9606 GN=HTATSF1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	221-UNIMOD:188,228-UNIMOD:188	0.02	24.0	2	1	0
PRT	sp|O60524-4|NEMF_HUMAN	Isoform 4 of Nuclear export mediator factor NEMF OS=Homo sapiens OX=9606 GN=NEMF	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q8NEV1|CSK23_HUMAN	Casein kinase II subunit alpha 3 OS=Homo sapiens OX=9606 GN=CSNK2A3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.05	24.0	1	1	1
PRT	sp|Q96QC0|PP1RA_HUMAN	Serine/threonine-protein phosphatase 1 regulatory subunit 10 OS=Homo sapiens OX=9606 GN=PPP1R10 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|O00148-3|DX39A_HUMAN	Isoform 3 of ATP-dependent RNA helicase DDX39A OS=Homo sapiens OX=9606 GN=DDX39A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	47-UNIMOD:267	0.05	24.0	1	1	1
PRT	sp|Q14247-3|SRC8_HUMAN	Isoform 3 of Src substrate cortactin OS=Homo sapiens OX=9606 GN=CTTN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	112-UNIMOD:4,119-UNIMOD:267	0.02	24.0	1	1	1
PRT	sp|P14649|MYL6B_HUMAN	Myosin light chain 6B OS=Homo sapiens OX=9606 GN=MYL6B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.05	24.0	1	1	1
PRT	sp|P16144-4|ITB4_HUMAN	Isoform Beta-4D of Integrin beta-4 OS=Homo sapiens OX=9606 GN=ITGB4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	1726-UNIMOD:267	0.01	24.0	2	1	0
PRT	sp|P41223|BUD31_HUMAN	Protein BUD31 homolog OS=Homo sapiens OX=9606 GN=BUD31 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	134-UNIMOD:4,137-UNIMOD:4,139-UNIMOD:4	0.08	24.0	1	1	1
PRT	sp|P11766|ADHX_HUMAN	Alcohol dehydrogenase class-3 OS=Homo sapiens OX=9606 GN=ADH5 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	226-UNIMOD:188,228-UNIMOD:188	0.03	24.0	1	1	1
PRT	sp|P49368-2|TCPG_HUMAN	Isoform 2 of T-complex protein 1 subunit gamma OS=Homo sapiens OX=9606 GN=CCT3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	40-UNIMOD:188	0.02	24.0	2	1	0
PRT	sp|O15355|PPM1G_HUMAN	Protein phosphatase 1G OS=Homo sapiens OX=9606 GN=PPM1G PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	463-UNIMOD:267,470-UNIMOD:267	0.02	24.0	1	1	1
PRT	sp|Q14152-2|EIF3A_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit A OS=Homo sapiens OX=9606 GN=EIF3A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q9BY32-3|ITPA_HUMAN	Isoform 3 of Inosine triphosphate pyrophosphatase OS=Homo sapiens OX=9606 GN=ITPA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.07	24.0	1	1	1
PRT	sp|O60610-2|DIAP1_HUMAN	Isoform 2 of Protein diaphanous homolog 1 OS=Homo sapiens OX=9606 GN=DIAPH1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q14978|NOLC1_HUMAN	Nucleolar and coiled-body phosphoprotein 1 OS=Homo sapiens OX=9606 GN=NOLC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	2	2	2
PRT	sp|Q13428-2|TCOF_HUMAN	Isoform 2 of Treacle protein OS=Homo sapiens OX=9606 GN=TCOF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q14192|FHL2_HUMAN	Four and a half LIM domains protein 2 OS=Homo sapiens OX=9606 GN=FHL2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|O76094-2|SRP72_HUMAN	Isoform 2 of Signal recognition particle subunit SRP72 OS=Homo sapiens OX=9606 GN=SRP72	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	240-UNIMOD:188,249-UNIMOD:188	0.02	24.0	2	1	0
PRT	sp|P00966|ASSY_HUMAN	Argininosuccinate synthase OS=Homo sapiens OX=9606 GN=ASS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|P43686-2|PRS6B_HUMAN	Isoform 2 of 26S proteasome regulatory subunit 6B OS=Homo sapiens OX=9606 GN=PSMC4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.06	24.0	1	1	1
PRT	sp|P47813|IF1AX_HUMAN	Eukaryotic translation initiation factor 1A, X-chromosomal OS=Homo sapiens OX=9606 GN=EIF1AX PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	51-UNIMOD:4	0.08	24.0	1	1	1
PRT	sp|Q9NZM5|NOP53_HUMAN	Ribosome biogenesis protein NOP53 OS=Homo sapiens OX=9606 GN=NOP53 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	94-UNIMOD:188,96-UNIMOD:188	0.03	24.0	1	1	1
PRT	sp|Q7L9B9|EEPD1_HUMAN	Endonuclease/exonuclease/phosphatase family domain-containing protein 1 OS=Homo sapiens OX=9606 GN=EEPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q9BTV4|TMM43_HUMAN	Transmembrane protein 43 OS=Homo sapiens OX=9606 GN=TMEM43 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|Q7L4I2-2|RSRC2_HUMAN	Isoform 2 of Arginine/serine-rich coiled-coil protein 2 OS=Homo sapiens OX=9606 GN=RSRC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|P54136-2|SYRC_HUMAN	Isoform Monomeric of Arginine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=RARS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	17-UNIMOD:188	0.02	24.0	1	1	1
PRT	sp|P11387|TOP1_HUMAN	DNA topoisomerase 1 OS=Homo sapiens OX=9606 GN=TOP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q86TI2-4|DPP9_HUMAN	Isoform 3 of Dipeptidyl peptidase 9 OS=Homo sapiens OX=9606 GN=DPP9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	225-UNIMOD:4,237-UNIMOD:188	0.02	24.0	2	1	0
PRT	sp|Q9GZS3|WDR61_HUMAN	WD repeat-containing protein 61 OS=Homo sapiens OX=9606 GN=WDR61 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	97-UNIMOD:188,100-UNIMOD:188	0.04	24.0	1	1	1
PRT	sp|Q16643|DREB_HUMAN	Drebrin OS=Homo sapiens OX=9606 GN=DBN1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	211-UNIMOD:35,215-UNIMOD:267,221-UNIMOD:267	0.02	24.0	1	1	1
PRT	sp|P00403|COX2_HUMAN	Cytochrome c oxidase subunit 2 OS=Homo sapiens OX=9606 GN=MT-CO2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	152-UNIMOD:35	0.09	24.0	1	1	1
PRT	sp|Q06481-5|APLP2_HUMAN	Isoform 5 of Amyloid-like protein 2 OS=Homo sapiens OX=9606 GN=APLP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	504-UNIMOD:35,515-UNIMOD:188	0.02	24.0	1	1	1
PRT	sp|Q00765-2|REEP5_HUMAN	Isoform 2 of Receptor expression-enhancing protein 5 OS=Homo sapiens OX=9606 GN=REEP5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	18-UNIMOD:4,25-UNIMOD:188,29-UNIMOD:188	0.11	24.0	1	1	1
PRT	sp|Q4V328-3|GRAP1_HUMAN	Isoform 3 of GRIP1-associated protein 1 OS=Homo sapiens OX=9606 GN=GRIPAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q15785|TOM34_HUMAN	Mitochondrial import receptor subunit TOM34 OS=Homo sapiens OX=9606 GN=TOMM34 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|Q96A65|EXOC4_HUMAN	Exocyst complex component 4 OS=Homo sapiens OX=9606 GN=EXOC4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	668-UNIMOD:267,676-UNIMOD:267	0.01	24.0	2	1	0
PRT	sp|P11234|RALB_HUMAN	Ras-related protein Ral-B OS=Homo sapiens OX=9606 GN=RALB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.05	24.0	1	1	1
PRT	sp|Q8WUX9|CHMP7_HUMAN	Charged multivesicular body protein 7 OS=Homo sapiens OX=9606 GN=CHMP7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|O60313-13|OPA1_HUMAN	Isoform 7 of Dynamin-like 120 kDa protein, mitochondrial OS=Homo sapiens OX=9606 GN=OPA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q9Y305-3|ACOT9_HUMAN	Isoform 3 of Acyl-coenzyme A thioesterase 9, mitochondrial OS=Homo sapiens OX=9606 GN=ACOT9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	239-UNIMOD:4,244-UNIMOD:267,212-UNIMOD:188	0.07	24.0	3	2	1
PRT	sp|Q15392-2|DHC24_HUMAN	Isoform 2 of Delta(24)-sterol reductase OS=Homo sapiens OX=9606 GN=DHCR24	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	275-UNIMOD:267,284-UNIMOD:267	0.03	24.0	1	1	1
PRT	sp|P30047-2|GFRP_HUMAN	Isoform 2 of GTP cyclohydrolase 1 feedback regulatory protein OS=Homo sapiens OX=9606 GN=GCHFR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	69-UNIMOD:4	0.26	24.0	1	1	1
PRT	sp|P61353|RL27_HUMAN	60S ribosomal protein L27 OS=Homo sapiens OX=9606 GN=RPL27 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	84-UNIMOD:267	0.09	24.0	2	1	0
PRT	sp|P62258-2|1433E_HUMAN	Isoform SV of 14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.06	24.0	1	1	1
PRT	sp|Q92466-2|DDB2_HUMAN	Isoform D1 of DNA damage-binding protein 2 OS=Homo sapiens OX=9606 GN=DDB2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.07	24.0	1	1	1
PRT	sp|P55060|XPO2_HUMAN	Exportin-2 OS=Homo sapiens OX=9606 GN=CSE1L PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	372-UNIMOD:267,382-UNIMOD:267	0.01	24.0	1	1	1
PRT	sp|P34897|GLYM_HUMAN	Serine hydroxymethyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=SHMT2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|P0CW19|LIMS3_HUMAN	LIM and senescent cell antigen-like-containing domain protein 3 OS=Homo sapiens OX=9606 GN=LIMS3 PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	36-UNIMOD:267,40-UNIMOD:188	0.18	24.0	1	1	1
PRT	sp|O60610|DIAP1_HUMAN	Protein diaphanous homolog 1 OS=Homo sapiens OX=9606 GN=DIAPH1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null	454-UNIMOD:385,454-UNIMOD:4,468-UNIMOD:35	0.01	24.0	1	1	1
PRT	sp|Q2M389|WASC4_HUMAN	WASH complex subunit 4 OS=Homo sapiens OX=9606 GN=WASHC4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.01	24.0	1	1	0
PRT	sp|Q7Z6M1|RABEK_HUMAN	Rab9 effector protein with kelch motifs OS=Homo sapiens OX=9606 GN=RABEPK PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.06	24.0	1	1	0
PRT	sp|E9PAV3|NACAM_HUMAN	Nascent polypeptide-associated complex subunit alpha, muscle-specific form OS=Homo sapiens OX=9606 GN=NACA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.01	24.0	1	1	0
PRT	sp|Q99986|VRK1_HUMAN	Serine/threonine-protein kinase VRK1 OS=Homo sapiens OX=9606 GN=VRK1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	34-UNIMOD:188	0.05	24.0	1	1	1
PRT	sp|P14324|FPPS_HUMAN	Farnesyl pyrophosphate synthase OS=Homo sapiens OX=9606 GN=FDPS PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null	81-UNIMOD:28,92-UNIMOD:267	0.03	24.0	1	1	1
PRT	sp|Q49A26|GLYR1_HUMAN	Putative oxidoreductase GLYR1 OS=Homo sapiens OX=9606 GN=GLYR1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null	486-UNIMOD:385,486-UNIMOD:4	0.03	24.0	1	1	0
PRT	sp|P04114|APOB_HUMAN	Apolipoprotein B-100 OS=Homo sapiens OX=9606 GN=APOB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.00	24.0	1	1	1
PRT	sp|P11388|TOP2A_HUMAN	DNA topoisomerase 2-alpha OS=Homo sapiens OX=9606 GN=TOP2A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	242-UNIMOD:267,251-UNIMOD:188	0.01	24.0	1	1	1
PRT	sp|Q86UY6|NAA40_HUMAN	N-alpha-acetyltransferase 40 OS=Homo sapiens OX=9606 GN=NAA40 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.08	24.0	1	1	1
PRT	sp|Q9BUK6|MSTO1_HUMAN	Protein misato homolog 1 OS=Homo sapiens OX=9606 GN=MSTO1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q15643|TRIPB_HUMAN	Thyroid receptor-interacting protein 11 OS=Homo sapiens OX=9606 GN=TRIP11 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	1597-UNIMOD:267,419-UNIMOD:188,421-UNIMOD:188	0.02	24.0	2	2	2
PRT	sp|P35080|PROF2_HUMAN	Profilin-2 OS=Homo sapiens OX=9606 GN=PFN2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.11	24.0	1	1	1
PRT	sp|Q01196|RUNX1_HUMAN	Runt-related transcription factor 1 OS=Homo sapiens OX=9606 GN=RUNX1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.04	24.0	1	1	0
PRT	sp|P09104-2|ENOG_HUMAN	Isoform 2 of Gamma-enolase OS=Homo sapiens OX=9606 GN=ENO2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	83-UNIMOD:267,89-UNIMOD:267	0.03	23.0	1	1	1
PRT	sp|Q6ZMZ3-3|SYNE3_HUMAN	Isoform 3 of Nesprin-3 OS=Homo sapiens OX=9606 GN=SYNE3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	322-UNIMOD:267,324-UNIMOD:267	0.02	23.0	1	1	1
PRT	sp|P30153|2AAA_HUMAN	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Homo sapiens OX=9606 GN=PPP2R1A PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	280-UNIMOD:188,292-UNIMOD:188	0.04	23.0	1	1	1
PRT	sp|P42345|MTOR_HUMAN	Serine/threonine-protein kinase mTOR OS=Homo sapiens OX=9606 GN=MTOR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	1563-UNIMOD:4	0.01	23.0	1	1	1
PRT	sp|Q8IXI2-6|MIRO1_HUMAN	Isoform 6 of Mitochondrial Rho GTPase 1 OS=Homo sapiens OX=9606 GN=RHOT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	175-UNIMOD:4	0.06	23.0	1	1	1
PRT	sp|O75821|EIF3G_HUMAN	Eukaryotic translation initiation factor 3 subunit G OS=Homo sapiens OX=9606 GN=EIF3G PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	169-UNIMOD:4,172-UNIMOD:188,180-UNIMOD:188	0.04	23.0	2	1	0
PRT	sp|Q9UKG1|DP13A_HUMAN	DCC-interacting protein 13-alpha OS=Homo sapiens OX=9606 GN=APPL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	124-UNIMOD:188,130-UNIMOD:188	0.01	23.0	1	1	1
PRT	sp|Q9UNZ2-6|NSF1C_HUMAN	Isoform 4 of NSFL1 cofactor p47 OS=Homo sapiens OX=9606 GN=NSFL1C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	25-UNIMOD:267	0.04	23.0	1	1	1
PRT	sp|O75683|SURF6_HUMAN	Surfeit locus protein 6 OS=Homo sapiens OX=9606 GN=SURF6 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	202-UNIMOD:188,213-UNIMOD:188	0.06	23.0	1	1	1
PRT	sp|Q96CW1-2|AP2M1_HUMAN	Isoform 2 of AP-2 complex subunit mu OS=Homo sapiens OX=9606 GN=AP2M1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	217-UNIMOD:188,222-UNIMOD:188	0.03	23.0	1	1	1
PRT	sp|O95433|AHSA1_HUMAN	Activator of 90 kDa heat shock protein ATPase homolog 1 OS=Homo sapiens OX=9606 GN=AHSA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	268-UNIMOD:188	0.09	23.0	2	2	2
PRT	sp|Q15293-2|RCN1_HUMAN	Isoform 2 of Reticulocalbin-1 OS=Homo sapiens OX=9606 GN=RCN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	125-UNIMOD:188,137-UNIMOD:267	0.05	23.0	1	1	1
PRT	sp|Q9UBZ4|APEX2_HUMAN	DNA-(apurinic or apyrimidinic site) lyase 2 OS=Homo sapiens OX=9606 GN=APEX2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.05	23.0	1	1	1
PRT	sp|Q9ULG1|INO80_HUMAN	Chromatin-remodeling ATPase INO80 OS=Homo sapiens OX=9606 GN=INO80 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|P48506|GSH1_HUMAN	Glutamate--cysteine ligase catalytic subunit OS=Homo sapiens OX=9606 GN=GCLC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q99714-2|HCD2_HUMAN	Isoform 2 of 3-hydroxyacyl-CoA dehydrogenase type-2 OS=Homo sapiens OX=9606 GN=HSD17B10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	116-UNIMOD:267	0.05	23.0	1	1	1
PRT	sp|Q04637-6|IF4G1_HUMAN	Isoform E of Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	1093-UNIMOD:267	0.01	23.0	1	1	1
PRT	sp|Q8TCG1|CIP2A_HUMAN	Protein CIP2A OS=Homo sapiens OX=9606 GN=CIP2A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	40-UNIMOD:188	0.01	23.0	1	1	1
PRT	sp|O15269|SPTC1_HUMAN	Serine palmitoyltransferase 1 OS=Homo sapiens OX=9606 GN=SPTLC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	23.0	null	219-UNIMOD:267	0.02	23.0	2	1	0
PRT	sp|Q6P9B6|MEAK7_HUMAN	MTOR-associated protein MEAK7 OS=Homo sapiens OX=9606 GN=MEAK7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	450-UNIMOD:267	0.03	23.0	1	1	1
PRT	sp|O14734|ACOT8_HUMAN	Acyl-coenzyme A thioesterase 8 OS=Homo sapiens OX=9606 GN=ACOT8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.08	23.0	1	1	1
PRT	sp|P17174-2|AATC_HUMAN	Isoform 2 of Aspartate aminotransferase, cytoplasmic OS=Homo sapiens OX=9606 GN=GOT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.06	23.0	1	1	1
PRT	sp|Q86UP2-2|KTN1_HUMAN	Isoform 2 of Kinectin OS=Homo sapiens OX=9606 GN=KTN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q16204|CCDC6_HUMAN	Coiled-coil domain-containing protein 6 OS=Homo sapiens OX=9606 GN=CCDC6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|Q16576|RBBP7_HUMAN	Histone-binding protein RBBP7 OS=Homo sapiens OX=9606 GN=RBBP7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	132-UNIMOD:35,142-UNIMOD:188	0.05	23.0	3	2	1
PRT	sp|O95758-1|PTBP3_HUMAN	Isoform 1 of Polypyrimidine tract-binding protein 3 OS=Homo sapiens OX=9606 GN=PTBP3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	37-UNIMOD:4	0.04	23.0	1	1	1
PRT	sp|P62888|RL30_HUMAN	60S ribosomal protein L30 OS=Homo sapiens OX=9606 GN=RPL30 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.09	23.0	1	1	1
PRT	sp|P08708|RS17_HUMAN	40S ribosomal protein S17 OS=Homo sapiens OX=9606 GN=RPS17 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	32-UNIMOD:188	0.07	23.0	1	1	1
PRT	sp|Q9H0S4-2|DDX47_HUMAN	Isoform 2 of Probable ATP-dependent RNA helicase DDX47 OS=Homo sapiens OX=9606 GN=DDX47	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	161-UNIMOD:188	0.02	23.0	2	1	0
PRT	sp|Q15042|RB3GP_HUMAN	Rab3 GTPase-activating protein catalytic subunit OS=Homo sapiens OX=9606 GN=RAB3GAP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q96CV9-3|OPTN_HUMAN	Isoform 3 of Optineurin OS=Homo sapiens OX=9606 GN=OPTN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|P61457|PHS_HUMAN	Pterin-4-alpha-carbinolamine dehydratase OS=Homo sapiens OX=9606 GN=PCBD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.14	23.0	1	1	1
PRT	sp|P55265-5|DSRAD_HUMAN	Isoform 5 of Double-stranded RNA-specific adenosine deaminase OS=Homo sapiens OX=9606 GN=ADAR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q8N8R7|AL14E_HUMAN	ARL14 effector protein OS=Homo sapiens OX=9606 GN=ARL14EP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.07	23.0	1	1	1
PRT	sp|P30084|ECHM_HUMAN	Enoyl-CoA hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=ECHS1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.05	23.0	1	1	1
PRT	sp|P53007|TXTP_HUMAN	Tricarboxylate transport protein, mitochondrial OS=Homo sapiens OX=9606 GN=SLC25A1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	262-UNIMOD:4	0.04	23.0	1	1	1
PRT	sp|Q9UH17-3|ABC3B_HUMAN	Isoform 3 of DNA dC->dU-editing enzyme APOBEC-3B OS=Homo sapiens OX=9606 GN=APOBEC3B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	329-UNIMOD:4,347-UNIMOD:267	0.06	23.0	1	1	1
PRT	sp|Q9Y265-2|RUVB1_HUMAN	Isoform 2 of RuvB-like 1 OS=Homo sapiens OX=9606 GN=RUVBL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	171-UNIMOD:188,182-UNIMOD:188	0.04	23.0	1	1	0
PRT	sp|P26447|S10A4_HUMAN	Protein S100-A4 OS=Homo sapiens OX=9606 GN=S100A4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.20	23.0	2	2	2
PRT	sp|Q99447-2|PCY2_HUMAN	Isoform 2 of Ethanolamine-phosphate cytidylyltransferase OS=Homo sapiens OX=9606 GN=PCYT2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.05	23.0	1	1	1
PRT	sp|O14744-2|ANM5_HUMAN	Isoform 2 of Protein arginine N-methyltransferase 5 OS=Homo sapiens OX=9606 GN=PRMT5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q8N573-3|OXR1_HUMAN	Isoform 3 of Oxidation resistance protein 1 OS=Homo sapiens OX=9606 GN=OXR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	328-UNIMOD:267	0.02	23.0	1	1	1
PRT	sp|P35052|GPC1_HUMAN	Glypican-1 OS=Homo sapiens OX=9606 GN=GPC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	90-UNIMOD:267	0.02	23.0	1	1	1
PRT	sp|Q9NP58-4|ABCB6_HUMAN	Isoform 2 of ATP-binding cassette sub-family B member 6, mitochondrial OS=Homo sapiens OX=9606 GN=ABCB6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	639-UNIMOD:267	0.03	23.0	1	1	1
PRT	sp|Q14258|TRI25_HUMAN	E3 ubiquitin/ISG15 ligase TRIM25 OS=Homo sapiens OX=9606 GN=TRIM25 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q3YEC7|RABL6_HUMAN	Rab-like protein 6 OS=Homo sapiens OX=9606 GN=RABL6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|Q9HB71-3|CYBP_HUMAN	Isoform 3 of Calcyclin-binding protein OS=Homo sapiens OX=9606 GN=CACYBP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.06	23.0	1	1	1
PRT	sp|Q96IW7|SC22A_HUMAN	Vesicle-trafficking protein SEC22a OS=Homo sapiens OX=9606 GN=SEC22A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	108-UNIMOD:267,111-UNIMOD:4,121-UNIMOD:267	0.07	23.0	1	1	1
PRT	sp|Q99081|HTF4_HUMAN	Transcription factor 12 OS=Homo sapiens OX=9606 GN=TCF12 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q14690|RRP5_HUMAN	Protein RRP5 homolog OS=Homo sapiens OX=9606 GN=PDCD11 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q15056-2|IF4H_HUMAN	Isoform Short of Eukaryotic translation initiation factor 4H OS=Homo sapiens OX=9606 GN=EIF4H	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	217-UNIMOD:267,219-UNIMOD:267	0.11	23.0	1	1	0
PRT	sp|P21281|VATB2_HUMAN	V-type proton ATPase subunit B, brain isoform OS=Homo sapiens OX=9606 GN=ATP6V1B2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	64-UNIMOD:188	0.03	23.0	1	1	1
PRT	sp|Q6NVV1|R13P3_HUMAN	Putative 60S ribosomal protein L13a protein RPL13AP3 OS=Homo sapiens OX=9606 GN=RPL13AP3 PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.13	23.0	1	1	1
PRT	sp|P29350|PTN6_HUMAN	Tyrosine-protein phosphatase non-receptor type 6 OS=Homo sapiens OX=9606 GN=PTPN6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|P0DN79|CBSL_HUMAN	Cystathionine beta-synthase-like protein OS=Homo sapiens OX=9606 GN=CBSL PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	431-UNIMOD:4,439-UNIMOD:267	0.05	23.0	1	1	1
PRT	sp|P21333|FLNA_HUMAN	Filamin-A OS=Homo sapiens OX=9606 GN=FLNA PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	301-UNIMOD:267,309-UNIMOD:267,1157-UNIMOD:4,1162-UNIMOD:188	0.01	23.0	2	2	1
PRT	sp|P35908|K22E_HUMAN	Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens OX=9606 GN=KRT2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	482-UNIMOD:188,489-UNIMOD:4,490-UNIMOD:267	0.02	23.0	3	1	0
PRT	sp|P22314|UBA1_HUMAN	Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	385-UNIMOD:188,410-UNIMOD:35,411-UNIMOD:188	0.03	23.0	1	1	0
PRT	sp|Q9H2G2|SLK_HUMAN	STE20-like serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=SLK PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	null	887-UNIMOD:28,891-UNIMOD:267,899-UNIMOD:267	0.01	23.0	1	1	1
PRT	sp|O60678|ANM3_HUMAN	Protein arginine N-methyltransferase 3 OS=Homo sapiens OX=9606 GN=PRMT3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	null	482-UNIMOD:28,489-UNIMOD:188,494-UNIMOD:188	0.03	23.0	1	1	1
PRT	sp|O60825|F262_HUMAN	6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Homo sapiens OX=9606 GN=PFKFB2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	359-UNIMOD:267,372-UNIMOD:267	0.04	23.0	1	1	1
PRT	sp|Q7Z434|MAVS_HUMAN	Mitochondrial antiviral-signaling protein OS=Homo sapiens OX=9606 GN=MAVS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.09	23.0	1	1	1
PRT	sp|P37198|NUP62_HUMAN	Nuclear pore glycoprotein p62 OS=Homo sapiens OX=9606 GN=NUP62 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|Q96SB4|SRPK1_HUMAN	SRSF protein kinase 1 OS=Homo sapiens OX=9606 GN=SRPK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	502-UNIMOD:4,506-UNIMOD:188	0.02	23.0	1	1	1
PRT	sp|P30048|PRDX3_HUMAN	Thioredoxin-dependent peroxide reductase, mitochondrial OS=Homo sapiens OX=9606 GN=PRDX3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.07	23.0	1	1	1
PRT	sp|P62847|RS24_HUMAN	40S ribosomal protein S24 OS=Homo sapiens OX=9606 GN=RPS24 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	null	22-UNIMOD:28	0.09	23.0	1	1	1
PRT	sp|P15121|ALDR_HUMAN	Aldo-keto reductase family 1 member B1 OS=Homo sapiens OX=9606 GN=AKR1B1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|P55084|ECHB_HUMAN	Trifunctional enzyme subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=HADHB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	238-UNIMOD:267,247-UNIMOD:267	0.04	23.0	1	1	1
PRT	sp|P02771|FETA_HUMAN	Alpha-fetoprotein OS=Homo sapiens OX=9606 GN=AFP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	452-UNIMOD:267	0.03	23.0	1	1	1
PRT	sp|Q9UPN6|SCAF8_HUMAN	SR-related and CTD-associated factor 8 OS=Homo sapiens OX=9606 GN=SCAF8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	921-UNIMOD:35,923-UNIMOD:35,927-UNIMOD:267	0.02	23.0	1	1	1
PRT	sp|P0C0L4|CO4A_HUMAN	Complement C4-A OS=Homo sapiens OX=9606 GN=C4A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q8IZL2|MAML2_HUMAN	Mastermind-like protein 2 OS=Homo sapiens OX=9606 GN=MAML2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	null	31-UNIMOD:267	0.03	23.0	1	1	1
PRT	sp|P28332|ADH6_HUMAN	Alcohol dehydrogenase 6 OS=Homo sapiens OX=9606 GN=ADH6 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	null	327-UNIMOD:28	0.04	23.0	1	1	1
PRT	sp|Q9UH65|SWP70_HUMAN	Switch-associated protein 70 OS=Homo sapiens OX=9606 GN=SWAP70 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	420-UNIMOD:267,428-UNIMOD:188	0.02	23.0	1	1	1
PRT	sp|P54886|P5CS_HUMAN	Delta-1-pyrroline-5-carboxylate synthase OS=Homo sapiens OX=9606 GN=ALDH18A1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	84-UNIMOD:267,88-UNIMOD:4,94-UNIMOD:267	0.02	23.0	1	1	0
PRT	sp|Q00872|MYPC1_HUMAN	Myosin-binding protein C, slow-type OS=Homo sapiens OX=9606 GN=MYBPC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|P05556|ITB1_HUMAN	Integrin beta-1 OS=Homo sapiens OX=9606 GN=ITGB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.02	23.0	1	1	0
PRT	sp|Q15056|IF4H_HUMAN	Eukaryotic translation initiation factor 4H OS=Homo sapiens OX=9606 GN=EIF4H PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.10	23.0	1	1	0

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	NLHQSGFSLSGAQIDDNIPR	1	sp|Q16555|DPYL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	20-UNIMOD:267	ms_run[2]:scan=8093	49.995	2	2178.0693	2178.0693	R	R	533	553
PSM	NLHQSGFSLSGAQIDDNIPR	2	sp|Q16555|DPYL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0		ms_run[2]:scan=8087	49.958	2	2168.061	2168.0610	R	R	533	553
PSM	HLCEPGADGAETFADGVPR	3	sp|Q14839|CHD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	3-UNIMOD:4	ms_run[2]:scan=6513	40.356	2	1997.8901	1997.8901	R	E	1466	1485
PSM	HVSPAGAAVGIPLSEDEAK	4	sp|P31939-2|PUR9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0		ms_run[2]:scan=6113	37.99	2	1846.9425	1846.9425	K	V	266	285
PSM	KGVNLPGAAVDLPAVSEK	5	sp|P14618-3|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	1-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=7808	48.229	2	1776.0184	1776.0184	K	D	192	210
PSM	NLHQSGFSLSGTQVDEGVR	6	sp|Q14195|DPYL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0		ms_run[2]:scan=6475	40.12	2	2029.9817	2029.9817	R	S	532	551
PSM	RAEDGSVIDYELIDQDAR	7	sp|P07355-2|ANXA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	1-UNIMOD:267,18-UNIMOD:267	ms_run[2]:scan=8070	49.858	2	2083.9925	2083.9925	R	D	197	215
PSM	AKGILFVGSGVSGGEEGAR	8	sp|P52209-2|6PGD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0		ms_run[2]:scan=6618	40.974	2	1789.9323	1789.9323	K	Y	105	124
PSM	HVSPAGAAVGIPLSEDEAK	9	sp|P31939-2|PUR9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	19-UNIMOD:188	ms_run[2]:scan=6112	37.985	2	1852.9626	1852.9626	K	V	266	285
PSM	IKAEYEGDGIPTVFVAVAGR	10	sp|P22234|PUR6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0		ms_run[2]:scan=10177	63.264	2	2091.1001	2091.1001	R	S	312	332
PSM	IVAPGKGILAADESTGSIAK	11	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	6-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=6526	40.429	2	1909.0923	1909.0923	R	R	23	43
PSM	KGVNLPGAAVDLPAVSEK	12	sp|P14618-3|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0		ms_run[2]:scan=7809	48.235	2	1763.9781	1763.9781	K	D	192	210
PSM	KLETAVNLAWTAGNSNTR	13	sp|P21796|VDAC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0		ms_run[2]:scan=7416	45.835	2	1945.0017	1945.0017	K	F	201	219
PSM	NHTLALTETGSVFAFGENK	14	sp|Q9P258|RCC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0		ms_run[2]:scan=9441	58.509	2	2035.0011	2035.0011	R	M	212	231
PSM	AHLTVGQAAAGGSGNLLTER	15	sp|Q99959|PKP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46.0	20-UNIMOD:267	ms_run[1]:scan=6218	38.59733	2	1931.993764	1932.005256	R	S	317	337
PSM	AHLTVGQAAAGGSGNLLTER	16	sp|Q99959-2|PKP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=6234	38.702	2	1921.997	1921.9970	R	S	317	337
PSM	AMKGAGTDEGCLIEILASR	17	sp|P09525-2|ANXA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	11-UNIMOD:4	ms_run[2]:scan=10483	65.235	2	1990.9816	1990.9816	R	T	16	35
PSM	GFGDLKSPAGLQVLNDYLADK	18	sp|P24534|EF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=11863	74.462	2	2220.1426	2220.1426	M	S	2	23
PSM	KWENPTQNNAGLEDFER	19	sp|P22694-8|KAPCB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=7050	43.607	2	2046.9395	2046.9395	K	K	30	47
PSM	NHTLALTETGSVFAFGENK	20	sp|Q9P258|RCC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	19-UNIMOD:188	ms_run[2]:scan=9449	58.561	2	2041.0212	2041.0212	R	M	212	231
PSM	RVYATILNAGTNTDGFK	21	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=7170	44.336	2	1839.9479	1839.9479	R	E	241	258
PSM	VAHALAEGLGVIACIGEK	22	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	14-UNIMOD:4	ms_run[2]:scan=10376	64.54	2	1806.9662	1806.9662	K	L	151	169
PSM	GHVFEESQVAGTPMFVVK	23	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	18-UNIMOD:188	ms_run[2]:scan=8443	52.131	2	1966.9918	1966.9918	R	A	768	786
PSM	GHVFEESQVAGTPMFVVK	24	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=8444	52.137	2	1960.9717	1960.9717	R	A	768	786
PSM	IVAPGKGILAADESTGSIAK	25	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=6527	40.435	2	1897.052	1897.0520	R	R	23	43
PSM	KGFSEGLWEIENNPTVK	26	sp|P51858-2|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	1-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=8740	53.999	2	1959.014	1959.0140	R	A	73	90
PSM	KICYQEVSQCFGVLSSR	27	sp|Q16531|DDB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	3-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=8643	53.394	2	2059.9819	2059.9819	R	I	723	740
PSM	RSLGYAYVNFQQPADAER	28	sp|Q13310-2|PABP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=7207	44.561	2	2084.0076	2084.0076	R	A	50	68
PSM	TFSHELSDFGLESTAGEIPVVAIR	29	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=11723	73.507	2	2574.2966	2574.2966	K	T	306	330
PSM	VAHALAEGLGVIACIGEK	30	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	14-UNIMOD:4,18-UNIMOD:188	ms_run[2]:scan=10375	64.534	2	1812.9863	1812.9863	K	L	151	169
PSM	VHAAVQPGSLDSESGIFACAFDQSESR	31	sp|O43660-2|PLRG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	19-UNIMOD:4	ms_run[2]:scan=10162	63.166	3	2864.3035	2864.3035	R	L	441	468
PSM	AIAHYEQSADYYKGEESNSSANK	32	sp|P54920|SNAA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	13-UNIMOD:188,23-UNIMOD:188	ms_run[2]:scan=3773	24.325	3	2573.1709	2573.1709	K	C	141	164
PSM	AVTFSPDLGPVPHEGLGEYNR	33	sp|Q9P1Y5|CAMP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=8722	53.885	2	2254.1018	2254.1018	K	A	681	702
PSM	FCSLPEKGTLTEAFPVLGGK	34	sp|P29144|TPP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	2-UNIMOD:4,7-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=10491	65.289	2	2162.1484	2162.1484	K	A	709	729
PSM	FGAVWTGDNTAEWDHLK	35	sp|Q14697|GANAB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	17-UNIMOD:188	ms_run[2]:scan=9325	57.765	2	1951.916	1951.9160	R	I	611	628
PSM	GHVTQDAPIPGSPLYTIK	36	sp|Q15029-2|U5S1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=7329	45.297	2	1892.9996	1892.9996	R	A	820	838
PSM	HLLVSNVGGDGEEIER	37	sp|O75694-2|NU155_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	16-UNIMOD:267	ms_run[2]:scan=5571	34.802	2	1732.8619	1732.8619	R	F	463	479
PSM	ISMSHEEEPLGTAGPLALAR	38	sp|Q9Y5P6|GMPPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	20-UNIMOD:267	ms_run[2]:scan=8509	52.552	2	2088.0549	2088.0549	R	D	75	95
PSM	KCEAEEAEPPAATQPQTSETQTSHLPESER	39	sp|Q9UKV3-5|ACINU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	2-UNIMOD:4	ms_run[2]:scan=4139	26.44	3	3337.5005	3337.5005	K	I	732	762
PSM	KDCEVVMMIGLPGAGK	40	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	3-UNIMOD:4	ms_run[2]:scan=8967	55.425	2	1703.8409	1703.8409	K	T	476	492
PSM	KGFSEGLWEIENNPTVK	41	sp|P51858-2|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=8741	54.005	2	1946.9738	1946.9738	R	A	73	90
PSM	KVWLDPNETNEIANANSR	42	sp|P84098|RL19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=6779	41.931	2	2070.013	2070.0130	K	Q	21	39
PSM	NLHQSGFSLSGTQVDEGVR	43	sp|Q14195|DPYL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	19-UNIMOD:267	ms_run[2]:scan=6479	40.148	2	2039.99	2039.9900	R	S	532	551
PSM	RLDEEEEDNEGGEWER	44	sp|Q99613-2|EIF3C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=4304	27.362	2	2010.8306	2010.8306	K	V	278	294
PSM	RLDEEEEDNEGGEWER	45	sp|Q99613-2|EIF3C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=4313	27.415	2	1990.8141	1990.8141	K	V	278	294
PSM	RPSAAPASQQLQSLESK	46	sp|Q9Y653-5|AGRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=4992	31.409	2	1796.9381	1796.9381	R	L	24	41
PSM	SLKPGALSNSESIPTIDGLR	47	sp|O95630-2|STABP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=8312	51.33	2	2054.1008	2054.1008	R	H	236	256
PSM	TFLRPSPEDEAIYGPNTK	48	sp|Q9UDY2-5|ZO2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=6860	42.458	2	2034.0058	2034.0058	R	M	494	512
PSM	TRTSQEELLAEVVQGQSR	49	sp|Q6PJT7-10|ZC3HE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=8364	51.655	2	2030.0392	2030.0392	R	T	350	368
PSM	YKDGVVTIGCVGFPNVGK	50	sp|P36915|GNL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	10-UNIMOD:4	ms_run[2]:scan=8734	53.959	2	1908.9768	1908.9768	R	S	356	374
PSM	QLFHPEQLITGKEDAANNYAR	51	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0	1-UNIMOD:28,12-UNIMOD:188,21-UNIMOD:267	ms_run[1]:scan=9493	58.836578333333335	2	2413.1966	2413.1992	R	G	85	106
PSM	QLFHPEQLITGKEDAANNYAR	52	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0	1-UNIMOD:28,12-UNIMOD:188,21-UNIMOD:267	ms_run[1]:scan=9684	60.05840333333333	2	2413.1966	2413.1992	R	G	85	106
PSM	QQSHFAMMHGGTGFAGIDSSSPEVK	53	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0	1-UNIMOD:28	ms_run[1]:scan=8102	50.04772333333333	2	2588.1387	2588.1419	R	G	244	269
PSM	QQSHFAMMHGGTGFAGIDSSSPEVK	54	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0	1-UNIMOD:28,25-UNIMOD:188	ms_run[1]:scan=8096	50.01101166666666	2	2594.1579	2594.1620	R	G	244	269
PSM	FLGTEPEPDAVGLDSGHIR	55	sp|Q16762|THTR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	19-UNIMOD:267	ms_run[2]:scan=7592	46.878	2	2018.9937	2018.9937	R	G	188	207
PSM	GKYSEVFEAINITNNER	56	sp|P19784|CSK22_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=8859	54.754	2	1982.9698	1982.9698	R	V	49	66
PSM	HATALEELSEQLEQAK	57	sp|P35580|MYH10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=10187	63.33	2	1795.8952	1795.8952	R	R	1201	1217
PSM	HLCEPGADGAETFADGVPR	58	sp|Q14839|CHD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	3-UNIMOD:4,19-UNIMOD:267	ms_run[2]:scan=6514	40.362	2	2007.8984	2007.8984	R	E	1466	1485
PSM	HLLVSNVGGDGEEIER	59	sp|O75694-2|NU155_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=5573	34.814	2	1722.8537	1722.8537	R	F	463	479
PSM	IGDLQAFQGHGAGNLAGLK	60	sp|P08195-2|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	19-UNIMOD:188	ms_run[2]:scan=8077	49.902	2	1871.9949	1871.9949	R	G	126	145
PSM	KDCEVVMMIGLPGAGK	61	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:188,3-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=8969	55.435	2	1715.8811	1715.8811	K	T	476	492
PSM	KFNALFAQGNYSEAAK	62	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=6659	41.215	2	1757.8737	1757.8737	R	V	367	383
PSM	LLAALLEDEGGSGRPLLQAAK	63	sp|Q9Y490|TLN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=10087	62.678	2	2121.1794	2121.1794	K	G	593	614
PSM	PNIVLFSGSSHQDLSQR	64	sp|P11908|PRPS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=7201	44.525	2	1883.949	1883.9490	M	V	2	19
PSM	RGDALIEMESEQDVQK	65	sp|Q12849-5|GRSF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=5816	36.244	2	1846.8731	1846.8731	R	A	31	47
PSM	RTGAIVDVPVGEELLGR	66	sp|P25705-2|ATPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=9396	58.217	2	1779.9843	1779.9843	K	V	83	100
PSM	TVPLAGHVGFDSLPDQLVNK	67	sp|Q14141-3|SEPT6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	20-UNIMOD:188	ms_run[2]:scan=9711	60.235	2	2112.1311	2112.1311	R	S	16	36
PSM	VNIEGGAIALGHPLGASGCR	68	sp|Q9BWD1|THIC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	19-UNIMOD:4,20-UNIMOD:267	ms_run[2]:scan=7654	47.276	2	1958.0031	1958.0031	K	I	342	362
PSM	QQSHFAMMHGGTGFAGIDSSSPEVK	69	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	1-UNIMOD:28,25-UNIMOD:188	ms_run[1]:scan=8090	49.978605	3	2594.1619	2594.1620	R	G	244	269
PSM	AHEVGAQGGPPVAQVEQDLPISR	70	sp|Q14676-4|MDC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=8227	50.81	3	2354.1979	2354.1979	R	E	620	643
PSM	EHNGQVTGIDWAPESNR	71	sp|O15143|ARC1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=6049	37.624	2	1908.8715	1908.8715	K	I	50	67
PSM	EHNGQVTGIDWAPESNR	72	sp|O15143|ARC1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	17-UNIMOD:267	ms_run[2]:scan=6050	37.63	2	1918.8797	1918.8797	K	I	50	67
PSM	FGNDGLHEPLDWAQEEGK	73	sp|Q9Y606-2|TRUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=8248	50.942	2	2040.9177	2040.9177	R	V	319	337
PSM	FNEEHIPDSPFVVPVASPSGDAR	74	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=9651	59.857	2	2466.1816	2466.1816	K	R	2303	2326
PSM	GLAPLHWADDDGNPTEQYPLNPNGSPGGVAGICSCDGR	75	sp|O15067|PUR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	33-UNIMOD:4,35-UNIMOD:4,38-UNIMOD:267	ms_run[2]:scan=10136	62.995	3	3973.7623	3973.7623	R	H	1253	1291
PSM	GSRVDIETPNLEGTLTGPR	76	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:267,19-UNIMOD:267	ms_run[2]:scan=7928	48.982	2	2031.05	2031.0500	K	L	538	557
PSM	HLSSLTDNEQADIFER	77	sp|O60343-2|TBCD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	16-UNIMOD:267	ms_run[2]:scan=7259	44.883	2	1883.8889	1883.8889	R	V	483	499
PSM	HSATTVFGANTPIVSCNFDR	78	sp|Q9NZM1-2|MYOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	16-UNIMOD:4,20-UNIMOD:267	ms_run[2]:scan=8258	51.004	2	2203.0356	2203.0356	K	V	1074	1094
PSM	HVDLLEVAQETDGFSGSDLK	79	sp|Q8NBU5|ATAD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=10153	63.105	2	2159.0382	2159.0382	R	E	281	301
PSM	KFGYVDFESAEDLEK	80	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=8648	53.426	2	1775.8254	1775.8254	R	A	348	363
PSM	KLSLGQYDNDAGGQLPFSK	81	sp|Q68CZ2-2|TENS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=8128	50.21	2	2037.0167	2037.0167	R	C	534	553
PSM	KQSLGELIGTLNAAK	82	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=8748	54.051	2	1553.918	1553.9180	R	V	56	71
PSM	KYLLGVQPAWGSAEAVDIDR	83	sp|Q10713|MPPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=9798	60.807	2	2187.1324	2187.1324	R	S	269	289
PSM	LKPEDITQIQPQQLVLR	84	sp|P05556-2|ITB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=9669	59.963	2	2018.1524	2018.1524	K	L	106	123
PSM	LNQENEHIYNLWCSGR	85	sp|Q96A33-2|CCD47_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	13-UNIMOD:4	ms_run[2]:scan=7976	49.274	2	2031.9221	2031.9221	K	V	197	213
PSM	LYPNMTAVLLHNTQLDQR	86	sp|Q8TCS8|PNPT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=10301	64.064	2	2126.0943	2126.0943	K	K	698	716
PSM	NHQSAAEYNIFEGMELR	87	sp|Q14195|DPYL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=10115	62.861	2	2007.9109	2007.9109	K	G	424	441
PSM	RLDEYTQEEIDAFPR	88	sp|Q9BYD1|RM13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=7967	49.221	2	1880.8905	1880.8905	K	L	154	169
PSM	TYDATTHFETTCDDIKNIYK	89	sp|P50395-2|GDIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	12-UNIMOD:4	ms_run[2]:scan=7502	46.331	2	2435.0951	2435.0951	R	R	358	378
PSM	VFSWLQQEGHLSEEEMAR	90	sp|P22102|PUR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	18-UNIMOD:267	ms_run[2]:scan=9708	60.217	2	2185.0138	2185.0138	R	T	712	730
PSM	VVLLGEFLHPCEDDIVCK	91	sp|Q9NY12-2|GAR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	11-UNIMOD:4,17-UNIMOD:4,18-UNIMOD:188	ms_run[2]:scan=11376	71.173	2	2148.0691	2148.0691	R	C	70	88
PSM	IGEHTPSALAIMENANVLAR	92	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	20-UNIMOD:267	ms_run[1]:scan=9870	61.27044333333333	2	2117.081128	2116.097442	K	Y	154	174
PSM	AAKLEILQQQLQVANEAR	93	sp|Q14980-2|NUMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=8313	51.336	2	2022.1222	2022.1222	K	D	614	632
PSM	EGGPNPEHNSNLANILEVCR	94	sp|Q9BSH4|TACO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	19-UNIMOD:4,20-UNIMOD:267	ms_run[2]:scan=8285	51.166	2	2229.0472	2229.0472	K	S	94	114
PSM	FGAVWTGDNTAEWDHLK	95	sp|Q14697|GANAB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=9324	57.759	2	1945.8959	1945.8959	R	I	611	628
PSM	FNDEHIPESPYLVPVIAPSDDAR	96	sp|O75369-6|FLNB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	23-UNIMOD:267	ms_run[2]:scan=10019	62.236	2	2590.2579	2590.2579	K	R	2201	2224
PSM	FRSETITEEELVGLMNK	97	sp|P16152|CBR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=10314	64.144	2	1994.9983	1994.9983	K	F	158	175
PSM	FSSSGDFLVAGVGQEHR	98	sp|O43818|U3IP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	17-UNIMOD:267	ms_run[2]:scan=7465	46.124	2	1801.8623	1801.8623	K	L	429	446
PSM	GAGKAPLNVQFNSPLPGDAVK	99	sp|O75369-6|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	4-UNIMOD:188,21-UNIMOD:188	ms_run[2]:scan=8072	49.874	2	2091.1515	2091.1515	K	D	874	895
PSM	GHVTQDAPIPGSPLYTIK	100	sp|Q15029-2|U5S1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	18-UNIMOD:188	ms_run[2]:scan=7333	45.317	2	1899.0197	1899.0197	R	A	820	838
PSM	HSGNITFDEIVNIAR	101	sp|P30050-2|RL12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	15-UNIMOD:267	ms_run[2]:scan=10139	63.017	2	1694.8616	1694.8616	K	Q	67	82
PSM	HSGNITFDEIVNIAR	102	sp|P30050-2|RL12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=10142	63.035	2	1684.8533	1684.8533	K	Q	67	82
PSM	HSGPNSADSANDGFVR	103	sp|P52597|HNRPF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=2592	17.544	2	1629.7132	1629.7132	K	L	99	115
PSM	HSGPNSADSANDGFVR	104	sp|P52597|HNRPF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	16-UNIMOD:267	ms_run[2]:scan=2593	17.55	2	1639.7214	1639.7214	K	L	99	115
PSM	HSMNPFCEIAVEEAVR	105	sp|P38117|ETFB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	7-UNIMOD:4	ms_run[2]:scan=9514	58.965	2	1887.8608	1887.8608	K	L	36	52
PSM	HTGPNSPDTANDGFVR	106	sp|P55795|HNRH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=3311	21.67	2	1683.7601	1683.7601	K	L	99	115
PSM	ICDQWDALGSLTHSR	107	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	2-UNIMOD:4	ms_run[2]:scan=8823	54.524	2	1757.8155	1757.8155	K	R	498	513
PSM	IENLSNLHQLQMLELGSNR	108	sp|Q15435-5|PP1R7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=9963	61.874	2	2208.1321	2208.1321	K	I	120	139
PSM	INSGGKLPNFGFVVFDDSEPVQK	109	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:188,23-UNIMOD:188	ms_run[2]:scan=11344	70.951	2	2505.2942	2505.2942	R	V	371	394
PSM	IRLESEEEGVPSTAIR	110	sp|P06493-2|CDK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	2-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=5794	36.125	2	1804.9434	1804.9434	K	E	35	51
PSM	IRLESEEEGVPSTAIR	111	sp|P06493-2|CDK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=5788	36.088	2	1784.9268	1784.9268	K	E	35	51
PSM	IVSLFAEHNDLQYAAPGGLIGVGTK	112	sp|Q2VIR3-2|IF2GL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	25-UNIMOD:188	ms_run[2]:scan=11127	69.497	2	2575.3742	2575.3742	K	I	318	343
PSM	KAEAGAGSATEFQFR	113	sp|P46783|RS10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=5228	32.795	2	1568.7583	1568.7583	K	G	139	154
PSM	KFGYVDFESAEDLEK	114	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=8666	53.533	2	1787.8657	1787.8657	R	A	348	363
PSM	KFIAYQFTDTPLQIK	115	sp|O00267-2|SPT5H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=9837	61.059	2	1811.9822	1811.9822	R	S	195	210
PSM	LDTHPAMVTVLEMGAAR	116	sp|Q12931-2|TRAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=9505	58.907	2	1810.907	1810.9070	R	H	550	567
PSM	LRLESEGSPETLTNLR	117	sp|Q9P035-2|HACD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=7055	43.636	2	1813.9534	1813.9534	K	K	76	92
PSM	LYPNMTAVLLHNTQLDQR	118	sp|Q8TCS8|PNPT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	18-UNIMOD:267	ms_run[2]:scan=10300	64.058	2	2136.1025	2136.1025	K	K	698	716
PSM	MWDLSSNQAIQIAQHDAPVK	119	sp|P78406|RAE1L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:35	ms_run[2]:scan=9131	56.48	2	2267.1005	2267.1005	K	T	112	132
PSM	PNIVLFSGSSHQDLSQR	120	sp|P11908|PRPS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	17-UNIMOD:267	ms_run[2]:scan=7202	44.532	2	1893.9572	1893.9572	M	V	2	19
PSM	RLDEYTQEEIDAFPR	121	sp|Q9BYD1|RM13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:267,15-UNIMOD:267	ms_run[2]:scan=7991	49.37	2	1900.907	1900.9070	K	L	154	169
PSM	SKGFGFVCFSSPEEATK	122	sp|Q13310-2|PABP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	8-UNIMOD:4	ms_run[2]:scan=8403	51.887	2	1876.8665	1876.8666	R	A	332	349
PSM	TFVNITPAEVGVLVGKDR	123	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=10696	66.621	2	1914.0575	1914.0575	K	S	39	57
PSM	TQHGVLSQQFVELINK	124	sp|Q12846|STX4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	16-UNIMOD:188	ms_run[2]:scan=9459	58.622	2	1846.0044	1846.0044	K	C	125	141
PSM	VWQLGSSSPNFTLEGHEK	125	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=8487	52.413	2	2014.9749	2014.9749	K	G	140	158
PSM	QLFHPEQLITGKEDAANNYAR	126	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:28	ms_run[1]:scan=9484	58.78080666666666	3	2397.1726	2397.1708	R	G	85	106
PSM	QLFHPEQLITGKEDAANNYAR	127	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:28,12-UNIMOD:188,21-UNIMOD:267	ms_run[1]:scan=9645	59.823935	3	2413.1994	2413.1992	R	G	85	106
PSM	QLFHPEQLITGKEDAANNYAR	128	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:28	ms_run[1]:scan=9648	59.83897833333333	2	2397.1690	2397.1708	R	G	85	106
PSM	HTGPNSPDTANDGFVR	129	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	16-UNIMOD:267	ms_run[1]:scan=3480	22.641175	2	1694.753756	1693.768380	K	L	99	115
PSM	ISMSHEEEPLGTAGPLALAR	130	sp|Q9Y5P6|GMPPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0		ms_run[1]:scan=8517	52.60210333333333	2	2079.045054	2078.046640	R	D	75	95
PSM	AIIRENEFSFEDNAIR	131	sp|Q14839|CHD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=8318	51.371	2	1942.9652	1942.9652	R	G	814	830
PSM	DTKEIYTHFTCATDTK	132	sp|P63096-2|GNAI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:188,11-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=5704	35.591	2	1941.9181	1941.9181	K	N	263	279
PSM	FIHQQPQSSSPVYGSSAK	133	sp|P49023-2|PAXI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	18-UNIMOD:188	ms_run[2]:scan=3314	21.684	2	1952.9688	1952.9688	R	T	76	94
PSM	FKNEEEVFAWNNEVK	134	sp|P49419-4|AL7A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=8012	49.499	2	1881.8897	1881.8897	K	Q	374	389
PSM	FNEEHIPDSPFVVPVASPSGDAR	135	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	23-UNIMOD:267	ms_run[2]:scan=9788	60.742	2	2476.1898	2476.1898	K	R	2303	2326
PSM	FTGEGATAHLETGGFIR	136	sp|Q8NE62|CHDH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=7225	44.672	2	1762.8638	1762.8638	K	S	372	389
PSM	GHVFEESQVAGTPMFVVK	137	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	14-UNIMOD:35	ms_run[2]:scan=7392	45.692	2	1976.9666	1976.9666	R	A	768	786
PSM	GHYTEGAELVDSVLDVVR	138	sp|Q13509-2|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=12420	78.237	2	1957.9745	1957.9745	K	K	32	50
PSM	GKLPIVNEDDELVAIIAR	139	sp|P12268|IMDH2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=11594	72.641	2	1964.0942	1964.0942	K	T	207	225
PSM	GPVKPTGGPGGGGTQTQQQMNQLK	140	sp|P26196|DDX6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=3609	23.385	3	2365.1808	2365.1808	R	N	23	47
PSM	GWLKSNVSDAVAQSTR	141	sp|P60174|TPIS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=6410	39.734	2	1717.8747	1717.8747	R	I	228	244
PSM	GYNPGLLVHPDLAYLQAEGGGDR	142	sp|P19838|NFKB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=10172	63.229	2	2411.187	2411.1870	R	Q	164	187
PSM	HMSEFMECNLNELVK	143	sp|P25786|PSA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	8-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=9323	57.753	2	1885.8468	1885.8468	R	H	175	190
PSM	HNEETGDNVGPLIIK	144	sp|Q9NZ45|CISD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=5993	37.281	2	1634.8264	1634.8264	K	K	90	105
PSM	IIKDFMIQGGDPTGTGR	145	sp|Q9Y3C6|PPIL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=7007	43.358	2	1804.9142	1804.9142	R	G	56	73
PSM	ITLPVDFVTADKFDENAK	146	sp|P00558-2|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=10589	65.919	2	2022.031	2022.0310	K	T	252	270
PSM	IVSLFAEHNDLQYAAPGGLIGVGTK	147	sp|Q2VIR3-2|IF2GL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=11132	69.528	2	2569.354	2569.3540	K	I	318	343
PSM	IVTGGSDNHLILVDLR	148	sp|P34896-4|GLYC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	16-UNIMOD:267	ms_run[2]:scan=8663	53.51	2	1730.9555	1730.9555	K	S	211	227
PSM	KFLDGNELTLADCNLLPK	149	sp|O00299|CLIC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:188,13-UNIMOD:4,18-UNIMOD:188	ms_run[2]:scan=10455	65.051	2	2072.1015	2072.1015	R	L	166	184
PSM	KFLDGNEMTLADCNLLPK	150	sp|Q9Y696|CLIC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:188,13-UNIMOD:4,18-UNIMOD:188	ms_run[2]:scan=10008	62.165	2	2090.0579	2090.0579	R	L	177	195
PSM	KFNALFAQGNYSEAAK	151	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=6657	41.204	2	1769.9139	1769.9139	R	V	367	383
PSM	KGEVFLYEIGGNIGER	152	sp|Q8N392-2|RHG18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=9356	57.963	2	1779.9155	1779.9155	K	C	576	592
PSM	KIVEGISQPIWLVSDTR	153	sp|Q15126|PMVK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=9846	61.117	2	1940.0731	1940.0731	R	R	94	111
PSM	KLSGLEQPQGALQTR	154	sp|Q6RFH5-2|WDR74_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=4913	30.941	2	1624.8897	1624.8897	R	R	340	355
PSM	KQSLGELIGTLNAAK	155	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=8756	54.102	2	1541.8777	1541.8777	R	V	56	71
PSM	LFVGNLPADITEDEFKR	156	sp|P23246-2|SFPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=10366	64.477	2	1963.0051	1963.0051	R	L	299	316
PSM	LHDNLIISDLENTVK	157	sp|Q69YQ0-2|CYTSA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	15-UNIMOD:188	ms_run[2]:scan=10377	64.545	2	1728.9353	1728.9353	K	K	705	720
PSM	LIEGLSHEVIVSAACGR	158	sp|Q9P258|RCC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	15-UNIMOD:4	ms_run[2]:scan=7905	48.834	2	1809.9407	1809.9407	R	N	195	212
PSM	LWAHVYAGAPVSSPEYTK	159	sp|P61086-2|UBE2K_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	18-UNIMOD:188	ms_run[2]:scan=7105	43.936	2	1981.0041	1981.0041	R	K	96	114
PSM	MWDPHNDPNAQGDAFK	160	sp|P08621-3|RU17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:35	ms_run[2]:scan=4847	30.539	2	1857.774	1857.7740	K	T	88	104
PSM	NGPGFHNDIDSNSTIQEILIPASK	161	sp|Q96I24|FUBP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=10032	62.319	2	2566.2663	2566.2663	R	V	150	174
PSM	SEHGPISFFPESGQPECLK	162	sp|Q96ME7-2|ZN512_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	17-UNIMOD:4	ms_run[2]:scan=8714	53.834	2	2144.9837	2144.9837	R	E	231	250
PSM	SGKAPILIATDVASR	163	sp|Q92841|DDX17_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=6387	39.604	2	1497.8515	1497.8515	R	G	466	481
PSM	SNPGGFGIAPHCLDEGTVR	164	sp|Q7Z7K6-2|CENPV_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	12-UNIMOD:4,19-UNIMOD:267	ms_run[2]:scan=6931	42.908	2	1992.9351	1992.9351	R	S	72	91
PSM	TGSLKPNPASPLPASPYGGPTPASYTTASTPAGPAFPVQVK	165	sp|Q15654|TRIP6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:188,41-UNIMOD:188	ms_run[2]:scan=9678	60.019	3	3991.077	3991.0770	R	V	133	174
PSM	THNSSLEYNIFEGMECR	166	sp|Q16555|DPYL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	16-UNIMOD:4	ms_run[2]:scan=9659	59.904	2	2085.8884	2085.8884	K	G	424	441
PSM	TKGVDEVTIVNILTNR	167	sp|P07355-2|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=10662	66.4	2	1770.984	1770.9840	K	S	66	82
PSM	TQHGVLSQQFVELINK	168	sp|Q12846|STX4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=9463	58.646	2	1839.9843	1839.9843	K	C	125	141
PSM	TRIIDVVYNASNNELVR	169	sp|P62241|RS8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=9165	56.742	2	1975.0487	1975.0487	K	T	76	93
PSM	VHYENNSPFLTITSMTR	170	sp|P04843|RPN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=9594	59.482	2	2008.9677	2008.9677	K	V	216	233
PSM	YGLIYHASLVGQTSPK	171	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	16-UNIMOD:188	ms_run[2]:scan=7005	43.347	2	1738.9349	1738.9349	K	H	338	354
PSM	IGEHTPSALAIMENANVLAR	172	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0		ms_run[1]:scan=9873	61.288734999999996	2	2107.072519	2106.089173	K	Y	154	174
PSM	QLFHPEQLITGKEDAANNYAR	173	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:28	ms_run[1]:scan=9486	58.79148333333334	2	2397.1690	2397.1708	R	G	85	106
PSM	QLFHPEQLITGKEDAANNYAR	174	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:28	ms_run[1]:scan=9646	59.82884333333333	3	2397.1726	2397.1708	R	G	85	106
PSM	LDTHPAMVTVLEMGAAR	175	sp|Q12931|TRAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	17-UNIMOD:267	ms_run[1]:scan=9509	58.93100333333333	2	1821.919988	1820.915244	R	H	603	620
PSM	ALELTGLKVFGNEIK	176	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=10508	65.398	2	1630.9294	1630.9294	K	L	363	378
PSM	ANIVHLMLSSPEQIQK	177	sp|P55060-4|XPO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	16-UNIMOD:188	ms_run[2]:scan=8921	55.152	2	1812.9863	1812.9863	K	Q	94	110
PSM	EHAPSIIFMDEIDSIGSSR	178	sp|P62195-2|PRS8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=11653	73.035	2	2102.9943	2102.9943	R	L	232	251
PSM	FLGTEPEPDAVGLDSGHIR	179	sp|Q16762|THTR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=7575	46.773	2	2008.9854	2008.9854	R	G	188	207
PSM	FLIPNASQAESKVFYLK	180	sp|P63104-2|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=10463	65.105	2	1954.0564	1954.0564	K	M	29	46
PSM	FNEEHIPDSPFVVPVASPSGDAR	181	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	23-UNIMOD:267	ms_run[2]:scan=9631	59.731	2	2476.1898	2476.1898	K	R	2303	2326
PSM	GCLELIKETGVPIAGR	182	sp|P11586|C1TC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	2-UNIMOD:4	ms_run[2]:scan=8202	50.663	2	1711.9291	1711.9291	K	H	151	167
PSM	GLGHQVATDALVAMEK	183	sp|Q9Y3I0|RTCB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	16-UNIMOD:188	ms_run[2]:scan=7793	48.138	2	1644.8601	1644.8601	R	A	264	280
PSM	GREEWESAALQNANTK	184	sp|Q5T4S7-3|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=5237	32.847	2	1802.8547	1802.8547	R	C	4876	4892
PSM	HQAFEAELSANQSR	185	sp|Q13813-3|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=4189	26.727	2	1586.7437	1586.7437	K	I	614	628
PSM	HTLADNFNPVSEER	186	sp|P20645|MPRD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	14-UNIMOD:267	ms_run[2]:scan=6168	38.301	2	1637.7673	1637.7673	R	G	148	162
PSM	IGNFLNYGSHTGDADGFK	187	sp|Q27J81|INF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=7926	48.967	2	1911.8751	1911.8751	R	I	764	782
PSM	IHIDPEIQDGSPTTSR	188	sp|P50479-2|PDLI4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	16-UNIMOD:267	ms_run[2]:scan=5231	32.811	2	1774.8725	1774.8725	R	R	102	118
PSM	IHYLDTTTLIEPAPR	189	sp|P46109|CRKL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=7920	48.931	2	1738.9254	1738.9254	K	Y	90	105
PSM	IHYLDTTTLIEPAPR	190	sp|P46109|CRKL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	15-UNIMOD:267	ms_run[2]:scan=7925	48.961	2	1748.9337	1748.9337	K	Y	90	105
PSM	INSGGKLPNFGFVVFDDSEPVQK	191	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=11342	70.933	2	2493.254	2493.2540	R	V	371	394
PSM	IREPLTAQQLETTTER	192	sp|Q6P1N0-2|C2D1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	2-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=6012	37.401	2	1905.007	1905.0070	R	W	790	806
PSM	ISSIQSIVPALEIANAHR	193	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	18-UNIMOD:267	ms_run[2]:scan=10694	66.611	2	1928.0719	1928.0719	K	K	251	269
PSM	KAGNLTNAYVYEVGPGPGGITR	194	sp|Q8WVM0|TFB1M_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=7359	45.484	2	2233.1491	2233.1491	R	S	50	72
PSM	KFLDGNELTLADCNLLPK	195	sp|O00299|CLIC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	13-UNIMOD:4	ms_run[2]:scan=10446	64.992	2	2060.0612	2060.0612	R	L	166	184
PSM	KPTFMDEEVQSILTK	196	sp|P82650|RT22_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=10170	63.217	2	1764.8968	1764.8968	K	M	67	82
PSM	KPTFMDEEVQSILTK	197	sp|P82650|RT22_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=10173	63.236	2	1776.937	1776.9370	K	M	67	82
PSM	LASTPFKGGTLFGGEVCK	198	sp|P42166|LAP2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	17-UNIMOD:4	ms_run[2]:scan=8154	50.37	2	1867.9502	1867.9502	K	V	668	686
PSM	LGRIEADSESQEDIIR	199	sp|P55957|BID_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=5615	35.063	2	1829.9119	1829.9119	R	N	69	85
PSM	LLQALAQYQNHLQEQPR	200	sp|Q9BQG0|MBB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	17-UNIMOD:267	ms_run[2]:scan=7695	47.523	2	2059.0838	2059.0838	K	K	162	179
PSM	LVGVVPGPVGEPADSDKR	201	sp|Q9HA77|SYCM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=5740	35.808	2	1790.9527	1790.9527	K	H	207	225
PSM	MEEIVEGCTGALHILAR	202	sp|P35222|CTNB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:35,8-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=8162	50.421	2	1923.9422	1923.9422	R	D	566	583
PSM	MEEIVEGCTGALHILAR	203	sp|P35222|CTNB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:35,8-UNIMOD:4	ms_run[2]:scan=8164	50.433	2	1913.9339	1913.9339	R	D	566	583
PSM	MQKEITALAPSTMK	204	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:35	ms_run[2]:scan=4956	31.203	2	1563.8	1563.8001	R	I	313	327
PSM	NLHYFNSDSFASHPNYPYSDEY	205	sp|P42330|AK1C3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=8858	54.748	2	2666.0986	2666.0986	R	-	302	324
PSM	QQPTQFINPETPGYVGFANLPNQVHR	206	sp|Q15019|SEPT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	26-UNIMOD:267	ms_run[2]:scan=9997	62.095	3	2961.4761	2961.4761	K	K	4	30
PSM	RALEYTIYNQELNETR	207	sp|Q9UQE7|SMC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=7017	43.414	2	2011.9963	2011.9963	R	A	221	237
PSM	REDLVVAPAGITLK	208	sp|P12268|IMDH2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=7686	47.472	2	1480.8613	1480.8613	K	E	182	196
PSM	REEEEFNTGPLSVLTQSVK	209	sp|P62316-2|SMD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=10607	66.039	2	2162.0855	2162.0855	K	N	9	28
PSM	RLQQTQNQVDEVVDIMR	210	sp|Q15836|VAMP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:267,17-UNIMOD:267	ms_run[2]:scan=8580	52.997	2	2091.0646	2091.0646	R	V	14	31
PSM	RLQQTQNQVDEVVDIMR	211	sp|Q15836|VAMP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=8587	53.043	2	2071.048	2071.0480	R	V	14	31
PSM	RTGAIVDVPVGEELLGR	212	sp|P25705-2|ATPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:267,17-UNIMOD:267	ms_run[2]:scan=9395	58.211	2	1800.0008	1800.0008	K	V	83	100
PSM	SRLEVAEAEEEETSIK	213	sp|O15213|WDR46_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=5610	35.032	2	1818.8847	1818.8847	R	A	130	146
PSM	SYYTVHLLQLENINSGETR	214	sp|P17706-3|PTN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=9470	58.691	2	2236.1124	2236.1124	K	T	152	171
PSM	TFSHELSDFGLESTAGEIPVVAIR	215	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	24-UNIMOD:267	ms_run[2]:scan=11722	73.501	3	2584.3049	2584.3049	K	T	306	330
PSM	THNSSLEYNIFEGMECR	216	sp|Q16555|DPYL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	16-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=9664	59.933	2	2095.8967	2095.8967	K	G	424	441
PSM	THSTSSSLGSGESPFSR	217	sp|Q9UGV2-3|NDRG3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=4308	27.384	2	1722.7809	1722.7809	R	S	240	257
PSM	TNVNGGAIALGHPLGGSGSR	218	sp|P42765|THIM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	20-UNIMOD:267	ms_run[2]:scan=5582	34.866	2	1843.9528	1843.9528	K	I	341	361
PSM	TRIIDVVYNASNNELVR	219	sp|P62241|RS8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	2-UNIMOD:267,17-UNIMOD:267	ms_run[2]:scan=9156	56.684	2	1995.0652	1995.0652	K	T	76	93
PSM	VCHLGDQLEGVNTPR	220	sp|O00471|EXOC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	2-UNIMOD:4	ms_run[2]:scan=5337	33.441	2	1693.8206	1693.8206	K	Q	110	125
PSM	VDHLTLACTPGSSPTLLR	221	sp|Q96IR7|HPDL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	8-UNIMOD:4,18-UNIMOD:267	ms_run[2]:scan=7805	48.211	2	1947.0123	1947.0123	R	W	161	179
PSM	VHYENNSPFLTITSMTR	222	sp|P04843|RPN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	17-UNIMOD:267	ms_run[2]:scan=9611	59.597	2	2018.9759	2018.9759	K	V	216	233
PSM	VNNASLIGLGYTQTLRPGVK	223	sp|Q9Y277|VDAC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=8505	52.528	2	2100.1691	2100.1691	K	L	237	257
PSM	VVLLGEFLHPCEDDIVCK	224	sp|Q9NY12-2|GAR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	11-UNIMOD:4,17-UNIMOD:4	ms_run[2]:scan=11385	71.233	2	2142.0489	2142.0489	R	C	70	88
PSM	NSSYVHGGLDSNGKPADAVYGQK	225	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	14-UNIMOD:188,23-UNIMOD:188	ms_run[1]:scan=4526	28.668765000000004	2	2376.131850	2375.154460	K	E	37	60
PSM	AGGSPAPGPETPAISPSKR	226	sp|P33316|DUT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=3435	22.374	2	1775.9166	1775.9166	K	A	85	104
PSM	ALNTLSSPGQSSFSHGTR	227	sp|Q8WWQ0|PHIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	18-UNIMOD:267	ms_run[2]:scan=4672	29.514	2	1855.9052	1855.9052	K	N	1554	1572
PSM	ALSAIADLLTNEHER	228	sp|O60716|CTND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	15-UNIMOD:267	ms_run[2]:scan=10027	62.284	2	1661.8612	1661.8612	K	V	711	726
PSM	AVQALCAVYEHWVPR	229	sp|O60701-3|UGDH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:4	ms_run[2]:scan=10333	64.266	2	1797.8985	1797.8985	R	E	94	109
PSM	FKNEEEVFAWNNEVK	230	sp|P49419-4|AL7A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=8011	49.494	2	1893.93	1893.9300	K	Q	374	389
PSM	FQNVADLHLYLYSAK	231	sp|P41250|GARS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=9801	60.826	2	1780.9148	1780.9148	K	A	365	380
PSM	FSHEEIAMATVTALR	232	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=8463	52.258	2	1674.8399	1674.8399	K	R	244	259
PSM	FSSSGDFLVAGVGQEHR	233	sp|O43818|U3IP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=7483	46.221	2	1791.854	1791.8540	K	L	429	446
PSM	GFKFDETEQALANER	234	sp|Q7L014|DDX46_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=7311	45.192	2	1753.8271	1753.8271	K	K	777	792
PSM	GIRDDIEEEDDQEAYFR	235	sp|Q86XP3-2|DDX42_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:267,17-UNIMOD:267	ms_run[2]:scan=7506	46.358	2	2118.9245	2118.9245	K	Y	27	44
PSM	GLHVVEVTYDDVPIPNSPFK	236	sp|O75369-6|FLNB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	20-UNIMOD:188	ms_run[2]:scan=10458	65.069	2	2231.157	2231.1570	K	V	1300	1320
PSM	GMTVEGLKQFIAAQGSSR	237	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=9970	61.92	2	1878.9622	1878.9622	R	S	465	483
PSM	GNGTSMISLIIPPKDQISR	238	sp|P62495|ERF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=10005	62.147	2	2026.0881	2026.0881	R	V	29	48
PSM	GYGFVHFETQEAAER	239	sp|P11940-2|PABP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=7032	43.502	2	1739.7903	1739.7903	K	A	139	154
PSM	HQSFVLVGETGSGK	240	sp|O43143|DHX15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=5038	31.678	2	1444.731	1444.7310	R	T	153	167
PSM	IHAESLLLDSPAVAK	241	sp|Q9H4L5-2|OSBL3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	15-UNIMOD:188	ms_run[2]:scan=7484	46.227	2	1568.8869	1568.8869	R	S	370	385
PSM	ILQDIASGSHPFSQVLK	242	sp|P28331-3|NDUS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=8429	52.042	2	1838.989	1838.9890	K	E	340	357
PSM	KAEPMQWASLELPAAK	243	sp|Q9UHD1|CHRD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=9287	57.523	2	1768.9182	1768.9182	R	K	306	322
PSM	KFFVSCNVQSVDEK	244	sp|Q5T1C6|THEM4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:4	ms_run[2]:scan=5698	35.552	2	1685.8083	1685.8083	R	T	207	221
PSM	KGGSWIQEINVAEK	245	sp|P78527-2|PRKDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=7674	47.396	2	1557.8151	1557.8151	K	N	3992	4006
PSM	KGIDYDFPSLILQK	246	sp|Q9BYG3|MK67I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=10623	66.145	2	1647.9275	1647.9275	K	T	179	193
PSM	KGLEMDPIDCTPPEYILPGSR	247	sp|O75153|CLU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	10-UNIMOD:4	ms_run[2]:scan=9918	61.582	2	2387.1501	2387.1501	K	E	175	196
PSM	KIFVGGLNPEATEEK	248	sp|Q99729-3|ROAA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=6054	37.657	2	1642.8969	1642.8969	K	I	155	170
PSM	KNWVVTGADDMQIR	249	sp|P35606-2|COPB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=7274	44.976	2	1631.809	1631.8090	R	V	40	54
PSM	KTYITDPVSAPCAPPLQPK	250	sp|Q93052|LPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	12-UNIMOD:4	ms_run[2]:scan=6908	42.76	2	2082.082	2082.0820	K	G	353	372
PSM	LFTAHNNMTNYATVWASK	251	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=8628	53.301	2	2067.9836	2067.9836	K	T	738	756
PSM	LGGEGGKGGDVWVVAQNR	252	sp|A4D1E9|GTPBA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=5998	37.31	2	1797.9122	1797.9122	R	M	35	53
PSM	LGRIEADSESQEDIIR	253	sp|P55957|BID_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=5606	35.009	2	1849.9285	1849.9285	R	N	69	85
PSM	LHAVNAEECNVLQGR	254	sp|O75521-2|ECI2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	9-UNIMOD:4	ms_run[2]:scan=5119	32.15	2	1708.8315	1708.8315	K	W	325	340
PSM	MEEIVEGCTGALHILAR	255	sp|P35222|CTNB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:35,8-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=8163	50.427	3	1923.9422	1923.9422	R	D	566	583
PSM	MHSPQTSAMLFTVDNEAGK	256	sp|P49588|SYAC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:35	ms_run[2]:scan=7044	43.569	2	2078.9401	2078.9401	K	I	880	899
PSM	MHSPQTSAMLFTVDNEAGK	257	sp|P49588|SYAC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=7522	46.451	2	2062.9452	2062.9452	K	I	880	899
PSM	MQKEITALAPSTMK	258	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:35,3-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=4947	31.151	2	1575.8403	1575.8403	R	I	313	327
PSM	MWDLSSNQAIQIAQHDAPVK	259	sp|P78406|RAE1L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:35,20-UNIMOD:188	ms_run[2]:scan=9119	56.408	2	2273.1206	2273.1206	K	T	112	132
PSM	MWDPHNDPNAQGDAFK	260	sp|P08621-3|RU17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=5634	35.173	2	1841.7791	1841.7791	K	T	88	104
PSM	NGPGFHNDIDSNSTIQEILIPASK	261	sp|Q96I24|FUBP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	24-UNIMOD:188	ms_run[2]:scan=10049	62.43	2	2572.2865	2572.2865	R	V	150	174
PSM	RGPQLVCTGSDDGTVK	262	sp|Q96DI7|SNR40_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:4	ms_run[2]:scan=3410	22.235	2	1688.8152	1688.8152	R	L	162	178
PSM	RNLGSINTELQDVQR	263	sp|O75396|SC22B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:267,15-UNIMOD:267	ms_run[2]:scan=6088	37.847	2	1761.9236	1761.9236	R	I	133	148
PSM	SKAECEILMMVGLPAAGK	264	sp|Q9BUJ2-3|HNRL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:4	ms_run[2]:scan=11094	69.275	2	1903.957	1903.9570	K	T	303	321
PSM	SKFYGNSLSAILEGEAR	265	sp|Q9BZF1-3|OSBL8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=9633	59.743	2	1840.9319	1840.9319	K	L	498	515
PSM	SKGFGFVCFSSPEEATK	266	sp|Q13310-2|PABP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:188,8-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=8402	51.882	2	1888.9068	1888.9068	R	A	332	349
PSM	SNMGHPEPASGLAALAK	267	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=6066	37.723	2	1649.8195	1649.8195	K	V	327	344
PSM	SRDLLVQQASQCLSK	268	sp|Q1KMD3|HNRL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	12-UNIMOD:4	ms_run[2]:scan=6221	38.615	2	1731.8938	1731.8938	K	L	507	522
PSM	TVPLAGHVGFDSLPDQLVNK	269	sp|Q14141-3|SEPT6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=9714	60.253	2	2106.111	2106.1110	R	S	16	36
PSM	TYHALCNEEFTIFNR	270	sp|Q8N3U4|STAG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:4	ms_run[2]:scan=8923	55.163	2	1913.873	1913.8730	K	V	635	650
PSM	VCHLGDQLEGVNTPR	271	sp|O00471|EXOC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=5332	33.41	2	1703.8289	1703.8289	K	Q	110	125
PSM	VFSWLQQEGHLSEEEMAR	272	sp|P22102|PUR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=9712	60.241	2	2175.0055	2175.0055	R	T	712	730
PSM	VLKDQPPNSVEGLLNALR	273	sp|Q9NUQ9-2|FA49B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=11526	72.179	2	1962.0898	1962.0898	K	Y	141	159
PSM	YWSTNAHEIEGTVFDR	274	sp|Q9H4L5-2|OSBL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	16-UNIMOD:267	ms_run[2]:scan=8673	53.574	2	1933.8834	1933.8834	K	S	696	712
PSM	QLYHLGVVEAYSGLTK	275	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:28,16-UNIMOD:188	ms_run[1]:scan=11063	69.07387	2	1765.9307	1765.9341	R	K	249	265
PSM	FSHEEIAMATVTALR	276	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	15-UNIMOD:267	ms_run[1]:scan=8477	52.34939666666667	2	1685.851964	1684.848210	K	R	244	259
PSM	NHYLDLAGIENYTSQFGPGSPSVAQK	277	sp|Q969G9|NKD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=10838	67.58294833333333	3	2792.346503	2792.340573	R	S	257	283
PSM	LIHEPSAALLAYGIGQDSPTGK	278	sp|Q0VDF9|HSP7E_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=9274	57.44411333333333	2	2237.169590	2237.169198	R	S	169	191
PSM	ALGMKLPETNLFETEETR	279	sp|Q15046|SYK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=9894	61.426	2	2078.0354	2078.0354	K	K	403	421
PSM	AVQALCAVYEHWVPR	280	sp|O60701-3|UGDH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=10343	64.328	2	1807.9067	1807.9067	R	E	94	109
PSM	DTKEIYTHFTCATDTK	281	sp|P63096-2|GNAI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	11-UNIMOD:4	ms_run[2]:scan=5703	35.585	2	1929.8778	1929.8778	K	N	263	279
PSM	EAPNPIHLTVDTSLQNGR	282	sp|O00303|EIF3F_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	18-UNIMOD:267	ms_run[2]:scan=7347	45.408	2	1971.0049	1971.0049	R	M	193	211
PSM	EGGPNPEHNSNLANILEVCR	283	sp|Q9BSH4|TACO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	19-UNIMOD:4	ms_run[2]:scan=8271	51.088	2	2219.0389	2219.0389	K	S	94	114
PSM	EKPYFPIPEEYTFIQNVPLEDR	284	sp|Q00839-2|HNRPU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=12025	75.557	3	2723.3483	2723.3483	K	V	444	466
PSM	FCACPEEAAHALELR	285	sp|Q9NP81|SYSM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	2-UNIMOD:4,4-UNIMOD:4	ms_run[2]:scan=8065	49.831	2	1772.7974	1772.7974	R	K	63	78
PSM	FGTVLTEHVAAAELGAR	286	sp|O43598-2|DNPH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=8148	50.33	2	1740.9159	1740.9159	R	G	49	66
PSM	FTHCEQVLGEGALDR	287	sp|Q96LD4|TRI47_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	4-UNIMOD:4	ms_run[2]:scan=5769	35.973	2	1730.8046	1730.8046	R	G	465	480
PSM	GIRDDIEEEDDQEAYFR	288	sp|Q86XP3-2|DDX42_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=7501	46.325	2	2098.908	2098.9080	K	Y	27	44
PSM	GKGFSVVADTPELQR	289	sp|Q14847-3|LASP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=6392	39.629	2	1602.8366	1602.8366	K	I	39	54
PSM	GLAPLHWADDDGNPTEQYPLNPNGSPGGVAGICSCDGR	290	sp|O15067|PUR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	33-UNIMOD:4,35-UNIMOD:4	ms_run[2]:scan=10119	62.886	3	3963.7541	3963.7541	R	H	1253	1291
PSM	GPAVGIDLGTTYSCVGVFQHGK	291	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	14-UNIMOD:4,22-UNIMOD:188	ms_run[2]:scan=9544	59.155	2	2268.1304	2268.1304	K	V	4	26
PSM	GPGGSSLLIEALSNSSHK	292	sp|Q9BSH4|TACO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	18-UNIMOD:188	ms_run[2]:scan=9009	55.686	2	1758.9208	1758.9208	R	C	142	160
PSM	GRTVIIEQSWGSPK	293	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=5805	36.186	2	1556.8311	1556.8311	K	V	59	73
PSM	HLSSCAAPAPLTSAER	294	sp|Q6IBS0|TWF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	5-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=3864	24.852	2	1676.818	1676.8180	K	E	137	153
PSM	IFVGGIKEDTEEYNLR	295	sp|P51991-2|ROA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=7543	46.583	2	1881.9472	1881.9472	K	D	106	122
PSM	IRLDTETEGVPSTAIR	296	sp|P24941-2|CDK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=6265	38.894	2	1756.9319	1756.9319	K	E	35	51
PSM	ISSIQSIVPALEIANAHR	297	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=10590	65.925	2	1918.0636	1918.0636	K	K	251	269
PSM	IVTGGSDNHLILVDLR	298	sp|P34896-4|GLYC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=8668	53.545	2	1720.9472	1720.9472	K	S	211	227
PSM	KAEPMQWASLELPAAK	299	sp|Q9UHD1|CHRD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=9301	57.606	2	1780.9584	1780.9584	R	K	306	322
PSM	KDPELWGSVLLESNPYR	300	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=11047	68.969	2	2002.016	2002.0160	R	R	951	968
PSM	KGVEGLIDIENPNR	301	sp|Q13442|HAP28_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=7283	45.028	2	1552.8209	1552.8209	R	V	75	89
PSM	LAELLTQQHGLQCR	302	sp|Q9H6R4-2|NOL6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	13-UNIMOD:4	ms_run[2]:scan=6041	37.576	2	1665.8621	1665.8621	R	A	765	779
PSM	LGGSPFGPAGTGKTESVK	303	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=4645	29.355	2	1688.8733	1688.8733	R	A	1900	1918
PSM	LHNQQALSSSIEEGLR	304	sp|Q06587-2|RING1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=6303	39.121	2	1780.9068	1780.9068	R	M	102	118
PSM	LLGPDAAINLTDPDGALAKR	305	sp|Q13561|DCTN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=9349	57.921	2	2020.0953	2020.0953	K	L	157	177
PSM	LLSRPQDALEGVVLSPSLEAR	306	sp|Q9NVI7-2|ATD3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=10126	62.931	2	2249.2379	2249.2379	R	V	307	328
PSM	LQISHEAAACITGLR	307	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	10-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=7023	43.45	2	1648.8594	1648.8594	K	A	1090	1105
PSM	LVDHIDQTPGFSLQQLR	308	sp|Q8N8A6|DDX51_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=8880	54.889	2	1966.0272	1966.0272	R	F	350	367
PSM	LYGAQFHPEVGLTENGK	309	sp|P49915-2|GUAA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	17-UNIMOD:188	ms_run[2]:scan=7063	43.685	2	1864.9415	1864.9415	K	V	85	102
PSM	MQEHSDQVPVGNIPR	310	sp|P33993-2|MCM7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:35	ms_run[2]:scan=4188	26.722	2	1721.8155	1721.8155	K	S	237	252
PSM	NKASVDELFAEIVR	311	sp|P61225|RAP2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=11196	69.951	2	1589.8413	1589.8413	K	Q	149	163
PSM	PLRPQVVTDDDGQAPEAK	312	sp|Q9HDC9-2|APMAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=3975	25.476	2	1934.9698	1934.9698	R	D	12	30
PSM	QLRFEDVVNQSSPK	313	sp|Q01085|TIAR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=6400	39.673	2	1645.8424	1645.8424	K	N	190	204
PSM	RTDIFGVEETAIGK	314	sp|Q15459-2|SF3A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=7956	49.157	2	1534.7991	1534.7991	R	K	408	422
PSM	RTVQSLEIDLDSMR	315	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:267,14-UNIMOD:267	ms_run[2]:scan=8414	51.955	2	1681.8572	1681.8572	R	N	301	315
PSM	RTVQSLEIDLDSMR	316	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=8432	52.064	2	1661.8407	1661.8407	R	N	301	315
PSM	SGPASTFNDRVFASELNAGIIK	317	sp|Q9P2J5|SYLC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=10336	64.288	3	2293.1703	2293.1703	R	T	786	808
PSM	SIYGEKFEDENFILK	318	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=9090	56.22	2	1842.9442	1842.9442	K	H	77	92
PSM	SLHQAIEGDTSGDFLK	319	sp|P08133-2|ANXA6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	16-UNIMOD:188	ms_run[2]:scan=6638	41.091	2	1722.852	1722.8520	K	A	616	632
PSM	SLYYYIQQDTKGDYQK	320	sp|P07355-2|ANXA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	11-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=7632	47.141	2	2023.993	2023.9930	K	A	332	348
PSM	TFGPVYEGKDLIAQAR	321	sp|Q9BQ39|DDX50_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=8033	49.628	2	1763.9206	1763.9206	K	T	167	183
PSM	TKGVDEVTIVNILTNR	322	sp|P07355-2|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	2-UNIMOD:188	ms_run[2]:scan=10673	66.471	2	1777.0041	1777.0041	K	S	66	82
PSM	TLAEIAKVELDNMPLR	323	sp|Q15233-2|NONO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=11326	70.831	2	1811.9815	1811.9815	R	G	31	47
PSM	TPCSSLLPLLNAHAATSGK	324	sp|Q9NUQ6-2|SPS2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:4	ms_run[2]:scan=9020	55.755	2	1937.004	1937.0040	R	Q	296	315
PSM	TYDATTHFETTCDDIKNIYK	325	sp|P50395-2|GDIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	12-UNIMOD:4	ms_run[2]:scan=7516	46.419	3	2435.0951	2435.0951	R	R	358	378
PSM	TYDATTHFETTCDDIKNIYK	326	sp|P50395-2|GDIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	12-UNIMOD:4,16-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=7520	46.439	2	2447.1354	2447.1354	R	R	358	378
PSM	VDHLTLACTPGSSPTLLR	327	sp|Q96IR7|HPDL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	8-UNIMOD:4	ms_run[2]:scan=7797	48.16	2	1937.004	1937.0040	R	W	161	179
PSM	WLSTRPEVASIEPLGLDEQQCSQK	328	sp|Q8TEM1-2|PO210_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	21-UNIMOD:4	ms_run[2]:scan=9362	58	3	2770.3596	2770.3596	R	A	56	80
PSM	YGLIYHASLVGQTSPK	329	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	16-UNIMOD:188	ms_run[2]:scan=6991	43.267	2	1738.9349	1738.9349	K	H	338	354
PSM	QATINIGTIGHVAHGK	330	sp|Q2VIR3|IF2GL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:28,16-UNIMOD:188	ms_run[1]:scan=7085	43.81455833333333	2	1604.8693	1604.8725	R	S	39	55
PSM	SKGVFVQSVLPYFVATK	331	sp|Q53GQ0|DHB12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=11131	69.52130166666667	2	1869.034019	1869.040021	R	L	222	239
PSM	ALELTGLKVFGNEIK	332	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	8-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=10507	65.392	2	1642.9697	1642.9697	K	L	363	378
PSM	DAVPATLHLLPCEVAVDGPAPVGR	333	sp|Q8TDP1|RNH2C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	12-UNIMOD:4,24-UNIMOD:267	ms_run[2]:scan=10241	63.676	2	2463.2819	2463.2819	R	F	23	47
PSM	EFPGFLENQKDPLAVDK	334	sp|P60903|S10AA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	10-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=9619	59.651	2	1958.0188	1958.0188	K	I	38	55
PSM	FNAHGDANTIVCNSK	335	sp|P09382|LEG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	12-UNIMOD:4	ms_run[2]:scan=3442	22.416	2	1646.7471	1646.7471	R	D	50	65
PSM	FSPNSSNPIIVSCGWDKLVK	336	sp|P63244|RACK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	13-UNIMOD:4,17-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=10204	63.438	2	2259.176	2259.1760	R	V	156	176
PSM	GIDRYNPENLATLER	337	sp|Q9UBQ5-2|EIF3K_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=7436	45.954	2	1759.8853	1759.8853	K	Y	17	32
PSM	GIYAYGFEKPSAIQQR	338	sp|P38919|IF4A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=6922	42.851	2	1826.9315	1826.9315	R	A	52	68
PSM	GRGTGEAEEEYVGPR	339	sp|Q13895|BYST_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=3073	20.298	2	1605.7383	1605.7383	R	L	39	54
PSM	HGQQWCEVQSQVDQK	340	sp|Q9BZM4|ULBP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=4412	27.963	2	1861.8473	1861.8473	R	N	46	61
PSM	HQAFEAELSANQSR	341	sp|Q13813-3|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	14-UNIMOD:267	ms_run[2]:scan=4177	26.66	2	1596.752	1596.7520	K	I	614	628
PSM	HSSLAGCQIINYR	342	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	7-UNIMOD:4	ms_run[2]:scan=5516	34.479	2	1517.7409	1517.7409	R	T	145	158
PSM	HVLDALDPNAYEAFK	343	sp|P49916-4|DNLI3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=9427	58.417	2	1701.8362	1701.8362	K	A	341	356
PSM	IASWADLVNAHVVPGSGVVK	344	sp|P11172|UMPS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	20-UNIMOD:188	ms_run[2]:scan=10730	66.856	2	2024.115	2024.1150	K	G	333	353
PSM	IAVHPDYQGMGYGSR	345	sp|Q9H0A0-2|NAT10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=5241	32.87	2	1649.762	1649.7620	R	A	557	572
PSM	ICGDIHGQYYDLLR	346	sp|P62136|PP1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:4	ms_run[2]:scan=8029	49.606	2	1721.8195	1721.8195	K	L	61	75
PSM	IENLSNLHQLQMLELGSNR	347	sp|Q15435-5|PP1R7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	19-UNIMOD:267	ms_run[2]:scan=9972	61.932	2	2218.1404	2218.1404	K	I	120	139
PSM	IEVIKPGDLGVDLTSK	348	sp|P38117|ETFB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=8761	54.127	2	1682.9455	1682.9455	K	L	206	222
PSM	IIGVHQEDELLECLSPATSR	349	sp|Q93009-3|UBP7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	13-UNIMOD:4	ms_run[2]:scan=9973	61.938	2	2266.1263	2266.1263	K	T	933	953
PSM	IMNVIGEPIDERGPIK	350	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=7671	47.379	2	1779.9553	1779.9553	R	T	144	160
PSM	IRLDTETEGVPSTAIR	351	sp|P24941-2|CDK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=6256	38.837	2	1776.9485	1776.9485	K	E	35	51
PSM	KCVQSNIVLLTQAFR	352	sp|O94925-3|GLSK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:4	ms_run[2]:scan=10083	62.649	2	1775.9716	1775.9716	K	R	202	217
PSM	KEFSPFGTITSAK	353	sp|P11940-2|PABP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=7067	43.71	2	1411.7347	1411.7347	R	V	312	325
PSM	KFIAYQFTDTPLQIK	354	sp|O00267-2|SPT5H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=9835	61.047	2	1824.0224	1824.0224	R	S	195	210
PSM	KGGSWIQEINVAEK	355	sp|P78527-2|PRKDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=7672	47.385	2	1569.8554	1569.8554	K	N	3992	4006
PSM	KPVAGALDVSFNK	356	sp|Q99627-2|CSN8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=5849	36.441	2	1344.7402	1344.7402	R	F	117	130
PSM	KVPGVTAIELGEETCTFR	357	sp|P51116|FXR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:4	ms_run[2]:scan=8600	53.125	2	2006.0143	2006.0143	R	I	256	274
PSM	KWENPTQNNAGLEDFER	358	sp|P22694-8|KAPCB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=7053	43.624	3	2046.9395	2046.9395	K	K	30	47
PSM	LEGVLAEVAQHYQDTLIR	359	sp|P46940|IQGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	18-UNIMOD:267	ms_run[2]:scan=11982	75.271	2	2064.0879	2064.0879	K	A	568	586
PSM	LHDSSGSQVGTGFK	360	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=2508	17.063	2	1418.679	1418.6790	K	S	1829	1843
PSM	LIQLMEEIMAEKENK	361	sp|Q92841|DDX17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	12-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=10675	66.488	2	1829.967	1829.9670	K	T	406	421
PSM	LIQLMEEIMAEKENK	362	sp|Q92841|DDX17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=10668	66.437	2	1817.9267	1817.9267	K	T	406	421
PSM	LIQLMEEIMAEKENK	363	sp|Q92841|DDX17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=10680	66.521	2	1817.9267	1817.9267	K	T	406	421
PSM	LNEHFLNTTDFLDTIK	364	sp|P48735-2|IDHP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=11109	69.377	2	1919.9629	1919.9629	K	S	375	391
PSM	LNQENEHIYNLWCSGR	365	sp|Q96A33-2|CCD47_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	13-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=7987	49.342	2	2041.9304	2041.9304	K	V	197	213
PSM	LSFQHDPETSVLVLR	366	sp|Q14697|GANAB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:267	ms_run[2]:scan=8613	53.209	2	1749.9289	1749.9289	R	K	915	930
PSM	LTHVDSPLEAPAGPLGQVK	367	sp|Q9BSJ8|ESYT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=7627	47.106	2	1928.0367	1928.0367	R	L	958	977
PSM	MVMIQDGPLPTGADKPLR	368	sp|Q96I24|FUBP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:35	ms_run[2]:scan=6784	41.966	2	1954.0016	1954.0016	K	I	196	214
PSM	NLHQSGFSLSGAQIDDNIPR	369	sp|Q16555|DPYL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=8084	49.942	3	2168.061	2168.0610	R	R	533	553
PSM	NLPSNPLEFNPDVLKK	370	sp|A0FGR8-6|ESYT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=9533	59.084	2	1823.9781	1823.9781	R	T	547	563
PSM	NRAEQWNVNYVETSAK	371	sp|P11233|RALA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=5992	37.275	2	1907.9126	1907.9126	K	T	144	160
PSM	QLYHLGVVEAYSGLTK	372	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=8813	54.464	2	1776.941	1776.9410	R	K	249	265
PSM	RNLGSINTELQDVQR	373	sp|O75396|SC22B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=6086	37.835	2	1741.9071	1741.9071	R	I	133	148
PSM	RTTDFSDFLSIVGCTK	374	sp|Q9UHD1|CHRD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	14-UNIMOD:4	ms_run[2]:scan=11571	72.49	2	1845.8931	1845.8931	R	G	46	62
PSM	SCILRPGGSEDASAMLR	375	sp|P52888|THOP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:4	ms_run[2]:scan=6544	40.542	3	1818.8717	1818.8717	R	R	643	660
PSM	SEAHLTELLEEICDR	376	sp|Q9Y2B0|CNPY2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	13-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=10883	67.879	2	1823.8599	1823.8599	R	M	74	89
PSM	SEELNKDLNPFTPLVGIR	377	sp|Q86U90|YRDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=10878	67.844	2	2041.0844	2041.0844	R	I	156	174
PSM	SHAVACVNQFIISR	378	sp|Q92973-3|TNPO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:4	ms_run[2]:scan=6996	43.298	2	1600.8144	1600.8144	R	T	150	164
PSM	SHAVACVNQFIISR	379	sp|Q92973-3|TNPO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=6999	43.312	2	1610.8227	1610.8227	R	T	150	164
PSM	SIYGEKFEDENFILK	380	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=9102	56.301	2	1830.904	1830.9040	K	H	77	92
PSM	SKGVFVQSVLPYFVATK	381	sp|Q53GQ0|DHB12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=11135	69.55	2	1881.0803	1881.0803	R	L	222	239
PSM	SLEDALSSDTSGHFR	382	sp|P08133-2|ANXA6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:267	ms_run[2]:scan=7156	44.255	2	1630.7462	1630.7462	K	R	452	467
PSM	SPDGAHLTWEPPSVTSGK	383	sp|P51610-2|HCFC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=6964	43.113	2	1864.8955	1864.8955	K	I	1833	1851
PSM	SPDGAHLTWEPPSVTSGK	384	sp|P51610-2|HCFC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	18-UNIMOD:188	ms_run[2]:scan=6965	43.119	2	1870.9157	1870.9157	K	I	1833	1851
PSM	SQEEPKDTFEHDPSESIDEFNK	385	sp|Q9NYF8-3|BCLF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=6295	39.071	2	2607.1249	2607.1249	K	S	181	203
PSM	SQIHDIVLVGGSTR	386	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=5852	36.454	2	1480.7998	1480.7998	K	I	329	343
PSM	SRGEGPEAEFQSLTPSQIK	387	sp|Q9H425-2|CA198_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=7896	48.775	2	2060.0174	2060.0174	R	S	68	87
PSM	SRGPATVEDLPSAFEEK	388	sp|O14908-2|GIPC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=7441	45.982	2	1831.8952	1831.8952	R	A	150	167
PSM	SVAAGCPVLLGKDNPSPGPSR	389	sp|Q9NQS1|AVEN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:4	ms_run[2]:scan=5572	34.808	2	2078.0579	2078.0579	K	D	246	267
PSM	TFHTSSAAIGNQLYVFGGGER	390	sp|Q7Z6M1-2|RABEK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	21-UNIMOD:267	ms_run[2]:scan=8881	54.895	2	2221.0791	2221.0791	R	G	89	110
PSM	TFNTSTGGLLLPSDTKR	391	sp|P12956|XRCC6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=7187	44.44	2	1806.9476	1806.9476	R	S	302	319
PSM	TFSHELSDFGLESTAGEIPVVAIR	392	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=11713	73.442	3	2574.2966	2574.2966	K	T	306	330
PSM	TTIENIQLPHTLLSR	393	sp|P33991|MCM4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=9434	58.463	2	1734.9628	1734.9628	K	F	629	644
PSM	VETPSHPGGVSEEFWER	394	sp|Q92620|PRP16_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=7116	44.002	2	1941.8857	1941.8857	R	S	115	132
PSM	VIAATNRVDILDPALLR	395	sp|P17980|PRS6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=10013	62.2	3	1849.0785	1849.0785	K	S	328	345
PSM	VKIPEGTILTMDMLTVK	396	sp|Q9NR45|SIAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=11533	72.228	2	1900.0816	1900.0816	K	V	299	316
PSM	VLPSDLDLLLHMNNAR	397	sp|Q8WUY1|THEM6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=11462	71.749	2	1819.9615	1819.9615	R	Y	54	70
PSM	VPATALCVFDAHDGEVNAVQFSPGSR	398	sp|Q676U5-5|A16L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	7-UNIMOD:4	ms_run[2]:scan=9885	61.367	3	2743.3024	2743.3024	R	L	147	173
PSM	VTYHPDGPEGQAYDVDFTPPFR	399	sp|Q15046|SYK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=9444	58.527	2	2507.1394	2507.1394	K	R	371	393
PSM	VVIIGAGKPAAVVLQTK	400	sp|Q14697|GANAB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=7300	45.127	2	1663.0396	1663.0396	R	G	892	909
PSM	YLSAQKPLLNDGQFR	401	sp|P23786|CPT2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=6590	40.815	2	1748.921	1748.9210	R	K	64	79
PSM	YNQLLRIEEELGSK	402	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=9658	59.898	2	1690.889	1690.8890	K	A	407	421
PSM	QLYHLGVVEAYSGLTK	403	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:28	ms_run[1]:scan=11059	69.04468833333333	2	1759.9105	1759.9140	R	K	249	265
PSM	GIYAYGFEKPSAIQQR	404	sp|P60842|IF4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=6915	42.805355	2	1828.936851	1826.931534	R	A	46	62
PSM	QLFHPEQLITGKEDAANNYAR	405	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:28	ms_run[1]:scan=9674	59.99561166666667	2	2397.1690	2397.1708	R	G	85	106
PSM	FRSETITEEELVGLMNK	406	sp|P16152|CBR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	2-UNIMOD:267,17-UNIMOD:188	ms_run[1]:scan=10306	64.09385166666667	2	2011.038375	2011.026691	K	F	158	175
PSM	QFNYTHICAGASAFGK	407	sp|P13804|ETFA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:28,8-UNIMOD:4	ms_run[1]:scan=9097	56.26625166666667	2	1753.7886	1753.7877	K	N	102	118
PSM	QLRFEDVVNQSSPK	408	sp|Q01085|TIAR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	3-UNIMOD:267,14-UNIMOD:188	ms_run[1]:scan=6381	39.56688833333334	2	1661.866299	1661.870782	K	N	190	204
PSM	AVHNTAVLFLQNDPGFAK	409	sp|Q9H4Z3|CAPAM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=8918	55.131146666666666	2	1943.012284	1941.010847	K	W	635	653
PSM	AGDRQPEWLEEQQGR	410	sp|Q14980-2|NUMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:267,15-UNIMOD:267	ms_run[2]:scan=5016	31.545	2	1817.856	1817.8560	R	Q	944	959
PSM	AIDLFTDAIKLNPR	411	sp|P50502|F10A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=10575	65.834	2	1585.8828	1585.8828	K	L	133	147
PSM	AILILDNDGDRLFAK	412	sp|P61923-5|COPZ1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9869	61.265	2	1672.9148	1672.9148	K	Y	15	30
PSM	ALSAIADLLTNEHER	413	sp|O60716|CTND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=10026	62.279	2	1651.8529	1651.8529	K	V	711	726
PSM	CGFCHVGEEENEAR	414	sp|Q8IWS0-4|PHF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:4,4-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=3141	20.684	2	1702.6703	1702.6703	K	G	211	225
PSM	CPEALFQPSFLGMESCGIHETTFNSIMK	415	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:4,13-UNIMOD:35,16-UNIMOD:4,27-UNIMOD:35	ms_run[2]:scan=11000	68.659	3	3262.4443	3262.4443	R	C	257	285
PSM	CSVIRDSLLQDGEFSMDLR	416	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:4,5-UNIMOD:267,16-UNIMOD:35,19-UNIMOD:267	ms_run[2]:scan=9359	57.983	3	2276.068	2276.0680	K	T	71	90
PSM	CTVFHGAQVEDAFR	417	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:4	ms_run[2]:scan=6774	41.904	2	1635.7464	1635.7464	K	Y	1828	1842
PSM	CTVFHGAQVEDAFR	418	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=6777	41.921	2	1645.7546	1645.7546	K	Y	1828	1842
PSM	DGQWFTDWDAVPHSR	419	sp|Q08J23-3|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	15-UNIMOD:267	ms_run[2]:scan=10145	63.052	2	1825.8048	1825.8048	K	H	134	149
PSM	DVCTELLPLIKPQGR	420	sp|P16152|CBR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:4	ms_run[2]:scan=10231	63.612	2	1737.9447	1737.9447	R	V	120	135
PSM	EAPNPIHLTVDTSLQNGR	421	sp|O00303|EIF3F_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=7346	45.401	2	1960.9967	1960.9967	R	M	193	211
PSM	FNAHGDANTIVCNSK	422	sp|P09382|LEG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	12-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=3431	22.353	2	1652.7672	1652.7672	R	D	50	65
PSM	GITNLCVIGGDGSLTGANLFRK	423	sp|Q01813-2|PFKAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:4	ms_run[2]:scan=10616	66.098	2	2262.1791	2262.1791	R	E	110	132
PSM	GLAPDLPEDLYHLIK	424	sp|P62277|RS13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	15-UNIMOD:188	ms_run[2]:scan=12199	76.736	2	1698.9288	1698.9288	K	K	79	94
PSM	GPVKPTGGPGGGGTQTQQQMNQLK	425	sp|P26196|DDX6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=3649	23.613	2	2365.1808	2365.1808	R	N	23	47
PSM	HEVTILGGLNEFVVK	426	sp|P62256-2|UBE2H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=10966	68.426	2	1653.909	1653.9090	K	F	23	38
PSM	HNGPNDASDGTVR	427	sp|P31942-2|HNRH3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=640	6.8336	2	1338.5913	1338.5913	K	L	7	20
PSM	HPSAVTACNLDLENLVTDSNR	428	sp|Q9Y678|COPG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	8-UNIMOD:4	ms_run[2]:scan=9261	57.364	2	2325.1019	2325.1019	K	S	318	339
PSM	HSATTVFGANTPIVSCNFDR	429	sp|Q9NZM1-2|MYOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	16-UNIMOD:4	ms_run[2]:scan=8247	50.936	2	2193.0273	2193.0273	K	V	1074	1094
PSM	HSLDASQGTATGPR	430	sp|O00330-3|ODPX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:267	ms_run[2]:scan=1147	9.478	2	1406.6778	1406.6778	K	G	180	194
PSM	HSMNPFCEIAVEEAVR	431	sp|P38117|ETFB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	7-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=9524	59.028	2	1897.869	1897.8690	K	L	36	52
PSM	HSSLAGCQIINYR	432	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	7-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=5510	34.444	2	1527.7492	1527.7492	R	T	145	158
PSM	HTLADNFNPVSEER	433	sp|P20645|MPRD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=6172	38.326	2	1627.759	1627.7590	R	G	148	162
PSM	HVDLLEVAQETDGFSGSDLK	434	sp|Q8NBU5|ATAD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=10161	63.159	3	2159.0382	2159.0382	R	E	281	301
PSM	HVFGESDELIGQK	435	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	13-UNIMOD:188	ms_run[2]:scan=5613	35.053	2	1463.7352	1463.7352	R	V	138	151
PSM	HVFGESDELIGQK	436	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=5614	35.058	2	1457.7151	1457.7151	R	V	138	151
PSM	HYLFYDGESVSGK	437	sp|O75436|VP26A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	13-UNIMOD:188	ms_run[2]:scan=6372	39.516	2	1506.7086	1506.7086	K	V	39	52
PSM	IAVSKPSGPQPQADLQALLQSGAQVR	438	sp|Q8IV08|PLD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=10401	64.699	3	2658.4453	2658.4453	R	M	163	189
PSM	ICDQWDALGSLTHSR	439	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=8821	54.514	2	1767.8238	1767.8238	K	R	498	513
PSM	IFVGGLNPEATEEKIR	440	sp|Q99729-3|ROAA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=7714	47.634	2	1771.9468	1771.9468	K	E	156	172
PSM	IFVGGLSPDTPEEKIR	441	sp|Q14103-4|HNRPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=7273	44.971	2	1756.9359	1756.9359	K	E	165	181
PSM	ILDKCNEIINWLDK	442	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	5-UNIMOD:4	ms_run[2]:scan=10373	64.522	2	1772.9131	1772.9131	K	N	570	584
PSM	IREIADGLCLEVEGK	443	sp|P13693|TCTP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	9-UNIMOD:4	ms_run[2]:scan=7877	48.657	2	1700.8767	1700.8767	K	M	20	35
PSM	IREPLTAQQLETTTER	444	sp|Q6P1N0-2|C2D1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=5995	37.292	2	1884.9905	1884.9905	R	W	790	806
PSM	KDCEVVMMIGLPGAGK	445	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:4,7-UNIMOD:35	ms_run[2]:scan=7832	48.38	2	1719.8358	1719.8358	K	T	476	492
PSM	KDCEVVMMIGLPGAGK	446	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:188,3-UNIMOD:4,7-UNIMOD:35,16-UNIMOD:188	ms_run[2]:scan=8055	49.768	2	1731.876	1731.8760	K	T	476	492
PSM	KEFSPFGTITSAK	447	sp|P11940-2|PABP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=7066	43.706	2	1423.775	1423.7750	R	V	312	325
PSM	KFLDGNEMTLADCNLLPK	448	sp|Q9Y696|CLIC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	13-UNIMOD:4	ms_run[2]:scan=10017	62.223	2	2078.0176	2078.0176	R	L	177	195
PSM	KGIDYDFPSLILQK	449	sp|Q9BYG3|MK67I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=10622	66.139	2	1635.8872	1635.8872	K	T	179	193
PSM	KGISLNPEQWSQLK	450	sp|P53999|TCP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=8902	55.032	2	1638.9132	1638.9132	R	E	101	115
PSM	KLTPITYPQGLAMAK	451	sp|P63000|RAC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=7560	46.689	2	1630.9116	1630.9116	K	E	133	148
PSM	KVESLQEEIAFLK	452	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9564	59.289	2	1532.845	1532.8450	R	K	223	236
PSM	LCSGVLGTVVHGK	453	sp|Q9Y6C9|MTCH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=5811	36.221	2	1331.7327	1331.7327	R	V	78	91
PSM	LHAVNAEECNVLQGR	454	sp|O75521-2|ECI2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	9-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=5120	32.156	2	1718.8398	1718.8398	K	W	325	340
PSM	LHDSSGSQVGTGFK	455	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:188	ms_run[2]:scan=2504	17.041	2	1424.6991	1424.6991	K	S	1829	1843
PSM	LLQALAQYQNHLQEQPR	456	sp|Q9BQG0|MBB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=7698	47.539	2	2049.0756	2049.0756	K	K	162	179
PSM	LQDFKLDFGNSQGK	457	sp|O75223-2|GGCT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	5-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=7578	46.795	2	1607.8346	1607.8346	R	T	46	60
PSM	LSFQHDPETSVLVLR	458	sp|Q14697|GANAB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=8614	53.214	2	1739.9206	1739.9206	R	K	915	930
PSM	MIAPEGSLVFHEK	459	sp|P48739|PIPNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=7037	43.528	2	1456.7384	1456.7384	R	A	74	87
PSM	MQEHSDQVPVGNIPR	460	sp|P33993-2|MCM7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:35,15-UNIMOD:267	ms_run[2]:scan=4181	26.682	2	1731.8238	1731.8238	K	S	237	252
PSM	MQKEITALAPSTMK	461	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:35	ms_run[2]:scan=4788	30.164	2	1563.8	1563.8001	R	I	313	327
PSM	MWDPHNDPNAQGDAFK	462	sp|P08621-3|RU17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:35,16-UNIMOD:188	ms_run[2]:scan=4848	30.545	2	1863.7942	1863.7942	K	T	88	104
PSM	NASEMIDKLTLTFNR	463	sp|P36542-2|ATPG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=10606	66.033	2	1751.8876	1751.8876	K	T	263	278
PSM	NKYLINGVNANNTR	464	sp|O95347-2|SMC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=4068	26.027	2	1589.8274	1589.8274	R	V	113	127
PSM	NNICSQPDLHAIGLSIIPAR	465	sp|Q01831-2|XPC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:4	ms_run[2]:scan=10079	62.624	3	2188.1423	2188.1423	R	F	184	204
PSM	NQYHDCSAPGPLACGVPYTCCIR	466	sp|O95858|TSN15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:4,14-UNIMOD:4,20-UNIMOD:4,21-UNIMOD:4	ms_run[2]:scan=7607	46.977	2	2695.14	2695.1400	K	N	166	189
PSM	NVDKVLEVPPVVYSR	467	sp|O00154-6|BACH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=8122	50.171	2	1712.9461	1712.9461	K	Q	118	133
PSM	QQPTQFINPETPGYVGFANLPNQVHR	468	sp|Q15019|SEPT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9999	62.107	3	2951.4678	2951.4678	K	K	4	30
PSM	RQQEELLAEENQR	469	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=3387	22.103	2	1641.8071	1641.8071	R	L	2549	2562
PSM	RQQEELLAEENQR	470	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:267,13-UNIMOD:267	ms_run[2]:scan=3392	22.133	2	1661.8236	1661.8236	R	L	2549	2562
PSM	SGCKVDLGGFAGLFDLK	471	sp|P22102|PUR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:4,4-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=12408	78.153	2	1794.9377	1794.9377	R	A	464	481
PSM	SIYGEKFEDENFILK	472	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9092	56.233	2	1830.904	1830.9040	K	H	77	92
PSM	SIYGSRFPDENFTLK	473	sp|P30405|PPIF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=8325	51.418	2	1772.8733	1772.8733	K	H	119	134
PSM	SKESVPEFPLSPPK	474	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=7174	44.364	2	1540.8137	1540.8137	R	K	28	42
PSM	SLESLHSFVAAATK	475	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=8560	52.872	2	1459.7671	1459.7671	R	E	582	596
PSM	SLGSVQAPSYGARPVSSAASVYAGAGGSGSR	476	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=6887	42.628	3	2853.4005	2853.4005	R	I	15	46
PSM	SLPDCTPHPNSISIDAGPR	477	sp|Q9Y2H0-3|DLGP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	5-UNIMOD:4,19-UNIMOD:267	ms_run[2]:scan=6227	38.655	2	2042.9719	2042.9719	R	Q	193	212
PSM	SLQSLEASLHAMESTR	478	sp|Q9UQE7|SMC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	16-UNIMOD:267	ms_run[2]:scan=10324	64.207	2	1768.8653	1768.8653	R	E	759	775
PSM	SNKQNLFLGSLTSR	479	sp|Q3ZCQ8-2|TIM50_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=7510	46.382	2	1563.8369	1563.8369	K	L	435	449
PSM	SNPFAHLAEPLDPVQPGKK	480	sp|P21399|ACOC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:1	ms_run[2]:scan=9957	61.835	2	2086.0847	2086.0847	M	F	2	21
PSM	SQIHDIVLVGGSTR	481	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:267	ms_run[2]:scan=5850	36.445	2	1490.8081	1490.8081	K	I	329	343
PSM	SSTATHPPGPAVQLNK	482	sp|Q14684-2|RRP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=3367	21.991	2	1603.8318	1603.8318	K	T	643	659
PSM	TFSHELSDFGLESTAGEIPVVAIR	483	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	24-UNIMOD:267	ms_run[2]:scan=11725	73.52	2	2584.3049	2584.3049	K	T	306	330
PSM	TIKAQIWDTAGQER	484	sp|P62491-2|RB11A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=5752	35.875	2	1615.8318	1615.8318	K	Y	59	73
PSM	TRTPASINATPANINLADLTR	485	sp|Q7KZ85|SPT6H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=8830	54.572	2	2209.1815	2209.1815	R	A	1530	1551
PSM	VFDKEGNGTVMGAELR	486	sp|P05976-2|MYL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=5668	35.375	2	1721.8407	1721.8407	R	H	94	110
PSM	VGRPSNIGQAQPIIDQLAEEAR	487	sp|Q9UHX1-4|PUF60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:267,22-UNIMOD:267	ms_run[2]:scan=9781	60.695	2	2381.2566	2381.2566	K	A	142	164
PSM	VIISAPSADAPMFVMGVNHEK	488	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9834	61.04	2	2212.102	2212.1020	R	Y	77	98
PSM	VIISAPSADAPMFVMGVNHEK	489	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	21-UNIMOD:188	ms_run[2]:scan=9852	61.158	2	2218.1222	2218.1222	R	Y	77	98
PSM	VLPSDLDLLLHMNNAR	490	sp|Q8WUY1|THEM6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	16-UNIMOD:267	ms_run[2]:scan=11467	71.779	2	1829.9697	1829.9697	R	Y	54	70
PSM	VNNFGSGLTALGLKPK	491	sp|O60488-2|ACSL4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=8409	51.922	2	1626.9496	1626.9496	R	N	94	110
PSM	VRLGDVISIQPCPDVK	492	sp|P55072|TERA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	12-UNIMOD:4	ms_run[2]:scan=8300	51.257	2	1794.9662	1794.9662	R	Y	94	110
PSM	YGGPPPDSVYSGQQPSVGTEIFVGKIPR	493	sp|O60506-4|HNRPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9691	60.105	3	2931.4767	2931.4767	K	D	144	172
PSM	YGGPPPDSVYSGVQPGIGTEVFVGKIPR	494	sp|O43390|HNRPR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=10234	63.629	3	2872.4759	2872.4759	K	D	147	175
PSM	CTVFHGAQVEDAFR	495	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=9299	57.59562	2	1618.7205	1618.7193	K	Y	1828	1842
PSM	AGGEAGVTLGQPHLSR	496	sp|Q2VIR3|IF2GL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0		ms_run[1]:scan=4877	30.728963333333336	2	1548.8012	1548.8003	M	Q	2	18
PSM	VWQLGSSSPNFTLEGHEK	497	sp|P35606|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	18-UNIMOD:188	ms_run[1]:scan=8480	52.36658	2	2023.003598	2020.994984	K	G	169	187
PSM	NSSYVHGGLDSNGKPADAVYGQK	498	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=4527	28.674995000000003	2	2364.092164	2363.114202	K	E	37	60
PSM	HGDNYLVLNLSEK	499	sp|Q68CZ2|TENS3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=7678	47.42276666666667	2	1500.759027	1500.757257	K	R	45	58
PSM	APVEHVVADAGAFLR	500	sp|Q9ULX3|NOB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	15-UNIMOD:267	ms_run[1]:scan=8725	53.90325833333334	2	1562.8302	1560.8282	M	H	2	17
PSM	TNVNGGAIALGHPLGGSGSR	501	sp|P42765|THIM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=5917	36.832045	2	1834.925608	1833.944558	K	I	341	361
PSM	KVPQVSTPTLVEVSR	502	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=6558	40.63004166666667	2	1638.929538	1638.930471	K	N	438	453
PSM	AALQELLSKGLIK	503	sp|P62851|RS25_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=10195	63.381	2	1382.8497	1382.8497	R	L	86	99
PSM	ACQSIYPLHDVFVR	504	sp|P61247|RS3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:4	ms_run[2]:scan=8706	53.786	2	1703.8454	1703.8454	K	K	200	214
PSM	AGGEAGVTLGQPHLSR	505	sp|Q2VIR3-2|IF2GL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=4895	30.835	2	1548.8009	1548.8009	M	Q	2	18
PSM	AHGLEVEPSALEQGFR	506	sp|Q9BSH5|HDHD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=8079	49.913	2	1738.8638	1738.8638	R	Q	35	51
PSM	AIIRENEFSFEDNAIR	507	sp|Q14839|CHD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=8319	51.377	2	1922.9486	1922.9486	R	G	814	830
PSM	ANIVHLMLSSPEQIQK	508	sp|P55060-4|XPO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=8926	55.182	2	1806.9662	1806.9662	K	Q	94	110
PSM	APMVNPTLGVHEADLLK	509	sp|Q13423|NNTM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=8497	52.478	2	1803.9553	1803.9553	R	T	130	147
PSM	ATAAFILANEHNVALFK	510	sp|O00410-2|IPO5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=10054	62.46	2	1828.9836	1828.9836	R	H	136	153
PSM	CIGKPGGSLDNSEQK	511	sp|Q9Y5L4|TIM13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:4,4-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=1920	13.727	2	1600.7918	1600.7918	K	C	50	65
PSM	CIGKPGGSLDNSEQK	512	sp|Q9Y5L4|TIM13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:4	ms_run[2]:scan=1926	13.764	2	1588.7515	1588.7515	K	C	50	65
PSM	EFPGFLENQKDPLAVDK	513	sp|P60903|S10AA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=9473	58.709	2	1945.9785	1945.9785	K	I	38	55
PSM	EFPGFLENQKDPLAVDK	514	sp|P60903|S10AA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=9623	59.679	2	1945.9785	1945.9785	K	I	38	55
PSM	EQQAQVEKEDFSDMVAEHAAK	515	sp|Q13435|SF3B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	8-UNIMOD:188,21-UNIMOD:188	ms_run[2]:scan=6347	39.371	2	2401.1259	2401.1259	R	Q	850	871
PSM	FAQHGTFEYEYSQR	516	sp|P23246-2|SFPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=5213	32.708	2	1761.7747	1761.7747	R	W	480	494
PSM	FCACPEEAAHALELR	517	sp|Q9NP81|SYSM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:4,4-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=8057	49.78	2	1782.8057	1782.8057	R	K	63	78
PSM	FGTVLTEHVAAAELGAR	518	sp|O43598-2|DNPH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	17-UNIMOD:267	ms_run[2]:scan=8142	50.293	3	1750.9242	1750.9242	R	G	49	66
PSM	FLSDPQVHTVLVER	519	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=7099	43.897	2	1638.873	1638.8730	K	S	68	82
PSM	FQNVADLHLYLYSAK	520	sp|P41250|GARS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	15-UNIMOD:188	ms_run[2]:scan=9789	60.749	2	1786.9349	1786.9349	K	A	365	380
PSM	FSPNSSNPIIVSCGWDKLVK	521	sp|P63244|RACK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	13-UNIMOD:4	ms_run[2]:scan=10200	63.41	2	2247.1358	2247.1358	R	V	156	176
PSM	GAGTNEDALIEILTTR	522	sp|P12429|ANXA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	16-UNIMOD:267	ms_run[2]:scan=12216	76.846	2	1682.8714	1682.8714	K	T	105	121
PSM	GFGFVTFDDHDPVDK	523	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	15-UNIMOD:188	ms_run[2]:scan=9228	57.151	2	1700.7778	1700.7778	R	I	142	157
PSM	GFGFVTFDDHDPVDK	524	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=9234	57.191	2	1694.7577	1694.7577	R	I	142	157
PSM	GGPPFAFVEFEDPRDAEDAVYGR	525	sp|Q07955|SRSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	14-UNIMOD:267,23-UNIMOD:267	ms_run[2]:scan=11686	73.261	3	2560.1774	2560.1774	R	D	52	75
PSM	GILADEDSSRPVWLK	526	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=8283	51.156	2	1684.8784	1684.8784	K	A	1430	1445
PSM	GLAPDLPEDLYHLIK	527	sp|P62277|RS13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=12200	76.742	2	1692.9087	1692.9087	K	K	79	94
PSM	GLGHQVATDALVAMEK	528	sp|Q9Y3I0|RTCB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=7795	48.148	2	1638.8399	1638.8399	R	A	264	280
PSM	GLPCTELFVAPVGVASKR	529	sp|O00515|LAD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	4-UNIMOD:4	ms_run[2]:scan=9452	58.579	2	1900.0241	1900.0241	R	H	425	443
PSM	GSVISPTELEAPILVPHTAQR	530	sp|Q8N1B4-2|VPS52_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	21-UNIMOD:267	ms_run[2]:scan=9912	61.541	2	2224.2091	2224.2091	R	G	226	247
PSM	GYGFVHFETQEAAER	531	sp|P11940-2|PABP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	15-UNIMOD:267	ms_run[2]:scan=7030	43.491	2	1749.7986	1749.7986	K	A	139	154
PSM	HGAEVIDTPVFELK	532	sp|P12081-4|HARS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	14-UNIMOD:188	ms_run[2]:scan=8675	53.591	2	1559.8291	1559.8291	R	E	87	101
PSM	HGNPEEEEWLTAER	533	sp|Q93008-1|USP9X_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=6097	37.899	2	1695.7489	1695.7489	R	M	372	386
PSM	HGQQWCEVQSQVDQK	534	sp|Q9BZM4|ULBP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:4	ms_run[2]:scan=4415	27.98	2	1855.8271	1855.8271	R	N	46	61
PSM	HLLNQAVGEEEVPK	535	sp|Q9H0G5|NSRP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	14-UNIMOD:188	ms_run[2]:scan=5029	31.625	2	1567.8301	1567.8301	R	C	186	200
PSM	HLSSCAAPAPLTSAER	536	sp|Q6IBS0|TWF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	5-UNIMOD:4	ms_run[2]:scan=3866	24.863	2	1666.8097	1666.8097	K	E	137	153
PSM	HPSAVTACNLDLENLVTDSNR	537	sp|Q9Y678|COPG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	8-UNIMOD:4,21-UNIMOD:267	ms_run[2]:scan=9273	57.438	2	2335.1102	2335.1102	K	S	318	339
PSM	HQSFVLVGETGSGK	538	sp|O43143|DHX15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	14-UNIMOD:188	ms_run[2]:scan=5037	31.673	2	1450.7512	1450.7512	R	T	153	167
PSM	IAAAGLDVTSPEPLPTNHPLLTLK	539	sp|Q9UBQ7|GRHPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	24-UNIMOD:188	ms_run[2]:scan=10098	62.751	2	2473.3888	2473.3888	K	N	263	287
PSM	IAVHPDYQGMGYGSR	540	sp|Q9H0A0-2|NAT10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	15-UNIMOD:267	ms_run[2]:scan=5239	32.859	2	1659.7703	1659.7703	R	A	557	572
PSM	IGGDAATTVNNSTPDFGFGGQKR	541	sp|Q92945|FUBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=6950	43.028	2	2309.1036	2309.1036	K	Q	88	111
PSM	IILDLISESPIKGR	542	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=9969	61.914	2	1552.9188	1552.9188	K	A	184	198
PSM	ILLAELEQLKGQGK	543	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=8660	53.495	2	1538.9032	1538.9032	K	S	130	144
PSM	INSGGKLPNFGFVVFDDSEPVQK	544	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=11336	70.896	3	2493.254	2493.2540	R	V	371	394
PSM	IVAPGKGILAADESTGSIAK	545	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=6522	40.41	3	1897.052	1897.0520	R	R	23	43
PSM	IVSGIITPIHEQWEK	546	sp|Q92530|PSMF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	15-UNIMOD:188	ms_run[2]:scan=8054	49.762	2	1754.9662	1754.9662	R	A	134	149
PSM	KALDIAENEMPGLMR	547	sp|P23526|SAHH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=8310	51.319	2	1686.8433	1686.8433	R	M	20	35
PSM	KASGPPVSELITK	548	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=5217	32.735	2	1337.7957	1337.7957	R	A	34	47
PSM	KFLDGNEMTLADCNLLPK	549	sp|Q9Y696|CLIC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:188,8-UNIMOD:35,13-UNIMOD:4,18-UNIMOD:188	ms_run[2]:scan=8831	54.578	2	2106.0528	2106.0528	R	L	177	195
PSM	KISEIEDAAFLAR	550	sp|O94905|ERLN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=7744	47.82	2	1461.7827	1461.7827	K	E	241	254
PSM	KLEPIWNEVGLEMK	551	sp|Q96JJ7-2|TMX3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=10514	65.429	2	1684.8858	1684.8858	K	S	58	72
PSM	KLETAVNLAWTAGNSNTR	552	sp|P21796|VDAC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:188,18-UNIMOD:267	ms_run[2]:scan=7409	45.794	2	1961.0301	1957.0420	K	F	201	219
PSM	KVESLQEEIAFLK	553	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=9572	59.342	2	1544.8853	1544.8853	R	K	223	236
PSM	LCSGVLGTVVHGK	554	sp|Q9Y6C9|MTCH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:4	ms_run[2]:scan=5804	36.181	2	1325.7126	1325.7126	R	V	78	91
PSM	LFQEDPEAFLLYHR	555	sp|O43159|RRP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=10714	66.741	2	1776.8835	1776.8835	R	G	269	283
PSM	LFQEDPEAFLLYHR	556	sp|O43159|RRP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	14-UNIMOD:267	ms_run[2]:scan=10725	66.821	2	1786.8918	1786.8918	R	G	269	283
PSM	LHDNLIISDLENTVK	557	sp|Q69YQ0-2|CYTSA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=10378	64.551	2	1722.9152	1722.9152	K	K	705	720
PSM	LLGQFSEKELAAEK	558	sp|P53004|BIEA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	8-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=6603	40.896	2	1573.8754	1573.8754	K	K	262	276
PSM	LQDFKLDFGNSQGK	559	sp|O75223-2|GGCT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=7581	46.811	2	1595.7944	1595.7944	R	T	46	60
PSM	LQELPDAVPHGEMPR	560	sp|P33992|MCM5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	15-UNIMOD:267	ms_run[2]:scan=6516	40.373	2	1697.8435	1697.8435	K	H	229	244
PSM	LVKPGNQNTQVTEAWNK	561	sp|Q9UQ80|PA2G4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=4732	29.849	2	1925.9959	1925.9959	R	V	156	173
PSM	LVKPGNQNTQVTEAWNK	562	sp|Q9UQ80|PA2G4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=4740	29.898	2	1938.0362	1938.0362	R	V	156	173
PSM	LVNLKELADEALQK	563	sp|Q9NR19|ACSA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	5-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=10645	66.291	2	1594.9333	1594.9333	K	C	223	237
PSM	LVNLKELADEALQK	564	sp|Q9NR19|ACSA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=10653	66.343	2	1582.893	1582.8930	K	C	223	237
PSM	LWAHVYAGAPVSSPEYTK	565	sp|P61086-2|UBE2K_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=7102	43.919	2	1974.984	1974.9840	R	K	96	114
PSM	LYDLNHNEIGELIR	566	sp|O75643|U520_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	14-UNIMOD:267	ms_run[2]:scan=9296	57.58	2	1707.882	1707.8820	R	M	1153	1167
PSM	LYHVSDSEGNLVVR	567	sp|P09327|VILI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=5911	36.801	2	1586.8053	1586.8053	K	E	255	269
PSM	NAAGALDLLKELK	568	sp|P23193|TCEA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=10312	64.133	2	1354.782	1354.7820	K	N	20	33
PSM	NACDHLSGFNVCNR	569	sp|Q9Y3B4|SF3B6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:4,12-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=5203	32.653	2	1672.7074	1672.7074	K	Y	72	86
PSM	NACDHLSGFNVCNR	570	sp|Q9Y3B4|SF3B6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=5206	32.668	2	1662.6991	1662.6991	K	Y	72	86
PSM	PNIVLFSGSSHQDLSQR	571	sp|P11908|PRPS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=7196	44.493	3	1883.949	1883.9490	M	V	2	19
PSM	RADLNQGIGEPQSPSR	572	sp|Q96C19|EFHD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=3361	21.952	2	1723.8602	1723.8602	R	R	62	78
PSM	SKGYAFIEFASFEDAK	573	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=10594	65.955	2	1820.9024	1820.9024	K	E	522	538
PSM	SKLTFSCLGGSDNFK	574	sp|Q15185-3|TEBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:188,7-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=7192	44.473	2	1671.8329	1671.8329	K	H	34	49
PSM	SLESLHSFVAAATK	575	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	14-UNIMOD:188	ms_run[2]:scan=8550	52.812	2	1465.7872	1465.7872	R	E	582	596
PSM	SLHDALCVLAQTVK	576	sp|P78371-2|TCPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	7-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=10688	66.571	2	1559.8437	1559.8437	R	D	342	356
PSM	SPVGSGAPQAAAPAPAAHVAGNPGGDAAPAATGTAAAASLATAAGSEDAEKK	577	sp|P16989-2|YBOX3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=7447	46.017	4	4506.2011	4506.2011	K	V	34	86
PSM	TLSHPQQMALLDQTK	578	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	15-UNIMOD:188	ms_run[2]:scan=5897	36.716	2	1715.8972	1715.8972	K	T	1752	1767
PSM	TLSHPQQMALLDQTK	579	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=5903	36.753	2	1709.8771	1709.8771	K	T	1752	1767
PSM	TNVNGGAIALGHPLGGSGSR	580	sp|P42765|THIM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=5581	34.86	2	1833.9446	1833.9446	K	I	341	361
PSM	TPGNNLHEVETAQGQR	581	sp|Q8N9N8|EIF1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	16-UNIMOD:267	ms_run[2]:scan=3002	19.892	2	1759.8477	1759.8477	R	F	33	49
PSM	VAPEEHPVLLTEAPLNPK	582	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=7428	45.905	2	1953.0571	1953.0571	R	A	96	114
PSM	VFIGNLNTLVVKK	583	sp|P07910-4|HNRPC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=8415	51.96	2	1443.8813	1443.8813	R	S	18	31
PSM	VLPEFDTPGHTLSWGK	584	sp|P07686|HEXB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	16-UNIMOD:188	ms_run[2]:scan=9038	55.873	2	1788.9142	1788.9142	R	G	285	301
PSM	VLVDGEEHVGFLK	585	sp|Q9NPA0|EMC7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	13-UNIMOD:188	ms_run[2]:scan=7188	44.446	2	1446.7814	1446.7814	R	T	67	80
PSM	VLVVHDGFEGLAK	586	sp|P08237-2|PFKAM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=7041	43.553	2	1382.7558	1382.7558	R	G	402	415
PSM	VQAQGHTLQVAGLR	587	sp|Q8IZ83|A16A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=4755	29.98	2	1476.8161	1476.8161	R	G	638	652
PSM	VTNRDIICQIAYAR	588	sp|P46777|RL5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	8-UNIMOD:4	ms_run[2]:scan=7542	46.578	2	1691.8777	1691.8777	R	I	55	69
PSM	YKDGVVTIGCVGFPNVGK	589	sp|P36915|GNL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:188,10-UNIMOD:4,18-UNIMOD:188	ms_run[2]:scan=8727	53.915	3	1921.017	1921.0170	R	S	356	374
PSM	YKWCEYGLTFTEK	590	sp|P45880-2|VDAC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	4-UNIMOD:4	ms_run[2]:scan=8780	54.253	2	1723.7916	1723.7916	K	W	62	75
PSM	YNFHGTAEQDLPFCK	591	sp|P41240|CSK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	14-UNIMOD:4	ms_run[2]:scan=7375	45.586	2	1825.8094	1825.8094	K	G	18	33
PSM	CTVFHGAQVEDAFR	592	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:385,1-UNIMOD:4,14-UNIMOD:267	ms_run[1]:scan=9289	57.535246666666666	2	1628.7290	1628.7276	K	Y	1828	1842
PSM	QATINIGTIGHVAHGK	593	sp|Q2VIR3|IF2GL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:28	ms_run[1]:scan=7087	43.82507833333333	2	1598.8516	1598.8524	R	S	39	55
PSM	QHADHLALNEEIVNR	594	sp|Q9UPN3-2|MACF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:28,15-UNIMOD:267	ms_run[1]:scan=6115	38.001325	2	1752.8662	1750.8622	R	K	3534	3549
PSM	QFNYTHICAGASAFGK	595	sp|P13804|ETFA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:28,8-UNIMOD:4,16-UNIMOD:188	ms_run[1]:scan=9093	56.238533333333336	2	1759.8077	1759.8078	K	N	102	118
PSM	FSGFGSGAGGKPLEGLSNGNNITSAPPFASAK	596	sp|Q9UKX7|NUP50_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=9736	60.39628666666667	3	3037.479233	3036.494114	R	A	73	105
PSM	ACQSIYPLHDVFVR	597	sp|P61247|RS3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=8704	53.775	2	1713.8536	1713.8536	K	K	200	214
PSM	AFHNEAQVNPER	598	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=2099	14.743	2	1410.664	1410.6640	R	K	469	481
PSM	AGAGAPVVGSGSSGGGNAFTGLGPVSTLPSLHGK	599	sp|Q9NNW5|WDR6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	34-UNIMOD:188	ms_run[2]:scan=9649	59.845	3	2969.5302	2969.5302	R	Q	536	570
PSM	AGDRQPEWLEEQQGR	600	sp|Q14980-2|NUMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=5022	31.583	2	1797.8394	1797.8394	R	Q	944	959
PSM	AGKEESGVSVSNSQPTNESHSIK	601	sp|Q99808|S29A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=2323	16	3	2371.1252	2371.1252	R	A	261	284
PSM	AHSNPDFLPVDNCLQSVLGQR	602	sp|Q5VSL9-2|STRP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:4	ms_run[2]:scan=10987	68.568	3	2366.1437	2366.1437	R	V	691	712
PSM	ALEQLNGFELAGRPMK	603	sp|Q14498-3|RBM39_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=8421	51.992	2	1772.9243	1772.9243	K	V	285	301
PSM	ALSRQEMQEVQSSR	604	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	4-UNIMOD:267,14-UNIMOD:267	ms_run[2]:scan=3320	21.722	2	1667.8164	1667.8164	K	S	175	189
PSM	APDVEGQGLDWSLKIPK	605	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	14-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=9472	58.703	3	1864.0133	1864.0133	K	M	1112	1129
PSM	ARDDLITDLLNEAK	606	sp|P36543-2|VATE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=11610	72.75	2	1585.8312	1585.8312	R	Q	64	78
PSM	ARQEELYSELQAR	607	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:267,13-UNIMOD:267	ms_run[2]:scan=5641	35.215	2	1611.812	1611.8120	R	E	3187	3200
PSM	ARQEELYSELQAR	608	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=5643	35.226	2	1591.7954	1591.7954	R	E	3187	3200
PSM	ATAAFILANEHNVALFK	609	sp|O00410-2|IPO5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	17-UNIMOD:188	ms_run[2]:scan=10052	62.448	2	1835.0037	1835.0037	R	H	136	153
PSM	ATAEEMTKYHSDEYIK	610	sp|Q92769-3|HDAC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=4472	28.332	2	1914.8669	1914.8669	K	F	30	46
PSM	AVQALCAVYEHWVPR	611	sp|O60701-3|UGDH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:4	ms_run[2]:scan=10330	64.248	3	1797.8985	1797.8985	R	E	94	109
PSM	CGFCHVGEEENEAR	612	sp|Q8IWS0-4|PHF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:4,4-UNIMOD:4	ms_run[2]:scan=3140	20.678	2	1692.6621	1692.6621	K	G	211	225
PSM	CQHAAEIITDLLR	613	sp|Q96AE4|FUBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=10223	63.561	2	1548.7958	1548.7958	R	S	332	345
PSM	DFNHINVELSLLGK	614	sp|P32969|RL9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	14-UNIMOD:188	ms_run[2]:scan=10646	66.297	2	1603.8665	1603.8665	R	K	37	51
PSM	EHAPSIIFMDEIDSIGSSR	615	sp|P62195-2|PRS8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	19-UNIMOD:267	ms_run[2]:scan=11643	72.968	3	2113.0025	2113.0025	R	L	232	251
PSM	FCSLPEKGTLTEAFPVLGGK	616	sp|P29144|TPP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:4	ms_run[2]:scan=10486	65.254	2	2150.1082	2150.1082	K	A	709	729
PSM	FCSLPEKGTLTEAFPVLGGK	617	sp|P29144|TPP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:4	ms_run[2]:scan=10490	65.283	3	2150.1082	2150.1082	K	A	709	729
PSM	FLSDPQVHTVLVER	618	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	14-UNIMOD:267	ms_run[2]:scan=7113	43.986	2	1648.8812	1648.8812	K	S	68	82
PSM	FLTAVNLEHPEMLEK	619	sp|Q9Y2Q3-4|GSTK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=8985	55.53	2	1769.9022	1769.9022	R	A	59	74
PSM	GEVFSVLEFAPSNHSFK	620	sp|Q9C0C9|UBE2O_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	17-UNIMOD:188	ms_run[2]:scan=10931	68.198	2	1899.9462	1899.9462	K	K	926	943
PSM	GFCFITFKEEEPVK	621	sp|Q14103-4|HNRPD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:4	ms_run[2]:scan=9490	58.815	2	1729.8385	1729.8385	R	K	205	219
PSM	GLKASEWVQQVSGLMDGK	622	sp|P49588|SYAC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=11425	71.496	2	1931.9775	1931.9775	R	G	913	931
PSM	GPWALEEESLVGREPEER	623	sp|O00515|LAD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=8696	53.724	2	2082.0018	2082.0018	R	K	152	170
PSM	GQMQKPFEDASFALR	624	sp|Q13526|PIN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7977	49.28	2	1723.8352	1723.8352	R	T	128	143
PSM	GSVISPTELEAPILVPHTAQR	625	sp|Q8N1B4-2|VPS52_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9914	61.558	2	2214.2008	2214.2008	R	G	226	247
PSM	GYAFNHSADFETVR	626	sp|P61160|ARP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=6165	38.285	2	1612.727	1612.7270	R	M	201	215
PSM	GYAFNHSADFETVR	627	sp|P61160|ARP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	14-UNIMOD:267	ms_run[2]:scan=6160	38.255	2	1622.7353	1622.7353	R	M	201	215
PSM	HGDGTTLDIMLK	628	sp|P55786-2|PSA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:188	ms_run[2]:scan=6979	43.2	2	1305.6694	1305.6694	K	L	674	686
PSM	HGDGTTLDIMLK	629	sp|P55786-2|PSA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=6981	43.21	2	1299.6493	1299.6493	K	L	674	686
PSM	HGFSGIPITETGTMGSK	630	sp|P20839-2|IMDH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=6785	41.972	2	1718.8298	1718.8298	R	L	112	129
PSM	HGSYEDAVHSGALND	631	sp|P17987|TCPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=3957	25.369	2	1570.6648	1570.6648	K	-	542	557
PSM	IAVAHNGELVNAAR	632	sp|Q06203|PUR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	14-UNIMOD:267	ms_run[2]:scan=3935	25.252	2	1443.7822	1443.7822	K	L	117	131
PSM	ICGDIHGQYYDLLR	633	sp|P62136|PP1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=8020	49.55	2	1731.8278	1731.8278	K	L	61	75
PSM	IFQKGESPVDYDGGR	634	sp|Q15084-3|PDIA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=4774	30.085	2	1666.7951	1666.7951	K	T	239	254
PSM	IGITNHDEYSLVR	635	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:267	ms_run[2]:scan=6167	38.295	2	1525.7764	1525.7764	R	E	119	132
PSM	KASGPPVSELITK	636	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=5208	32.683	2	1325.7555	1325.7555	R	A	34	47
PSM	KATGPPVSELITK	637	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=5255	32.956	2	1351.8114	1351.8114	R	A	37	50
PSM	KEDSISEFLSLAR	638	sp|Q9BRR8|GPTC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=10740	66.919	2	1493.7726	1493.7726	K	S	692	705
PSM	KIFVGGLSPDTPEEK	639	sp|Q14103-4|HNRPD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=6032	37.523	2	1615.8457	1615.8457	K	I	164	179
PSM	KISLEDIQAFEK	640	sp|Q8WXX5|DNJC9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=8435	52.08	2	1431.8012	1431.8012	K	T	107	119
PSM	KISLEDIQAFEK	641	sp|Q8WXX5|DNJC9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=8437	52.092	2	1419.7609	1419.7609	K	T	107	119
PSM	KLASLTPGFSGADVANVCNEAALIAAR	642	sp|Q9Y4W6|AFG32_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	18-UNIMOD:4	ms_run[2]:scan=10891	67.933	3	2715.4014	2715.4014	R	H	508	535
PSM	LAELLTQQHGLQCR	643	sp|Q9H6R4-2|NOL6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=6039	37.565	2	1675.8703	1675.8703	R	A	765	779
PSM	LAILGIHNEVSK	644	sp|P12814-2|ACTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:188	ms_run[2]:scan=6614	40.954	2	1298.7654	1298.7654	R	I	566	578
PSM	LAILGIHNEVSK	645	sp|P12814-2|ACTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=6621	40.994	2	1292.7452	1292.7452	R	I	566	578
PSM	LFQECCPHSTDR	646	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	5-UNIMOD:4,6-UNIMOD:4	ms_run[2]:scan=2880	19.185	2	1548.6449	1548.6449	K	V	156	168
PSM	LKEGDTIIVPGVEGPIVTQIR	647	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=10062	62.512	2	2233.2682	2233.2682	R	G	882	903
PSM	LKTALLDISCVK	648	sp|O60488-2|ACSL4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:188,10-UNIMOD:4,12-UNIMOD:188	ms_run[2]:scan=7618	47.049	2	1371.8198	1371.8198	K	H	171	183
PSM	LLDSVPPTAISHFK	649	sp|Q9NR30-2|DDX21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7492	46.273	2	1523.8348	1523.8348	R	Q	514	528
PSM	LLQALAQYQNHLQEQPR	650	sp|Q9BQG0|MBB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7692	47.501	3	2049.0756	2049.0756	K	K	162	179
PSM	LLSRPQDALEGVVLSPSLEAR	651	sp|Q9NVI7-2|ATD3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	4-UNIMOD:267,21-UNIMOD:267	ms_run[2]:scan=10124	62.919	2	2269.2545	2269.2545	R	V	307	328
PSM	LPGGELNPGEDEVEGLKR	652	sp|O43809|CPSF5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=6594	40.843	3	1907.9589	1907.9589	K	L	106	124
PSM	LTRDDVIQICGPADGIR	653	sp|Q12800-2|TFCP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:267,10-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=7360	45.49	2	1917.9845	1917.9845	K	L	309	326
PSM	LYDLNHNEIGELIR	654	sp|O75643|U520_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9297	57.585	2	1697.8737	1697.8737	R	M	1153	1167
PSM	MMANGILKVPAINVNDSVTK	655	sp|P23526|SAHH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:35	ms_run[2]:scan=8744	54.024	2	2130.1177	2130.1177	K	S	167	187
PSM	MMANGILKVPAINVNDSVTK	656	sp|P23526|SAHH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:35,8-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=8768	54.172	2	2142.158	2142.1580	K	S	167	187
PSM	NCLTNFHGMDLTR	657	sp|P61247|RS3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=7427	45.899	2	1587.7161	1587.7162	K	D	95	108
PSM	NDKESEAQISWFAPEDHGYGTEVSTK	658	sp|Q9H2U1|DHX36_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:188,26-UNIMOD:188	ms_run[2]:scan=8184	50.557	3	2936.3503	2936.3503	K	N	106	132
PSM	NFNKDGDLVDWWTQQSASNFK	659	sp|P08473|NEP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=11412	71.413	3	2499.1455	2499.1455	R	E	596	617
PSM	NHQNLLDSLEQYVK	660	sp|Q93008-1|USP9X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=11140	69.58	2	1699.8529	1699.8529	R	G	1746	1760
PSM	NLPSNPLEFNPDVLKK	661	sp|A0FGR8-6|ESYT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	15-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=9547	59.176	2	1836.0184	1836.0184	R	T	547	563
PSM	NLQAHYEDFLQDSR	662	sp|Q9UPN3-4|MACF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7609	46.989	2	1734.7962	1734.7962	K	D	992	1006
PSM	NPELSTQLIDIIHTAAAR	663	sp|Q9NXF1-2|TEX10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	18-UNIMOD:267	ms_run[2]:scan=12253	77.089	2	1972.0617	1972.0617	R	A	569	587
PSM	REFQLDLDEIENDNGTVR	664	sp|Q14008-2|CKAP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9170	56.777	3	2162.024	2162.0240	R	C	1482	1500
PSM	REFQLDLDEIENDNGTVR	665	sp|Q14008-2|CKAP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9172	56.789	2	2162.024	2162.0240	R	C	1482	1500
PSM	RLDECEEAFQGTK	666	sp|P61289|PSME3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	5-UNIMOD:4	ms_run[2]:scan=3855	24.803	2	1581.7093	1581.7093	R	V	88	101
PSM	RLEESDVLQEAR	667	sp|O43615|TIM44_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:267,12-UNIMOD:267	ms_run[2]:scan=4976	31.314	2	1463.7483	1463.7483	R	R	90	102
PSM	RLTQNADCVVVLDNTALNR	668	sp|Q9NRH3|TBG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	8-UNIMOD:4	ms_run[2]:scan=7373	45.574	2	2171.1117	2171.1117	K	I	194	213
PSM	RSENEEFVEVGR	669	sp|P10644-2|KAP0_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:267,12-UNIMOD:267	ms_run[2]:scan=4101	26.218	2	1469.7014	1469.7014	R	L	306	318
PSM	RSENEEFVEVGR	670	sp|P10644-2|KAP0_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=4105	26.242	2	1449.6848	1449.6848	R	L	306	318
PSM	SDSFENPVLQQHFR	671	sp|P12956|XRCC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7321	45.251	2	1702.8063	1702.8063	R	N	475	489
PSM	SFTETMSSLSPGKPWQTK	672	sp|Q9HB07|MYG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=8193	50.612	2	2010.9721	2010.9721	R	L	111	129
PSM	SHIAEGPADLEDPFNPK	673	sp|Q9NUL7|DDX28_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7842	48.441	2	1835.869	1835.8690	K	A	307	324
PSM	SKLTFSCLGGSDNFK	674	sp|Q15185-3|TEBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:4	ms_run[2]:scan=7184	44.423	2	1659.7927	1659.7927	K	H	34	49
PSM	SLQSLEASLHAMESTR	675	sp|Q9UQE7|SMC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=10331	64.254	2	1758.857	1758.8570	R	E	759	775
PSM	SLVEIIEHGLVDEQQK	676	sp|O75533|SF3B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	16-UNIMOD:188	ms_run[2]:scan=11827	74.208	2	1841.983	1841.9830	R	V	685	701
PSM	SNPFAHLAEPLDPVQPGKK	677	sp|P21399|ACOC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:1,18-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=9971	61.926	2	2098.125	2098.1250	M	F	2	21
PSM	SQEGRPVQVIGALIGK	678	sp|Q7L5N1|CSN6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=8952	55.339	2	1650.9417	1650.9417	R	Q	60	76
PSM	SSEPPPPPQPPTHQASVGLLDTPR	679	sp|Q9Y2V2|CHSP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:1	ms_run[2]:scan=7399	45.736	2	2546.2765	2546.2765	M	S	2	26
PSM	SYDVPPPPMEPDHPFYSNISK	680	sp|Q8N0Y7|PGAM4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	21-UNIMOD:188	ms_run[2]:scan=8226	50.804	2	2422.1247	2422.1247	R	D	118	139
PSM	TAGYPNVNIHNFTTSWR	681	sp|Q01082-3|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	17-UNIMOD:267	ms_run[2]:scan=9226	57.139	2	1986.9576	1986.9576	K	D	174	191
PSM	TAGYPNVNIHNFTTSWR	682	sp|Q01082-3|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9219	57.092	2	1976.9493	1976.9493	K	D	174	191
PSM	TCFVDCLIEQTHPEIR	683	sp|Q15029-2|U5S1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:4,6-UNIMOD:4	ms_run[2]:scan=10216	63.514	2	2016.9397	2016.9397	K	K	108	124
PSM	THGSEIINDLQGR	684	sp|O75116|ROCK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=5467	34.196	2	1438.7165	1438.7165	R	I	635	648
PSM	TKADFFEDENGQR	685	sp|O95573|ACSL3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=4339	27.565	2	1555.6903	1555.6903	K	W	546	559
PSM	TPEIVAPQSAHAAFNK	686	sp|O95470|SGPL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	16-UNIMOD:188	ms_run[2]:scan=5323	33.355	2	1685.8832	1685.8832	K	A	232	248
PSM	TQQVIHIIDFGLAK	687	sp|Q9Y6M4-6|KC1G3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	14-UNIMOD:188	ms_run[2]:scan=9966	61.892	2	1587.908	1587.9080	K	E	64	78
PSM	VAPEEHPVLLTEAPLNPK	688	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	18-UNIMOD:188	ms_run[2]:scan=7461	46.103	2	1959.0773	1959.0773	R	A	96	114
PSM	VDINAPDVGVQGPDWHLK	689	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	18-UNIMOD:188	ms_run[2]:scan=8632	53.328	2	1965.0052	1965.0052	K	M	2620	2638
PSM	VFIGNLNTLVVKK	690	sp|P07910-4|HNRPC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=8416	51.965	2	1455.9216	1455.9216	R	S	18	31
PSM	VKEEIIEAFVQELR	691	sp|P50552|VASP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=12301	77.42	2	1701.9301	1701.9301	K	K	362	376
PSM	VKEGMNIVEAMER	692	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7328	45.292	2	1504.7378	1504.7378	K	F	132	145
PSM	VRVEALQSGGGQER	693	sp|Q9Y697-2|NFS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=2753	18.45	2	1484.7696	1484.7696	R	G	216	230
PSM	VVDLMAHMASKE	694	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=6128	38.076	2	1329.6421	1329.6421	R	-	282	294
PSM	VVVHKETELAEEGED	695	sp|O43491-2|E41L2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	5-UNIMOD:188	ms_run[2]:scan=3099	20.448	2	1688.82	1688.8200	R	-	659	674
PSM	YEAVGSVHQAWEAIR	696	sp|Q9BV20-2|MTNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7754	47.882	2	1714.8427	1714.8427	R	A	27	42
PSM	CLLLCHPGPCPPCPK	697	sp|Q6ZNB6|NFXL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:385,1-UNIMOD:4,5-UNIMOD:4,10-UNIMOD:4,13-UNIMOD:4,15-UNIMOD:188	ms_run[1]:scan=8987	55.54248333333334	2	1793.8143	1793.8176	K	M	269	284
PSM	LYGEFADPFKLAECK	698	sp|O75694|NU155_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	14-UNIMOD:4	ms_run[1]:scan=10355	64.40920833333334	2	1787.866146	1786.860008	K	L	1188	1203
PSM	AASDIAMTELPPTHPIR	699	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=6932	42.913826666666665	2	1820.938808	1818.929819	K	L	154	171
PSM	KVPQVSTPTLVEVSR	700	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=6394	39.639583333333334	3	1638.930122	1638.930471	K	N	438	453
PSM	QQSHFAMMHGGTGFAGIDSSSPEVK	701	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:28,7-UNIMOD:35,25-UNIMOD:188	ms_run[1]:scan=7151	44.22058833333334	3	2610.1559	2610.1569	R	G	244	269
PSM	NNRQPYAVSELAGHQTSAESWGTGR	702	sp|P36578|RL4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=7255	44.861106666666664	3	2716.258025	2715.274953	K	A	47	72
PSM	EFSGHQGQINDMAFSPDGR	703	sp|Q8NI36|WDR36_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=6478	40.142225	2	2091.946075	2091.906852	R	W	617	636
PSM	NLLKEPENCNNFCLWK	704	sp|Q9H7Z3|NRDE2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	4-UNIMOD:188,9-UNIMOD:4,13-UNIMOD:4,16-UNIMOD:188	ms_run[1]:scan=9176	56.81280666666667	2	2091.002867	2090.011625	K	Q	769	785
PSM	AGGEAGVTLGQPHLSR	705	sp|Q2VIR3-2|IF2GL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	16-UNIMOD:267	ms_run[2]:scan=4887	30.787	2	1558.8091	1558.8091	M	Q	2	18
PSM	AGRSEAVVEYVFSGSR	706	sp|Q7KZF4|SND1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8059	49.791	2	1712.8482	1712.8482	R	L	524	540
PSM	AHNNELEPTPGNTLR	707	sp|P24928|RPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=3819	24.595	2	1661.8121	1661.8121	K	Q	720	735
PSM	AQIHDLVLVGGSTR	708	sp|P0DMV8-2|HS71A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6362	39.462	2	1464.8049	1464.8049	K	I	274	288
PSM	ARSDEGQLSPATR	709	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:267,13-UNIMOD:267	ms_run[2]:scan=1319	10.361	2	1406.7017	1406.7017	R	G	543	556
PSM	ASCLPAMLLDPPPGSHVIDACAAPGNK	710	sp|Q96P11-3|NSUN5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:4,21-UNIMOD:4	ms_run[2]:scan=10189	63.342	3	2758.3241	2758.3241	R	T	157	184
PSM	ASVITQVFHVPLEER	711	sp|Q00341-2|VIGLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	15-UNIMOD:267	ms_run[2]:scan=10225	63.572	2	1733.934	1733.9340	K	K	109	124
PSM	DGQWFTDWDAVPHSR	712	sp|Q08J23-3|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10144	63.046	2	1815.7965	1815.7965	K	H	134	149
PSM	DITLFHAMDTLQR	713	sp|O94776-2|MTA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:267	ms_run[2]:scan=10341	64.317	2	1569.7849	1569.7849	R	N	55	68
PSM	DLSSHQLNEFLAQTLQR	714	sp|P09960-4|LKHA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	17-UNIMOD:267	ms_run[2]:scan=11339	70.915	2	2009.0206	2009.0206	K	A	470	487
PSM	DVEHYVGSDKEIDVIDVTR	715	sp|Q9UPP1-5|PHF8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=7825	48.335	3	2188.0648	2188.0648	R	Q	146	165
PSM	EFESVLVDAFSHVAR	716	sp|Q9NQG5|RPR1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	15-UNIMOD:267	ms_run[2]:scan=12223	76.892	2	1714.8554	1714.8554	R	E	80	95
PSM	EFPGFLENQKDPLAVDK	717	sp|P60903|S10AA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	10-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=9460	58.628	2	1958.0188	1958.0188	K	I	38	55
PSM	EHAPSIIFMDEIDSIGSSR	718	sp|P62195-2|PRS8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	19-UNIMOD:267	ms_run[2]:scan=11651	73.023	2	2113.0025	2113.0025	R	L	232	251
PSM	EIRPALELLEPIEQK	719	sp|P50395-2|GDIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10229	63.6	2	1776.9986	1776.9985	K	F	320	335
PSM	ELNHMLSDTGNR	720	sp|Q96FQ6|S10AG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=3579	23.207	2	1385.6358	1385.6358	K	K	45	57
PSM	ELQHAALGGTATR	721	sp|O14828-2|SCAM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=2287	15.793	2	1323.6895	1323.6895	R	Q	93	106
PSM	EYFSWEGAFQHVGK	722	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:188	ms_run[2]:scan=9981	61.991	2	1689.7883	1689.7883	R	A	415	429
PSM	FEDHEGLPTVVK	723	sp|P49589-2|SYCC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5497	34.37	2	1369.6878	1369.6878	R	L	629	641
PSM	FGAVWTGDNTAEWDHLK	724	sp|Q14697|GANAB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9322	57.747	3	1945.8959	1945.8959	R	I	611	628
PSM	FQQVPTDALANKLFGAPEPSTIAR	725	sp|Q6PKG0-3|LARP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10633	66.21	2	2570.3493	2570.3493	R	S	665	689
PSM	GAQERLPTVPLSGMYNK	726	sp|O14562|UBFD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=7725	47.702	2	1859.9564	1859.9564	K	S	208	225
PSM	GGPPFAFVEFEDPRDAEDAVYGR	727	sp|Q07955|SRSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=11642	72.962	3	2540.1608	2540.1608	R	D	52	75
PSM	GIDRYNPENLATLER	728	sp|Q9UBQ5-2|EIF3K_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	4-UNIMOD:267,15-UNIMOD:267	ms_run[2]:scan=7443	45.998	2	1779.9018	1779.9018	K	Y	17	32
PSM	GIRDDIEEEDDQEAYFR	729	sp|Q86XP3-2|DDX42_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=7508	46.37	3	2098.908	2098.9080	K	Y	27	44
PSM	GVIALCIEDGSIHR	730	sp|P31040-2|SDHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	6-UNIMOD:4	ms_run[2]:scan=7718	47.658	2	1538.7875	1538.7875	R	I	185	199
PSM	GYFEYIEENKYSR	731	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=7470	46.154	2	1696.7733	1696.7733	R	A	237	250
PSM	GYNPGLLVHPDLAYLQAEGGGDR	732	sp|P19838|NFKB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	23-UNIMOD:267	ms_run[2]:scan=10158	63.141	3	2421.1952	2421.1952	R	Q	164	187
PSM	HEELMLGDPCLK	733	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	10-UNIMOD:4	ms_run[2]:scan=6723	41.589	2	1440.6741	1440.6741	K	D	651	663
PSM	HLCEPGADGAETFADGVPR	734	sp|Q14839|CHD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:4,19-UNIMOD:267	ms_run[2]:scan=6515	40.368	3	2007.8984	2007.8984	R	E	1466	1485
PSM	HLSCTVGDLQTK	735	sp|Q96T51-3|RUFY1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	4-UNIMOD:4,12-UNIMOD:188	ms_run[2]:scan=3407	22.214	2	1363.6861	1363.6861	R	I	317	329
PSM	HQEAEMAQNAVR	736	sp|P35222|CTNB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	12-UNIMOD:267	ms_run[2]:scan=1748	12.753	2	1392.6444	1392.6444	R	L	475	487
PSM	HQEAEMAQNAVR	737	sp|P35222|CTNB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=1751	12.769	2	1382.6361	1382.6361	R	L	475	487
PSM	HVLDALDPNAYEAFK	738	sp|P49916-4|DNLI3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	15-UNIMOD:188	ms_run[2]:scan=9422	58.387	2	1707.8564	1707.8564	K	A	341	356
PSM	HVLEYNEERDDFDLEA	739	sp|Q9NV31|IMP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=7777	48.034	2	1992.8701	1992.8701	R	-	169	185
PSM	IAKEEIFGPVQPILK	740	sp|P47895|AL1A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=8888	54.941	2	1693.0217	1693.0217	R	F	407	422
PSM	IASWADLVNAHVVPGSGVVK	741	sp|P11172|UMPS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10726	66.827	2	2018.0949	2018.0949	K	G	333	353
PSM	ICVNGDDAHPLWK	742	sp|P36969-2|GPX4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:4	ms_run[2]:scan=6328	39.259	2	1523.7191	1523.7191	K	W	106	119
PSM	IDFSKLTSLNVK	743	sp|P26599|PTBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9137	56.52	2	1363.7711	1363.7711	R	Y	255	267
PSM	IMNVIGEPIDERGPIK	744	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:35	ms_run[2]:scan=6593	40.837	2	1795.9502	1795.9502	R	T	144	160
PSM	IPGEETDTIQHMR	745	sp|P50416-2|CPT1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=4534	28.72	2	1525.7195	1525.7195	R	D	317	330
PSM	IQHILCTGNLCTK	746	sp|Q9UBQ0|VPS29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	6-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=5096	32.012	2	1556.7803	1556.7803	K	E	31	44
PSM	IRIDSLSAQLSQLQK	747	sp|P02545-2|LMNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9074	56.114	2	1698.9628	1698.9628	R	Q	297	312
PSM	ISGLIYEETRGVLK	748	sp|P62805|H4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8281	51.146	2	1576.8825	1576.8825	R	V	47	61
PSM	IVAPGKGILAADESTGSIAK	749	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	6-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=6521	40.405	3	1909.0923	1909.0923	R	R	23	43
PSM	IVGPSGAAVPCKVEPGLGADNSVVR	750	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	11-UNIMOD:4	ms_run[2]:scan=6927	42.879	2	2448.2795	2448.2795	K	F	1008	1033
PSM	IVSSSDVGHDEYSTQSLVKK	751	sp|Q01082-3|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=4805	30.268	2	2178.0804	2178.0804	K	H	753	773
PSM	KENFNNVPDLELNPIR	752	sp|Q96BS2-2|CHP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8597	53.107	2	1910.985	1910.9850	R	S	44	60
PSM	KFDFDACNEVPPAPK	753	sp|Q15424-2|SAFB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:4	ms_run[2]:scan=6501	40.282	2	1733.8083	1733.8083	R	E	287	302
PSM	KLEAELLQIEER	754	sp|Q969G3-6|SMCE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=7869	48.609	2	1469.809	1469.8090	R	H	170	182
PSM	KLLDLVQQSCNYK	755	sp|P55769|NH2L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:188,10-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=7059	43.662	2	1619.8744	1619.8744	K	Q	21	34
PSM	KLLDLVQQSCNYK	756	sp|P55769|NH2L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	10-UNIMOD:4	ms_run[2]:scan=7061	43.673	2	1607.8341	1607.8341	K	Q	21	34
PSM	KMMADEALGSGLVSR	757	sp|Q13011|ECH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6444	39.934	2	1563.7749	1563.7749	R	V	231	246
PSM	KNPEVPVNFAEFSK	758	sp|O15347|HMGB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=7947	49.1	2	1616.8601	1616.8601	K	K	30	44
PSM	KPLLESGTLGTK	759	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=4292	27.304	2	1242.7184	1242.7184	R	G	553	565
PSM	KPLLESGTLGTK	760	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=4293	27.308	2	1254.7586	1254.7586	R	G	553	565
PSM	KPTFMDEEVQSILTK	761	sp|P82650|RT22_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10166	63.194	3	1764.8968	1764.8968	K	M	67	82
PSM	KQPPVSPGTALVGSQK	762	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=3870	24.888	2	1604.9289	1604.9289	R	E	31	47
PSM	KTWLEEQGMILK	763	sp|P18858|DNLI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=8645	53.404	2	1486.8256	1486.8256	R	Q	493	505
PSM	LFQECCPHSTDR	764	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	5-UNIMOD:4,6-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=2879	19.18	2	1558.6532	1558.6532	K	V	156	168
PSM	LGSFNLEKVENPAEVIR	765	sp|Q13426-3|XRCC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9345	57.892	2	1914.0211	1914.0211	R	E	108	125
PSM	LHAVNAEECNVLQGR	766	sp|O75521-2|ECI2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=5118	32.145	3	1718.8398	1718.8398	K	W	325	340
PSM	LHVTALDYLAPYAK	767	sp|Q9Y221-2|NIP7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:188	ms_run[2]:scan=9900	61.466	2	1579.8706	1579.8706	R	G	81	95
PSM	LKEFCCDSALPQSR	768	sp|P20585|MSH3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	5-UNIMOD:4,6-UNIMOD:4	ms_run[2]:scan=5008	31.496	2	1709.7865	1709.7865	K	V	137	151
PSM	LKPFLGSSDCVNQISGK	769	sp|Q9BZF1-3|OSBL8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:188,10-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=6647	41.146	3	1860.9806	1860.9806	K	L	566	583
PSM	LQGGKDFNMPLTISSLK	770	sp|Q96HC4-3|PDLI5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	5-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=9398	58.229	2	1860.0218	1860.0218	R	D	18	35
PSM	MIAPEGSLVFHEK	771	sp|P48739|PIPNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:188	ms_run[2]:scan=7035	43.518	2	1462.7586	1462.7586	R	A	74	87
PSM	MNVDQAFHELVR	772	sp|P62070-3|RRAS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	12-UNIMOD:267	ms_run[2]:scan=9867	61.249	2	1467.7168	1467.7168	R	V	127	139
PSM	MQKEITALAPSTMK	773	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:35,3-UNIMOD:188,13-UNIMOD:35,14-UNIMOD:188	ms_run[2]:scan=3564	23.124	2	1591.8352	1591.8352	R	I	313	327
PSM	MTGSEFDFEEMKR	774	sp|P50395-2|GDIB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:35	ms_run[2]:scan=6481	40.16	2	1621.6752	1621.6752	R	K	379	392
PSM	NAAPILHLSGMDVTIVK	775	sp|Q53H12|AGK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9929	61.653	2	1777.976	1777.9760	K	T	83	100
PSM	NGGLITLEELHQQVLK	776	sp|Q96H20-2|SNF8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	16-UNIMOD:188	ms_run[2]:scan=9829	61.006	2	1797.0092	1797.0092	R	G	115	131
PSM	NHQNLLDSLEQYVK	777	sp|Q93008-1|USP9X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:188	ms_run[2]:scan=11139	69.574	2	1705.8731	1705.8731	R	G	1746	1760
PSM	NISHDTFGTTYGR	778	sp|Q9H7B2|RPF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:267	ms_run[2]:scan=4130	26.386	2	1477.6825	1477.6825	K	I	253	266
PSM	NISHDTFGTTYGR	779	sp|Q9H7B2|RPF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=4148	26.496	2	1467.6743	1467.6743	K	I	253	266
PSM	NLGIGKVSSFEEK	780	sp|P40926|MDHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	6-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=5920	36.854	2	1418.7808	1418.7808	K	M	302	315
PSM	NRPTSISWDGLDSGK	781	sp|P30086|PEBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6494	40.242	2	1631.7903	1631.7903	K	L	48	63
PSM	PNIVLFSGSSHQDLSQR	782	sp|P11908|PRPS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	17-UNIMOD:267	ms_run[2]:scan=7197	44.498	3	1893.9572	1893.9572	M	V	2	19
PSM	RAGELTEDEVER	783	sp|P62269|RS18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:267,12-UNIMOD:267	ms_run[2]:scan=2733	18.333	2	1422.6854	1422.6854	K	V	55	67
PSM	RAGELTEDEVER	784	sp|P62269|RS18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=2735	18.348	2	1402.6688	1402.6688	K	V	55	67
PSM	RALQAAIQQLAEAQPEATAK	785	sp|Q92616|GCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8137	50.265	3	2107.1386	2107.1386	R	N	68	88
PSM	RANENSNIQVLSER	786	sp|Q6UN15-4|FIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=4002	25.639	2	1628.823	1628.8230	R	S	316	330
PSM	REEQIVQLLNSVQAK	787	sp|Q9H2U1|DHX36_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9405	58.277	2	1753.9686	1753.9686	R	N	91	106
PSM	RLEDLSESIVNDFAYMK	788	sp|P49755|TMEDA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=12183	76.629	2	2028.9826	2028.9826	R	K	153	170
PSM	RNQDLAPNSAEQASILSLVTK	789	sp|Q12905|ILF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10011	62.183	2	2254.1917	2254.1917	K	I	60	81
PSM	RTVQSLEIDLDSMR	790	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:35	ms_run[2]:scan=6633	41.061	3	1677.8356	1677.8356	R	N	301	315
PSM	RVTAYTVDVTGR	791	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:267,12-UNIMOD:267	ms_run[2]:scan=4256	27.115	2	1356.7265	1356.7265	R	E	156	168
PSM	SCGSLLPELKLEER	792	sp|P42704|LPPRC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:4	ms_run[2]:scan=8591	53.068	2	1629.8396	1629.8396	R	T	129	143
PSM	SFGSAQEFAWAHDSSEYAIR	793	sp|P35606-2|COPB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9317	57.712	2	2258.0029	2258.0029	K	E	358	378
PSM	SGSKFPVFNMSYNPAENAVLLCTR	794	sp|P53621|COPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	22-UNIMOD:4	ms_run[2]:scan=11592	72.628	3	2701.2992	2701.2992	R	A	359	383
PSM	SKLGESQTLQQFSR	795	sp|Q13813-3|SPTN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5147	32.318	2	1607.8267	1607.8267	R	D	1525	1539
PSM	SKLSQNNFALGYK	796	sp|Q9Y277|VDAC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5451	34.104	2	1468.7674	1468.7674	K	A	162	175
PSM	SLHDALCVLAQTVK	797	sp|P78371-2|TCPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:4	ms_run[2]:scan=10687	66.565	2	1553.8236	1553.8236	R	D	342	356
PSM	SNMGHPEPASGLAALAK	798	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	17-UNIMOD:188	ms_run[2]:scan=6068	37.733	2	1655.8397	1655.8397	K	V	327	344
PSM	SPQPDPVGTPTIFKPQSK	799	sp|P46013-2|KI67_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=6361	39.457	3	1935.0504	1935.0504	R	R	1863	1881
PSM	SQEEPKDTFEHDPSESIDEFNK	800	sp|Q9NYF8-3|BCLF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6280	38.986	3	2607.1249	2607.1249	K	S	181	203
PSM	SRLNATASLEQER	801	sp|O76024|WFS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=3521	22.877	2	1473.7536	1473.7536	R	S	25	38
PSM	SSGPYGGGGQYFAKPR	802	sp|P09651-3|ROA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=4468	28.309	2	1627.7743	1627.7743	R	N	232	248
PSM	SYDVPPPPMEPDHPFYSNISK	803	sp|Q8N0Y7|PGAM4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:35	ms_run[2]:scan=7323	45.261	2	2432.0995	2432.0995	R	D	118	139
PSM	SYDVPPPPMEPDHPFYSNISK	804	sp|Q8N0Y7|PGAM4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8220	50.763	2	2416.1045	2416.1045	R	D	118	139
PSM	TFVDFFSQCLHEEYR	805	sp|Q53GQ0|DHB12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=11940	74.988	2	1986.881	1986.8810	K	S	207	222
PSM	TFVDFFSQCLHEEYR	806	sp|Q53GQ0|DHB12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:4	ms_run[2]:scan=11939	74.981	2	1976.8727	1976.8727	K	S	207	222
PSM	TFVNITPAEVGVLVGKDR	807	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10850	67.661	2	1914.0575	1914.0575	K	S	39	57
PSM	TGTGKTFSFAIPLIEK	808	sp|Q9NR30-2|DDX21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10769	67.124	2	1708.94	1708.9400	R	L	164	180
PSM	THGSEIINDLQGR	809	sp|O75116|ROCK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:267	ms_run[2]:scan=5461	34.164	2	1448.7247	1448.7247	R	I	635	648
PSM	TIPGKQQLLIGAYAK	810	sp|Q99832|TCPH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6660	41.221	2	1599.9348	1599.9348	R	A	426	441
PSM	TPCSSLLPLLNAHAATSGK	811	sp|Q9NUQ6-2|SPS2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:4,19-UNIMOD:188	ms_run[2]:scan=9042	55.901	3	1943.0242	1943.0242	R	Q	296	315
PSM	TPEIVAPQSAHAAFNK	812	sp|O95470|SGPL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5318	33.326	2	1679.8631	1679.8631	K	A	232	248
PSM	TPVLFDIYEIKEAIK	813	sp|P50995-2|ANX11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=12208	76.794	2	1777.9866	1777.9866	K	G	239	254
PSM	TRQGVDDAFYTLVR	814	sp|P01116-2|RASK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8460	52.24	2	1639.8318	1639.8318	K	E	148	162
PSM	TYDATTHFETTCDDIKNIYK	815	sp|P50395-2|GDIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	12-UNIMOD:4,16-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=7517	46.424	3	2447.1354	2447.1354	R	R	358	378
PSM	VGHSELVGEIIR	816	sp|P38606-2|VATA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6415	39.764	2	1307.7197	1307.7197	R	L	12	24
PSM	VIAATNRVDILDPALLR	817	sp|P17980|PRS6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10025	62.273	2	1849.0785	1849.0785	K	S	328	345
PSM	VIAATNRVDILDPALLR	818	sp|P17980|PRS6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:267,17-UNIMOD:267	ms_run[2]:scan=10022	62.259	3	1869.0951	1869.0951	K	S	328	345
PSM	VKAEGLLDVFQAVK	819	sp|P23469-3|PTPRE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10879	67.851	2	1515.8661	1515.8661	R	S	565	579
PSM	VLKDQPPNSVEGLLNALR	820	sp|Q9NUQ9-2|FA49B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=11507	72.052	3	1962.0898	1962.0898	K	Y	141	159
PSM	VLPEFDTPGHTLSWGK	821	sp|P07686|HEXB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9039	55.879	2	1782.8941	1782.8941	R	G	285	301
PSM	VLQKLDDDGLPFIGAK	822	sp|Q9H9Y6-4|RPA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	4-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=9288	57.529	2	1739.986	1739.9860	R	L	592	608
PSM	VPDLKDLDPIGK	823	sp|Q8WUM4|PDC6I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	5-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=8336	51.487	2	1320.7692	1320.7692	R	A	323	335
PSM	VSFELFADKVPK	824	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9125	56.444	2	1378.7497	1378.7497	R	T	20	32
PSM	VSFELFADKVPK	825	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:188	ms_run[2]:scan=8980	55.497	2	1384.7698	1384.7698	R	T	20	32
PSM	VTVLFAGQHISK	826	sp|O75369-6|FLNB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	12-UNIMOD:188	ms_run[2]:scan=6063	37.709	2	1304.7548	1304.7548	K	S	329	341
PSM	YCVEEEEKAAEMHK	827	sp|P78347-2|GTF2I_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:4	ms_run[2]:scan=3939	25.272	2	1751.7495	1751.7495	K	M	79	93
PSM	YGLIYHASLVGQTSPK	828	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6997	43.303	2	1732.9148	1732.9148	K	H	338	354
PSM	YKWCEYGLTFTEK	829	sp|P45880-2|VDAC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:188,4-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=8782	54.265	2	1735.8319	1735.8319	K	W	62	75
PSM	YPIEHGIITNWDDMEK	830	sp|P63267|ACTH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8514	52.585	2	1959.9037	1959.9037	K	I	70	86
PSM	YQELPNSGPPHDR	831	sp|P19525-2|E2AK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:267	ms_run[2]:scan=2864	19.089	2	1518.7091	1518.7091	K	R	27	40
PSM	YYREVLPGEIVEISR	832	sp|Q06203|PUR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8457	52.218	2	1821.9625	1821.9625	R	H	246	261
PSM	VIPELNGKLTGMAFR	833	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0		ms_run[1]:scan=9504	58.90148333333334	2	1645.8862	1644.9012	K	V	220	235
PSM	TKGVDEVTIVNILTNR	834	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	2-UNIMOD:188,16-UNIMOD:267	ms_run[1]:scan=10725	66.82138	2	1787.015702	1787.012361	K	S	48	64
PSM	QLFHPEQLITGKEDAANNYAR	835	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:28,12-UNIMOD:188,21-UNIMOD:267	ms_run[1]:scan=9475	58.72539833333333	3	2413.1994	2413.1992	R	G	85	106
PSM	LKPNLGNGADLPNYR	836	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=6207	38.53189833333333	2	1641.846310	1640.863454	K	W	159	174
PSM	GDAPSPEEKLHLITR	837	sp|P54577|SYYC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:1	ms_run[1]:scan=6676	41.317843333333336	2	1703.8843	1703.8837	M	N	2	17
PSM	LDVGNFSWGSECCTRK	838	sp|P62241|RS8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	12-UNIMOD:4,13-UNIMOD:4	ms_run[1]:scan=8006	49.462203333333335	2	1915.838756	1914.835267	R	T	60	76
PSM	QTELFAHFIQPAAQK	839	sp|O60264|SMCA5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:28	ms_run[1]:scan=11392	71.27429833333333	2	1710.8647	1710.8724	K	T	98	113
PSM	GFAFVTFESPADAKDAAR	840	sp|P38159|RBMX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=9408	58.29456833333334	2	1898.910402	1898.916277	R	D	50	68
PSM	KVPQVSTPTLVEVSR	841	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=6390	39.61841	2	1638.929538	1638.930471	K	N	438	453
PSM	SLQSLEASLHAMESTR	842	sp|Q9UQE7|SMC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=10316	64.15659166666666	2	1758.860322	1758.857048	R	E	759	775
PSM	IPGEETDTIQHMR	843	sp|P50416|CPT1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	13-UNIMOD:267	ms_run[1]:scan=4520	28.631276666666665	2	1536.730619	1535.727761	R	D	317	330
PSM	QIENIVDKTFFHQENVR	844	sp|Q9H089|LSG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:28,8-UNIMOD:188,17-UNIMOD:267	ms_run[1]:scan=11588	72.604075	3	2115.0674	2115.0715	K	A	587	604
PSM	AAKLEILQQQLQVANEAR	845	sp|Q14980-2|NUMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=8299	51.252	3	2022.1222	2022.1222	K	D	614	632
PSM	ACQSIYPLHDVFVR	846	sp|P61247|RS3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=8705	53.781	3	1713.8536	1713.8536	K	K	200	214
PSM	AFTGREFDELNPSAQR	847	sp|P16615-5|AT2A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6934	42.926	2	1836.8755	1836.8755	K	D	651	667
PSM	AHSSMVGVNLPQK	848	sp|P00558-2|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=4366	27.711	2	1366.7027	1366.7027	R	A	144	157
PSM	AIEINPDSAQPYKWR	849	sp|P50502|F10A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7419	45.852	2	1786.9002	1786.9002	R	G	174	189
PSM	AMKGAGTDEGCLIEILASR	850	sp|P09525-2|ANXA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	11-UNIMOD:4	ms_run[2]:scan=10474	65.176	3	1990.9816	1990.9816	R	T	16	35
PSM	ASVITQVFHVPLEER	851	sp|Q00341-2|VIGLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=10226	63.578	2	1723.9257	1723.9257	K	K	109	124
PSM	AVFQANQENLPILKR	852	sp|P05023-2|AT1A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7694	47.517	2	1739.9683	1739.9683	R	A	431	446
PSM	CASCPYLGMPAFKPGEK	853	sp|Q6FI81|CPIN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:4,4-UNIMOD:4,13-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=7549	46.618	2	1923.9084	1923.9084	R	V	285	302
PSM	CASCPYLGMPAFKPGEK	854	sp|Q6FI81|CPIN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:4,4-UNIMOD:4	ms_run[2]:scan=7557	46.667	2	1911.8681	1911.8681	R	V	285	302
PSM	CGFCHVGEEENEAR	855	sp|Q8IWS0-4|PHF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:4,4-UNIMOD:4	ms_run[2]:scan=3142	20.69	3	1692.6621	1692.6621	K	G	211	225
PSM	CGFCHVGEEENEAR	856	sp|Q8IWS0-4|PHF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:4,4-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=3144	20.7	3	1702.6703	1702.6703	K	G	211	225
PSM	CSVIRDSLLQDGEFSMDLR	857	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:4,16-UNIMOD:35	ms_run[2]:scan=9358	57.979	3	2256.0515	2256.0515	K	T	71	90
PSM	DFAVSTVPVSGPSHLR	858	sp|O95865|DDAH2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6933	42.92	2	1667.8631	1667.8631	R	G	158	174
PSM	DLYIDRPLPYLIGSK	859	sp|Q9Y4E1-5|WAC2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=10789	67.255	2	1761.9665	1761.9665	K	L	177	192
PSM	DVGRPNFEEGGPTSVGR	860	sp|Q6Y7W6-4|GGYF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5056	31.78	3	1772.8442	1772.8442	K	K	176	193
PSM	ELQHAALGGTATR	861	sp|O14828-2|SCAM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:267	ms_run[2]:scan=2289	15.804	2	1333.6978	1333.6978	R	Q	93	106
PSM	ENIVEAIIHSPELIR	862	sp|O95373|IPO7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	15-UNIMOD:267	ms_run[2]:scan=12852	81.642	2	1741.9602	1741.9602	R	V	93	108
PSM	EQLEEEEEAKHNLEK	863	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=3465	22.558	2	1853.8643	1853.8643	R	Q	1343	1358
PSM	EQQAQVEKEDFSDMVAEHAAK	864	sp|Q13435|SF3B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6334	39.294	2	2389.0856	2389.0856	R	Q	850	871
PSM	ESLREVQLEELEAAR	865	sp|P51570|GALK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7393	45.698	2	1770.9112	1770.9112	K	D	253	268
PSM	EVGSHFDDFVTNLIEK	866	sp|P35610-3|SOAT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=11446	71.641	2	1848.8894	1848.8894	K	S	3	19
PSM	FAQHGTFEYEYSQR	867	sp|P23246-2|SFPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:267	ms_run[2]:scan=5211	32.696	2	1771.783	1771.7830	R	W	480	494
PSM	FGWDCHGLPVEYEIDK	868	sp|P41252|SYIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	5-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=9856	61.181	2	1969.8976	1969.8976	R	T	83	99
PSM	FKNEEEVFAWNNEVK	869	sp|P49419-4|AL7A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=8013	49.505	3	1881.8897	1881.8897	K	Q	374	389
PSM	GAGKAPLNVQFNSPLPGDAVK	870	sp|O75369-6|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=8121	50.165	2	2079.1113	2079.1113	K	D	874	895
PSM	GAVHQLCQSLAGK	871	sp|P09417-2|DHPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	7-UNIMOD:4	ms_run[2]:scan=4204	26.811	2	1367.698	1367.6980	K	N	124	137
PSM	GEHPGLSIGDVAK	872	sp|P09429|HMGB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5010	31.512	2	1278.6568	1278.6568	K	K	115	128
PSM	GFGDLKSPAGLQVLNDYLADK	873	sp|P24534|EF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:188,21-UNIMOD:188	ms_run[2]:scan=11857	74.419	2	2232.1829	2232.1829	M	S	2	23
PSM	GHTAEILDFALSK	874	sp|Q13685|AAMP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:188	ms_run[2]:scan=8975	55.469	2	1406.7501	1406.7501	R	D	398	411
PSM	GMLKDNAMLEYLK	875	sp|P15311|EZRI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=9026	55.796	2	1536.8083	1536.8083	R	I	181	194
PSM	GPGGSSLLIEALSNSSHK	876	sp|Q9BSH4|TACO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9005	55.658	2	1752.9006	1752.9006	R	C	142	160
PSM	GQMQKPFEDASFALR	877	sp|Q13526|PIN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7980	49.298	3	1723.8352	1723.8352	R	T	128	143
PSM	GTSYQSPHGIPIDLLDR	878	sp|Q9Y230-2|RUVB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	17-UNIMOD:267	ms_run[2]:scan=8990	55.561	2	1877.9511	1877.9511	R	L	292	309
PSM	GVDEVTIVNILTNR	879	sp|P07355-2|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:267	ms_run[2]:scan=11963	75.146	2	1551.8496	1551.8496	K	S	68	82
PSM	GVMLAVDAVIAELKK	880	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=13212	85.059	2	1567.941	1567.9410	R	Q	143	158
PSM	HAEATLGSGNLR	881	sp|Q9H8S9-2|MOB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=2556	17.344	2	1224.6211	1224.6211	K	Q	31	43
PSM	HCQLLETPESWAK	882	sp|P52948-6|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:4	ms_run[2]:scan=7297	45.107	2	1597.7559	1597.7559	R	E	1486	1499
PSM	HCQLLETPESWAK	883	sp|P52948-6|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=7298	45.112	2	1603.776	1603.7760	R	E	1486	1499
PSM	HECQANGPEDLNR	884	sp|P60981-2|DEST_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=1373	10.643	2	1548.6615	1548.6615	K	A	116	129
PSM	HEQILVLDPPTDLK	885	sp|Q9P0L0|VAPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:188	ms_run[2]:scan=8342	51.526	2	1622.8975	1622.8975	K	F	11	25
PSM	HIDMVEGDEGR	886	sp|P52789|HXK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	11-UNIMOD:267	ms_run[2]:scan=2738	18.363	2	1266.5538	1266.5538	R	M	244	255
PSM	HLLNQAVGEEEVPK	887	sp|Q9H0G5|NSRP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5035	31.657	2	1561.81	1561.8100	R	C	186	200
PSM	HLLVSNVGGDGEEIER	888	sp|O75694-2|NU155_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5574	34.82	3	1722.8537	1722.8537	R	F	463	479
PSM	HLTPEPDIVASTK	889	sp|Q5JSH3-4|WDR44_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=4606	29.137	2	1406.7405	1406.7405	R	K	192	205
PSM	HQEPVYSVAFSPDGR	890	sp|Q9BZK7|TBL1R_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	15-UNIMOD:267	ms_run[2]:scan=6383	39.578	2	1697.8037	1697.8037	K	Y	441	456
PSM	HSGNITFDEIVNIAR	891	sp|P30050-2|RL12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	15-UNIMOD:267	ms_run[2]:scan=10141	63.029	3	1694.8616	1694.8616	K	Q	67	82
PSM	HSGNITFDEIVNIAR	892	sp|P30050-2|RL12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=10143	63.041	3	1684.8533	1684.8533	K	Q	67	82
PSM	HVLEYNEERDDFDLEA	893	sp|Q9NV31|IMP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	9-UNIMOD:267	ms_run[2]:scan=7771	47.994	2	2002.8784	2002.8784	R	-	169	185
PSM	HVLTGSADNSCR	894	sp|Q13347|EIF3I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	11-UNIMOD:4	ms_run[2]:scan=905	8.2371	2	1315.5939	1315.5939	K	L	66	78
PSM	IAKEEIFGPVQPILK	895	sp|P47895|AL1A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=8913	55.101	2	1680.9814	1680.9814	R	F	407	422
PSM	ICDQWDALGSLTHSR	896	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:4	ms_run[2]:scan=8822	54.519	3	1757.8155	1757.8155	K	R	498	513
PSM	IEVIKPGDLGVDLTSK	897	sp|P38117|ETFB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	5-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=8765	54.154	2	1694.9857	1694.9857	K	L	206	222
PSM	ILPVFDEPPNPTNVEESLKR	898	sp|Q9NYL9|TMOD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=10227	63.583	2	2293.1954	2293.1954	K	T	173	193
PSM	IQFKQDDGTGPEK	899	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=2633	17.771	2	1461.71	1461.7100	R	I	356	369
PSM	IRQEEIEIEVVQR	900	sp|Q14254|FLOT2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:267,13-UNIMOD:267	ms_run[2]:scan=6355	39.419	2	1659.9059	1659.9059	K	K	252	265
PSM	ISIPDVDLDLKGPK	901	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	11-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=9241	57.237	2	1520.8853	1520.8853	K	V	4849	4863
PSM	KFLDGNEMTLADCNLLPK	902	sp|Q9Y696|CLIC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	8-UNIMOD:35,13-UNIMOD:4	ms_run[2]:scan=8834	54.596	2	2094.0126	2094.0126	R	L	177	195
PSM	KGPGLAVQSGDK	903	sp|Q96PK6|RBM14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=1405	10.806	2	1167.665	1167.6650	K	T	153	165
PSM	KLDAEDVIGSR	904	sp|P46013-2|KI67_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5082	31.938	2	1201.6303	1201.6303	R	R	2532	2543
PSM	KLDPGSEETQTLVR	905	sp|P26641|EF1G_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=4536	28.732	2	1571.8155	1571.8155	R	E	401	415
PSM	KLTPITYPQGLAMAK	906	sp|P63000|RAC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=7552	46.64	2	1642.9519	1642.9519	K	E	133	148
PSM	KLVTDQNISENWR	907	sp|P24666-4|PPAC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5761	35.926	2	1601.8162	1601.8162	R	V	29	42
PSM	KPVAGALDVSFNK	908	sp|Q99627-2|CSN8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=5847	36.433	2	1356.7804	1356.7804	R	F	117	130
PSM	KYNILGTNAIMDK	909	sp|Q9BUJ2-3|HNRL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=7080	43.782	2	1491.8158	1491.8158	K	M	335	348
PSM	LEGLTDEINFLR	910	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:267	ms_run[2]:scan=11159	69.704	2	1428.7488	1428.7488	R	Q	214	226
PSM	LGRIEADSESQEDIIR	911	sp|P55957|BID_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=5605	35.004	3	1849.9285	1849.9285	R	N	69	85
PSM	LIAHAGSLTNLAK	912	sp|O00567|NOP56_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:188	ms_run[2]:scan=5308	33.269	2	1313.7763	1313.7763	R	Y	308	321
PSM	LKNTSEQDQPMGGWEMIR	913	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7952	49.13	3	2118.9827	2118.9827	R	K	456	474
PSM	LLGHEVEDVIIK	914	sp|Q92900-2|RENT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7390	45.681	2	1363.7711	1363.7711	K	C	445	457
PSM	LLQDFFNGKELNK	915	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=8805	54.413	2	1564.8249	1564.8249	K	S	349	362
PSM	LVKPGNQNTQVTEAWNK	916	sp|Q9UQ80|PA2G4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=4700	29.676	3	1925.9959	1925.9959	R	V	156	173
PSM	LYHVSDSEGNLVVR	917	sp|P09327|VILI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:267	ms_run[2]:scan=5916	36.826	2	1596.8135	1596.8135	K	E	255	269
PSM	MALNHPYFNDLDNQIK	918	sp|P06493-2|CDK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=8165	50.439	2	1931.92	1931.9200	K	K	223	239
PSM	MLFKDDYPSSPPK	919	sp|P63279|UBC9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=5844	36.411	2	1535.7733	1535.7733	R	C	62	75
PSM	MMANGILKVPAINVNDSVTK	920	sp|P23526|SAHH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:35,8-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=8750	54.062	3	2142.158	2142.1580	K	S	167	187
PSM	MQHNLEQQIQAR	921	sp|Q13813-3|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:35	ms_run[2]:scan=3290	21.546	2	1510.7311	1510.7311	R	N	2284	2296
PSM	MQKEITALAPSTMK	922	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:35,3-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=4783	30.135	2	1575.8403	1575.8403	R	I	313	327
PSM	MTDQEAIQDLWQWRK	923	sp|P06748|NPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:35	ms_run[2]:scan=10160	63.153	2	1962.9258	1962.9258	R	S	278	293
PSM	NCISTVVHQGLIR	924	sp|P78527-2|PRKDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=6715	41.539	2	1505.8012	1505.8012	R	I	477	490
PSM	NGGLITLEELHQQVLK	925	sp|Q96H20-2|SNF8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9826	60.988	2	1790.989	1790.9890	R	G	115	131
PSM	NLGIGKVSSFEEK	926	sp|P40926|MDHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5924	36.874	2	1406.7405	1406.7405	K	M	302	315
PSM	NMQNVEHVPLSLDR	927	sp|P20618|PSB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:267	ms_run[2]:scan=6641	41.107	2	1660.8231	1660.8231	K	A	185	199
PSM	NNFFVEKNPTIVNFPITNVDLR	928	sp|Q53GS9-2|SNUT2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=11695	73.322	3	2590.3544	2590.3544	K	E	357	379
PSM	NPEVGLKPVWYSPK	929	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7480	46.206	2	1612.8613	1612.8613	K	V	536	550
PSM	NPEVGLKPVWYSPK	930	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	7-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=7498	46.311	2	1624.9016	1624.9016	K	V	536	550
PSM	NQALKEAGVFVPR	931	sp|P53396|ACLY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6173	38.332	2	1427.7885	1427.7885	K	S	776	789
PSM	NREPVQLETLSIR	932	sp|P62314|SMD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:267,13-UNIMOD:267	ms_run[2]:scan=7048	43.597	2	1573.8691	1573.8691	K	G	49	62
PSM	NREPVQLETLSIR	933	sp|P62314|SMD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:267,13-UNIMOD:267	ms_run[2]:scan=7052	43.619	3	1573.8691	1573.8691	K	G	49	62
PSM	PQTVILPGPAPWGFR	934	sp|Q53GG5-3|PDLI3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	15-UNIMOD:267	ms_run[2]:scan=11186	69.886	2	1644.9016	1644.9016	M	L	2	17
PSM	QGDTGDWIGTFLGHK	935	sp|Q9Y3F4|STRAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=10918	68.111	2	1630.774	1630.7740	R	G	45	60
PSM	QQAAQAFIHNSLYGPGTNR	936	sp|Q9UMY1|NOL7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7231	44.711	2	2072.0188	2072.0188	R	T	187	206
PSM	QVQHILASASPSGR	937	sp|O94979-5|SC31A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:267	ms_run[2]:scan=3363	21.963	2	1459.7771	1459.7771	R	A	179	193
PSM	RIVAVTGAEAQK	938	sp|P49588|SYAC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=2096	14.728	2	1241.7092	1241.7092	R	A	751	763
PSM	RLAPEYEAAATR	939	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:267,12-UNIMOD:267	ms_run[2]:scan=3240	21.269	2	1366.7108	1366.7108	K	L	62	74
PSM	RLEESDVLQEAR	940	sp|O43615|TIM44_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=4977	31.319	2	1443.7318	1443.7318	R	R	90	102
PSM	RQLEEAEEEAQR	941	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=2200	15.317	2	1486.7012	1486.7012	K	A	1877	1889
PSM	RSLGYAYVNFQQPADAER	942	sp|Q13310-2|PABP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:267,18-UNIMOD:267	ms_run[2]:scan=7205	44.55	3	2104.0241	2104.0241	R	A	50	68
PSM	RTGAIVDVPVGEELLGR	943	sp|P25705-2|ATPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:267,17-UNIMOD:267	ms_run[2]:scan=9430	58.439	3	1800.0008	1800.0008	K	V	83	100
PSM	RVDGLAFVNEDIVASK	944	sp|Q9UFC0|LRWD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=8543	52.767	2	1731.9155	1731.9155	R	G	499	515
PSM	SCILRPGGSEDASAMLR	945	sp|P52888|THOP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:4	ms_run[2]:scan=6543	40.536	2	1818.8717	1818.8717	R	R	643	660
PSM	SDSFENPVLQQHFR	946	sp|P12956|XRCC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:267	ms_run[2]:scan=7318	45.235	2	1712.8146	1712.8146	R	N	475	489
PSM	SEHGPISFFPESGQPECLK	947	sp|Q96ME7-2|ZN512_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	17-UNIMOD:4,19-UNIMOD:188	ms_run[2]:scan=8715	53.84	2	2151.0038	2151.0038	R	E	231	250
PSM	SIDQFANLVLHQTVER	948	sp|O15116|LSM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=11627	72.86	2	1868.9745	1868.9745	R	I	34	50
PSM	SKINVNEIFYDLVR	949	sp|P61224-2|RAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=12345	77.723	2	1708.9148	1708.9148	K	Q	103	117
PSM	SLGSVQAPSYGARPVSSAASVYAGAGGSGSR	950	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:267,31-UNIMOD:267	ms_run[2]:scan=6897	42.691	2	2873.4171	2873.4171	R	I	15	46
PSM	SLTYLSILRNPVTNK	951	sp|P09661|RU2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9982	61.997	2	1717.9727	1717.9727	K	K	114	129
PSM	SMVDVLADHAGELVR	952	sp|Q13761|RUNX3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	15-UNIMOD:267	ms_run[2]:scan=10307	64.1	2	1620.8169	1620.8169	R	T	54	69
PSM	SMVEVLADHPGELVR	953	sp|Q01196-6|RUNX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	15-UNIMOD:267	ms_run[2]:scan=8337	51.493	2	1660.8482	1660.8482	R	T	50	65
PSM	SNELFTTFRQEMEK	954	sp|Q9NUQ3-2|TXLNG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9511	58.947	2	1758.8247	1758.8247	K	M	239	253
PSM	SRLNATASLEQER	955	sp|O76024|WFS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:267,13-UNIMOD:267	ms_run[2]:scan=3524	22.894	2	1493.7701	1493.7701	R	S	25	38
PSM	SRVTQSNFAVGYK	956	sp|P21796|VDAC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=4172	26.629	2	1455.747	1455.7470	K	T	162	175
PSM	STYNHLSSWLTDAR	957	sp|P61106|RAB14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=8245	50.924	2	1649.7798	1649.7798	R	N	97	111
PSM	SVDDVLSHFAQR	958	sp|Q86Y56-2|DAAF5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=8391	51.818	2	1372.6735	1372.6735	K	L	242	254
PSM	TADMDVGQIGFHR	959	sp|Q86WR0-2|CCD25_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6345	39.359	2	1445.6721	1445.6721	K	Q	33	46
PSM	TKGVDEVTIVNILTNR	960	sp|P07355-2|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:188,16-UNIMOD:267	ms_run[2]:scan=10655	66.354	2	1787.0124	1783.0242	K	S	66	82
PSM	VCAHITNIPFSITK	961	sp|Q9NTZ6|RBM12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=8073	49.88	2	1605.8644	1605.8644	K	M	544	558
PSM	VGRPSNIGQAQPIIDQLAEEAR	962	sp|Q9UHX1-4|PUF60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9772	60.637	2	2361.2401	2361.2401	K	A	142	164
PSM	VHACGVNPVETYIR	963	sp|Q08257-3|QOR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=6302	39.115	2	1623.8067	1623.8067	K	S	42	56
PSM	VLAEMREQYEAMAER	964	sp|P13646-2|K1C13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:267,15-UNIMOD:267	ms_run[2]:scan=7135	44.12	2	1844.8664	1844.8664	R	N	261	276
PSM	VLEGHTDFINGLVFDPK	965	sp|Q8NFH4|NUP37_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=10387	64.607	2	1899.9731	1899.9731	K	E	119	136
PSM	VLFDKVASQGEVVR	966	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6306	39.142	2	1545.8515	1545.8515	K	K	903	917
PSM	VLFDKVASQGEVVR	967	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6309	39.156	3	1545.8515	1545.8515	K	K	903	917
PSM	VLQKLDDDGLPFIGAK	968	sp|Q9H9Y6-4|RPA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9247	57.272	2	1727.9458	1727.9458	R	L	592	608
PSM	VLVDGEEHVGFLK	969	sp|Q9NPA0|EMC7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7189	44.451	2	1440.7613	1440.7613	R	T	67	80
PSM	VLYPNDNFFEGKELR	970	sp|P11216|PYGB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=8646	53.41	2	1839.9155	1839.9155	R	L	279	294
PSM	VSFELFADKVPK	971	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	9-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=9123	56.436	2	1390.7899	1390.7899	R	T	20	32
PSM	VSFELFADKVPK	972	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	9-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=9277	57.467	2	1390.7899	1390.7899	R	T	20	32
PSM	VSFELFADKVPK	973	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=8970	55.44	2	1378.7497	1378.7497	R	T	20	32
PSM	VSFELFADKVPK	974	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9279	57.475	2	1378.7497	1378.7497	R	T	20	32
PSM	VVDLMAHMASKE	975	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	11-UNIMOD:188	ms_run[2]:scan=6127	38.072	2	1335.6622	1335.6622	R	-	282	294
PSM	WIDNPTVDDRGVGQAAIR	976	sp|P18206-2|VINC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	10-UNIMOD:267,18-UNIMOD:267	ms_run[2]:scan=6698	41.447	2	2002.0135	2002.0135	R	G	503	521
PSM	CSVIRDSLLQDGEFSMDLR	977	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:385,1-UNIMOD:4,16-UNIMOD:35	ms_run[1]:scan=11400	71.333625	3	2239.0178	2239.0244	K	T	71	90
PSM	NPDRVLIGGDETPEGQR	978	sp|O60701|UGDH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=4571	28.935763333333337	2	1851.908638	1851.907504	K	A	174	191
PSM	CLLLCHPGPCPPCPK	979	sp|Q6ZNB6|NFXL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:385,1-UNIMOD:4,5-UNIMOD:4,10-UNIMOD:4,13-UNIMOD:4	ms_run[1]:scan=8984	55.52440166666667	2	1787.7957	1787.7974	K	M	269	284
PSM	QTFEAAILTQLHPR	980	sp|Q9NPD3|EXOS4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:28,14-UNIMOD:267	ms_run[1]:scan=12000	75.39118	2	1616.8546	1616.8545	R	S	105	119
PSM	KVPQVSTPTLVEVSR	981	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=6557	40.62578833333333	3	1638.930122	1638.930471	K	N	438	453
PSM	HSGPNSADSANDGFVR	982	sp|P52597|HNRPF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0		ms_run[1]:scan=2793	18.680058333333335	2	1630.6962	1629.7122	K	L	99	115
PSM	HTGPNSPDTANDGFVR	983	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=3486	22.676714999999998	2	1684.746010	1683.760111	K	L	99	115
PSM	VIPSFMCQAGDFTNHNGTGGK	984	sp|P30405|PPIF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	7-UNIMOD:4,21-UNIMOD:188	ms_run[1]:scan=8328	51.435388333333336	2	2244.003437	2243.019501	R	S	98	119
PSM	QDGPMPKPHSVSLNDTETR	985	sp|Q9P0L0|VAPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:28	ms_run[1]:scan=5294	33.180726666666665	2	2090.9659	2090.9686	K	K	155	174
PSM	EKFGDQDVWILPQAEWQPGETLR	986	sp|Q9H2W6|RM46_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=11769	73.818055	3	2741.325656	2741.344930	R	G	163	186
PSM	VFDKEGNGTVMGAELR	987	sp|P05976|MYL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	4-UNIMOD:188,16-UNIMOD:267	ms_run[1]:scan=5669	35.38133	2	1737.870057	1737.869068	R	H	138	154
PSM	LLGHEVEDVIIK	988	sp|Q92900|RENT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	12-UNIMOD:188	ms_run[1]:scan=7389	45.67632166666667	2	1369.792970	1369.791246	K	C	456	468
PSM	QLKLDPSIFESLQK	989	sp|Q9Y265|RUVB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:28,3-UNIMOD:188,14-UNIMOD:188	ms_run[1]:scan=12008	75.444715	2	1639.9188	1639.9219	K	E	169	183
PSM	QLKLDPSIFESLQK	990	sp|Q9Y265|RUVB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:28	ms_run[1]:scan=12009	75.45048333333334	2	1627.8795	1627.8816	K	E	169	183
PSM	GSCHIGGNVATNAGGLR	991	sp|Q8N465|D2HDH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:4,17-UNIMOD:267	ms_run[1]:scan=3786	24.400760000000002	2	1650.820584	1649.793155	K	F	196	213
PSM	AALCHFCIDMLNAK	992	sp|P54920|SNAA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	4-UNIMOD:4,7-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=8938	55.259	2	1668.7882	1668.7882	K	L	209	223
PSM	AALCHFCIDMLNAK	993	sp|P54920|SNAA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	4-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=8939	55.264	2	1662.768	1662.7680	K	L	209	223
PSM	AFEGQAHGADR	994	sp|Q8TDB8-3|GTR14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:267	ms_run[2]:scan=831	7.8552	2	1167.5297	1167.5297	R	S	129	140
PSM	AHEVGAQGGPPVAQVEQDLPISR	995	sp|Q14676-4|MDC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	23-UNIMOD:267	ms_run[2]:scan=8257	50.997	3	2364.2061	2364.2061	R	E	620	643
PSM	AHTMTDDVTFWK	996	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7735	47.765	2	1450.6551	1450.6551	K	W	101	113
PSM	AQVARPGGDTIFGK	997	sp|P49773|HINT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=4772	30.075	2	1415.7521	1415.7521	K	I	8	22
PSM	ARPCIIPENEEIPR	998	sp|P0CW19-2|LIMS3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	2-UNIMOD:267,4-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=6186	38.406	2	1712.8783	1712.8783	R	A	7	21
PSM	ARSDEGQLSPATR	999	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=1321	10.371	2	1386.6852	1386.6852	R	G	543	556
PSM	ASITPGTILIILTGR	1000	sp|Q02878|RL6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=13734	91.546	2	1524.9239	1524.9239	R	H	142	157
PSM	AVDIPHMDIEALK	1001	sp|P62906|RL10A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9003	55.647	2	1450.749	1450.7490	K	K	79	92
PSM	CFNDLKAEELLLK	1002	sp|P55212|CASP6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:4,6-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=9355	57.957	2	1603.8682	1603.8682	K	I	87	100
PSM	CQNILQGNFKPDFYLK	1003	sp|Q49A26-5|GLYR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:4,10-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=10053	62.454	2	1996.0279	1996.0279	K	Y	405	421
PSM	DALSDLALHFLNK	1004	sp|P50991-2|TCPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:188	ms_run[2]:scan=12735	80.706	2	1461.7923	1461.7923	R	M	277	290
PSM	DALSDLALHFLNK	1005	sp|P50991-2|TCPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=12727	80.64	2	1455.7722	1455.7722	R	M	277	290
PSM	DDGLFSGDPNWFPKK	1006	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10000	62.113	2	1721.8049	1721.8049	R	S	140	155
PSM	DRVTSAVEALLSADSASR	1007	sp|P45974-2|UBP5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11506	72.046	2	1846.9385	1846.9385	R	K	145	163
PSM	DVGRPNFEEGGPTSVGR	1008	sp|Q6Y7W6-4|GGYF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	4-UNIMOD:267,17-UNIMOD:267	ms_run[2]:scan=5076	31.9	2	1792.8607	1792.8607	K	K	176	193
PSM	EFTRLEICNLTPDALK	1009	sp|P07384|CAN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	8-UNIMOD:4	ms_run[2]:scan=9952	61.804	2	1918.9822	1918.9822	R	S	344	360
PSM	EHALLAYTLGVK	1010	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7821	48.312	2	1313.7343	1313.7343	R	Q	135	147
PSM	EHALLAYTLGVK	1011	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:188	ms_run[2]:scan=7829	48.363	2	1319.7545	1319.7545	R	Q	135	147
PSM	ELKIDIIPNPQER	1012	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8092	49.989	2	1563.8621	1563.8621	K	T	70	83
PSM	EQKVPEILQLSDALR	1013	sp|P49589-2|SYCC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10482	65.229	2	1737.9625	1737.9625	R	D	604	619
PSM	ERESLQQMAEVTR	1014	sp|P14314-2|GLU2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	2-UNIMOD:267,13-UNIMOD:267	ms_run[2]:scan=5362	33.589	2	1595.784	1595.7840	K	E	123	136
PSM	EVEERPAPTPWGSK	1015	sp|O15143|ARC1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=4267	27.172	2	1581.7787	1581.7787	K	M	175	189
PSM	FKLITEDVQGK	1016	sp|P61247|RS3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5856	36.478	2	1276.7027	1276.7027	K	N	84	95
PSM	FLTAVNLEHPEMLEK	1017	sp|Q9Y2Q3-4|GSTK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	15-UNIMOD:188	ms_run[2]:scan=9010	55.692	2	1775.9223	1775.9223	R	A	59	74
PSM	FLTKGDNNAVDDR	1018	sp|P67812-2|SC11A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=2849	19	2	1463.7005	1463.7005	K	G	85	98
PSM	GLGTDEDTIIDIITHR	1019	sp|P08133-2|ANXA6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	16-UNIMOD:267	ms_run[2]:scan=12324	77.579	2	1777.9086	1777.9086	K	S	346	362
PSM	GNSLTLIDLPGHESLR	1020	sp|Q9Y5M8|SRPRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8842	54.646	2	1720.9108	1720.9108	R	L	110	126
PSM	GPGGSSLLIEALSNSSHK	1021	sp|Q9BSH4|TACO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9001	55.635	3	1752.9006	1752.9006	R	C	142	160
PSM	GRPLAEESEQER	1022	sp|Q8N357|S35F6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=1204	9.7734	2	1399.6692	1399.6692	R	L	347	359
PSM	GSSHQVEYEILFPGCVLR	1023	sp|O76054-5|S14L2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	15-UNIMOD:4,18-UNIMOD:267	ms_run[2]:scan=10792	67.274	2	2100.0338	2100.0338	R	W	204	222
PSM	GVDEVTIVNILTNR	1024	sp|P07355-2|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11966	75.164	2	1541.8413	1541.8413	K	S	68	82
PSM	GYAFNHSADFETVR	1025	sp|P61160|ARP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6156	38.236	3	1612.727	1612.7270	R	M	201	215
PSM	GYDAPLCNLLLFKK	1026	sp|O60488-2|ACSL4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	7-UNIMOD:4,13-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=11252	70.33	2	1662.9206	1662.9206	K	V	373	387
PSM	GYGFVHFETQEAAER	1027	sp|P11940-2|PABP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	15-UNIMOD:267	ms_run[2]:scan=7031	43.497	3	1749.7986	1749.7986	K	A	139	154
PSM	HAEATLGSGNLR	1028	sp|Q9H8S9-2|MOB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:267	ms_run[2]:scan=2555	17.339	2	1234.6294	1234.6294	K	Q	31	43
PSM	HALIIYDDLSK	1029	sp|P25705-2|ATPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:188	ms_run[2]:scan=7008	43.365	2	1292.7072	1292.7072	K	Q	256	267
PSM	HALIIYDDLSK	1030	sp|P25705-2|ATPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7012	43.389	2	1286.6871	1286.6871	K	Q	256	267
PSM	HCPSAVVPVELQK	1031	sp|Q9NZB2-2|F120A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	2-UNIMOD:4	ms_run[2]:scan=5168	32.445	2	1462.7602	1462.7602	K	L	13	26
PSM	HECQANGPEDLNR	1032	sp|P60981-2|DEST_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	3-UNIMOD:4	ms_run[2]:scan=1372	10.638	2	1538.6532	1538.6532	K	A	116	129
PSM	HEVTILGGLNEFVVK	1033	sp|P62256-2|UBE2H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	15-UNIMOD:188	ms_run[2]:scan=10965	68.421	2	1659.9291	1659.9291	K	F	23	38
PSM	HFVALSTNTTK	1034	sp|P06744-2|G6PI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=3231	21.217	2	1217.6404	1217.6404	K	V	253	264
PSM	HIDLVEGDEGR	1035	sp|P19367-4|HXK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=3637	23.544	2	1238.5891	1238.5891	R	M	232	243
PSM	HIDMVEGDEGR	1036	sp|P52789|HXK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=2737	18.358	2	1256.5455	1256.5456	R	M	244	255
PSM	HIEVQVAQETR	1037	sp|O60271-5|JIP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:267	ms_run[2]:scan=3052	20.179	2	1318.6869	1318.6869	K	N	302	313
PSM	HIEVQVAQETR	1038	sp|O60271-5|JIP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=3059	20.219	2	1308.6786	1308.6786	K	N	302	313
PSM	HLLVSNVGGDGEEIER	1039	sp|O75694-2|NU155_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	16-UNIMOD:267	ms_run[2]:scan=5578	34.846	3	1732.8619	1732.8619	R	F	463	479
PSM	HNVQTLDIISR	1040	sp|Q06203|PUR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:267	ms_run[2]:scan=5565	34.765	2	1304.7076	1304.7076	R	S	261	272
PSM	HQDDLQDVIGR	1041	sp|Q6P1N9|TATD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:267	ms_run[2]:scan=5472	34.225	2	1304.6348	1304.6348	K	A	28	39
PSM	HQDDLQDVIGR	1042	sp|Q6P1N9|TATD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5475	34.239	2	1294.6266	1294.6266	K	A	28	39
PSM	HTGPNSPDTANDGFVR	1043	sp|P55795|HNRH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	16-UNIMOD:267	ms_run[2]:scan=3275	21.466	3	1693.7684	1693.7684	K	L	99	115
PSM	HYLFYDGESVSGK	1044	sp|O75436|VP26A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6371	39.511	2	1500.6885	1500.6885	K	V	39	52
PSM	IAALQAFADQLIAAGHYAK	1045	sp|Q13813-3|SPTN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=13135	84.186	2	1971.0578	1971.0578	K	G	1481	1500
PSM	ICDQWDALGSLTHSR	1046	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	2-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=8814	54.47	3	1767.8238	1767.8238	K	R	498	513
PSM	IFHTVTTTDDPVIR	1047	sp|O15371-2|EIF3D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5866	36.531	2	1613.8413	1613.8413	R	K	174	188
PSM	IFVGGLSPDTPEEKIR	1048	sp|Q14103-4|HNRPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7264	44.915	3	1756.9359	1756.9359	K	E	165	181
PSM	IHMGSCAENTAK	1049	sp|P24752|THIL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	6-UNIMOD:4,12-UNIMOD:188	ms_run[2]:scan=1272	10.116	2	1323.6007	1323.6007	K	K	191	203
PSM	ILLAELEQLKGQGK	1050	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	10-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=8659	53.49	2	1550.9435	1550.9435	K	S	130	144
PSM	ILPVFDEPPNPTNVEESLKR	1051	sp|Q9NYL9|TMOD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10211	63.485	3	2293.1954	2293.1954	K	T	173	193
PSM	IQFKQDDGTGPEK	1052	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	4-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=2634	17.777	2	1473.7502	1473.7502	R	I	356	369
PSM	KASGPPVSELITK	1053	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5043	31.701	2	1325.7555	1325.7555	R	A	34	47
PSM	KASGPPVSELITK	1054	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=5049	31.737	2	1337.7957	1337.7957	R	A	34	47
PSM	KATGPPVSELITK	1055	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5272	33.058	2	1339.7711	1339.7711	R	A	37	50
PSM	KCGETAFIAPQCEMIPIEWVCR	1056	sp|P22234|PUR6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	2-UNIMOD:4,12-UNIMOD:4,21-UNIMOD:4	ms_run[2]:scan=11897	74.69	3	2694.2427	2694.2427	R	R	80	102
PSM	KFLDGIYVSEK	1057	sp|P32969|RL9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=6707	41.497	2	1309.7321	1309.7321	R	G	174	185
PSM	KITIGQAPTEK	1058	sp|P11586|C1TC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=2881	19.19	2	1184.6765	1184.6765	R	G	543	554
PSM	KLVIIEGDLER	1059	sp|P06753|TPM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6524	40.419	2	1283.7449	1283.7449	R	T	169	180
PSM	KNILLTIGSYK	1060	sp|P27708|PYR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7968	49.227	2	1248.7442	1248.7442	K	N	1313	1324
PSM	KQPPVSPGTALVGSQK	1061	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=3875	24.912	2	1592.8886	1592.8886	R	E	31	47
PSM	KVEDLFLTFAK	1062	sp|Q13813-3|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=10267	63.843	2	1321.7684	1321.7684	R	K	2068	2079
PSM	KWLLLNDPEDTSSGSK	1063	sp|Q9NZM1-2|MYOF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8158	50.394	3	1788.8894	1788.8894	R	G	256	272
PSM	LFNEHIEALTK	1064	sp|O14776-2|TCRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:188	ms_run[2]:scan=6608	40.92	2	1319.7181	1319.7181	K	K	924	935
PSM	LHVTALDYLAPYAK	1065	sp|Q9Y221-2|NIP7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9899	61.46	2	1573.8504	1573.8504	R	G	81	95
PSM	LIAHAGSLTNLAK	1066	sp|O00567|NOP56_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5312	33.29	2	1307.7561	1307.7561	R	Y	308	321
PSM	LIHPDEDISLEER	1067	sp|O43670-3|ZN207_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6117	38.017	2	1564.7733	1564.7733	K	R	280	293
PSM	LIHPDEDISLEER	1068	sp|O43670-3|ZN207_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:267	ms_run[2]:scan=6111	37.979	2	1574.7816	1574.7816	K	R	280	293
PSM	LIKEPAPDSGLLGLFQGQNSLLH	1069	sp|Q96AB3-3|ISOC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=12620	79.691	3	2446.322	2446.3220	K	-	113	136
PSM	LKDLEALLNSK	1070	sp|P02545-2|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8208	50.698	2	1242.7184	1242.7184	R	E	134	145
PSM	LKLSEELSGGR	1071	sp|P61158|ARP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=4918	30.969	2	1187.651	1187.6510	R	L	347	358
PSM	LLGQFSEKELAAEK	1072	sp|P53004|BIEA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6604	40.901	2	1561.8352	1561.8352	K	K	262	276
PSM	LLKDAEALSQR	1073	sp|P35580|MYH10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=4004	25.655	2	1242.6932	1242.6932	K	L	1397	1408
PSM	LLQALAQYQNHLQEQPR	1074	sp|Q9BQG0|MBB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	17-UNIMOD:267	ms_run[2]:scan=7690	47.491	3	2059.0838	2059.0838	K	K	162	179
PSM	LLQDFFNGKELNK	1075	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	9-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=8803	54.403	2	1576.8652	1576.8652	K	S	349	362
PSM	LLVGNDDVHIIAR	1076	sp|Q7Z6Z7-2|HUWE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:267	ms_run[2]:scan=7072	43.734	2	1443.8073	1443.8073	R	S	2606	2619
PSM	LRAETEQGEQQR	1077	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	2-UNIMOD:267,12-UNIMOD:267	ms_run[2]:scan=705	7.1947	2	1463.7232	1463.7232	R	Q	1686	1698
PSM	LRAETEQGEQQR	1078	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=707	7.2041	2	1443.7066	1443.7066	R	Q	1686	1698
PSM	LREAQNDLEQVLR	1079	sp|Q15075|EEA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6720	41.572	2	1582.8427	1582.8427	K	Q	504	517
PSM	LRQEEPQSLQAAVR	1080	sp|P29590-14|PML_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=4240	27.019	2	1623.8693	1623.8693	R	T	359	373
PSM	LRQEEPQSLQAAVR	1081	sp|P29590-14|PML_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	2-UNIMOD:267,14-UNIMOD:267	ms_run[2]:scan=4241	27.025	2	1643.8858	1643.8858	R	T	359	373
PSM	LRYPINEEALEK	1082	sp|P19174|PLCG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6047	37.613	2	1473.7827	1473.7827	K	I	752	764
PSM	LVINGNPITIFQERDPSK	1083	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10199	63.404	2	2040.1004	2040.1004	K	I	25	43
PSM	LVLEVAQHLGESTVR	1084	sp|P06576|ATPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8106	50.07	3	1649.9101	1649.9101	R	T	95	110
PSM	MFEIVFEDPKIPGEK	1085	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:35	ms_run[2]:scan=9893	61.42	2	1793.891	1793.8910	K	Q	1251	1266
PSM	MFVGGLSWDTSKK	1086	sp|Q99729-3|ROAA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=8135	50.255	2	1466.763	1466.7630	K	D	72	85
PSM	MKEIAEAYLGK	1087	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:35,2-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=4342	27.58	2	1279.6885	1279.6885	K	T	127	138
PSM	MMANGILKVPAINVNDSVTK	1088	sp|P23526|SAHH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:35	ms_run[2]:scan=8716	53.846	3	2130.1177	2130.1177	K	S	167	187
PSM	MMANGILKVPAINVNDSVTK	1089	sp|P23526|SAHH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	8-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=9383	58.131	3	2126.163	2126.1630	K	S	167	187
PSM	MNVDQAFHELVR	1090	sp|P62070-3|RRAS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9874	61.295	2	1457.7085	1457.7085	R	V	127	139
PSM	MQKEITALAPSTMK	1091	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:35,13-UNIMOD:35	ms_run[2]:scan=3566	23.135	2	1579.795	1579.7950	R	I	313	327
PSM	NAAGALDLLKELK	1092	sp|P23193|TCEA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	10-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=10311	64.128	2	1366.8223	1366.8223	K	N	20	33
PSM	NCLTNFHGMDLTR	1093	sp|P61247|RS3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	2-UNIMOD:4	ms_run[2]:scan=7430	45.916	2	1577.7079	1577.7079	K	D	95	108
PSM	NDEELNKLLGR	1094	sp|P04908|H2A1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7208	44.567	2	1299.6783	1299.6783	R	V	90	101
PSM	NEDLLEVGSRPGPASQLPR	1095	sp|Q96P11-3|NSUN5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7394	45.704	3	2034.0494	2034.0494	R	F	61	80
PSM	NEVDMQVLHLLGPK	1096	sp|P47897-2|SYQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10253	63.754	2	1591.8392	1591.8392	K	L	156	170
PSM	NFVVVMVTKPK	1097	sp|P54727|RD23B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	9-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=6678	41.329	2	1272.7667	1272.7667	K	A	68	79
PSM	NIYVLQELDNPGAKR	1098	sp|P12956|XRCC6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8453	52.194	2	1728.9159	1728.9159	K	I	101	116
PSM	NKLAELEEALQK	1099	sp|P13647|K2C5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	2-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=8198	50.646	2	1396.7965	1396.7965	R	A	430	442
PSM	NKYQELINDIAR	1100	sp|P46940|IQGA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8400	51.871	2	1475.7732	1475.7732	K	D	1476	1488
PSM	NPELSTQLIDIIHTAAAR	1101	sp|Q9NXF1-2|TEX10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=12254	77.095	2	1962.0534	1962.0534	R	A	569	587
PSM	PLRPQVVTDDDGQAPEAK	1102	sp|Q9HDC9-2|APMAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=3960	25.389	3	1934.9698	1934.9698	R	D	12	30
PSM	QFNYTHICAGASAFGK	1103	sp|P13804-2|ETFA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	8-UNIMOD:4	ms_run[2]:scan=7175	44.369	2	1770.8148	1770.8148	K	N	53	69
PSM	QLLTDFCTHLPNLPDSTAK	1104	sp|Q9BT78-2|CSN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	7-UNIMOD:4,19-UNIMOD:188	ms_run[2]:scan=10180	63.283	2	2176.093	2176.0930	R	E	64	83
PSM	RATVLESEGTR	1105	sp|Q9UJZ1-2|STML2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=1625	12.049	2	1217.6364	1217.6364	K	E	156	167
PSM	RPSAAPASQQLQSLESK	1106	sp|Q9Y653-5|AGRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5001	31.463	3	1796.9381	1796.9381	R	L	24	41
PSM	RQDFNPCEYDLK	1107	sp|Q9BZE9|ASPC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	7-UNIMOD:4	ms_run[2]:scan=5899	36.727	2	1583.7038	1583.7038	R	F	42	54
PSM	RTVQSLEIDLDSMR	1108	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:35	ms_run[2]:scan=6624	41.011	2	1677.8356	1677.8356	R	N	301	315
PSM	RVELLQDELALSEPR	1109	sp|Q6ZMI0-5|PPR21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:267,15-UNIMOD:267	ms_run[2]:scan=8778	54.236	2	1786.9692	1786.9692	K	G	72	87
PSM	RYDGSQQALDLK	1110	sp|Q9UBU9-2|NXF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=3812	24.553	2	1392.6997	1392.6997	K	G	219	231
PSM	SAPSIPKENFSCLTR	1111	sp|P40925-2|MDHC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:4	ms_run[2]:scan=6676	41.318	2	1705.8458	1705.8458	K	L	54	69
PSM	SILKIDDVVNTR	1112	sp|P50991-2|TCPD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7165	44.31	2	1371.7722	1371.7722	R	-	498	510
PSM	SIYGERFPDENFK	1113	sp|P23284|PPIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6916	42.811	2	1600.7522	1600.7522	K	L	117	130
PSM	SKDIVLVAYSALGSQR	1114	sp|P42330|AK1C3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9422	58.387	2	1705.9363	1705.9363	K	D	208	224
PSM	SKIEDYFPEFAR	1115	sp|P63092-3|GNAS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9521	59.01	2	1500.7249	1500.7249	K	Y	291	303
PSM	SKLSQNNFALGYK	1116	sp|Q9Y277|VDAC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	2-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=5453	34.115	2	1480.8077	1480.8077	K	A	162	175
PSM	SLGTADVHFER	1117	sp|Q86V81|THOC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=4965	31.254	2	1230.5993	1230.5993	R	K	145	156
PSM	SLTNDWEDHLAVK	1118	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7646	47.226	2	1526.7365	1526.7365	K	H	307	320
PSM	SLVEIIEHGLVDEQQK	1119	sp|O75533|SF3B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11832	74.247	2	1835.9629	1835.9629	R	V	685	701
PSM	SNMGHPEPASGLAALAK	1120	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	3-UNIMOD:35,17-UNIMOD:188	ms_run[2]:scan=5484	34.288	2	1671.8346	1671.8346	K	V	327	344
PSM	SRAEAALEEESR	1121	sp|Q969G3-6|SMCE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=2436	16.661	2	1346.6426	1346.6426	K	Q	77	89
PSM	SSTATHPPGPAVQLNK	1122	sp|Q14684-2|RRP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	16-UNIMOD:188	ms_run[2]:scan=3375	22.038	2	1609.8519	1609.8519	K	T	643	659
PSM	SVFALTNGIYPHK	1123	sp|Q02878|RL6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8389	51.807	2	1445.7667	1445.7667	R	L	273	286
PSM	SYDVPPPPMEPDHPFYSNISK	1124	sp|Q8N0Y7|PGAM4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	9-UNIMOD:35,21-UNIMOD:188	ms_run[2]:scan=7337	45.344	2	2438.1196	2438.1196	R	D	118	139
PSM	TIAIIAEGIPEALTRK	1125	sp|P53396|ACLY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10429	64.882	2	1694.9931	1694.9931	R	L	593	609
PSM	TLSLHYFEEPELR	1126	sp|Q10570|CPSF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9183	56.859	2	1632.8148	1632.8148	K	D	117	130
PSM	VDINAPDVGVQGPDWHLK	1127	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	18-UNIMOD:188	ms_run[2]:scan=8630	53.317	3	1965.0052	1965.0052	K	M	2620	2638
PSM	VIKDFMIQGGDFTR	1128	sp|P23284|PPIB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8192	50.606	2	1625.8236	1625.8236	R	G	96	110
PSM	VLKQELGGLGISIK	1129	sp|Q13884-2|SNTB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8052	49.747	2	1453.8868	1453.8868	K	G	115	129
PSM	VRGDINVLLCGDPGTAK	1130	sp|P49736|MCM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	10-UNIMOD:4	ms_run[2]:scan=7081	43.788	2	1783.9251	1783.9251	K	S	513	530
PSM	VVLDDKDYFLFR	1131	sp|P61604|CH10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10051	62.442	2	1528.7926	1528.7926	K	D	81	93
PSM	YPIEHGIITNWDDMEK	1132	sp|P63267|ACTH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	16-UNIMOD:188	ms_run[2]:scan=8513	52.58	2	1965.9238	1965.9238	K	I	70	86
PSM	VKLEAEIATYR	1133	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	2-UNIMOD:188,11-UNIMOD:267	ms_run[1]:scan=5962	37.09432833333333	2	1307.741275	1307.742000	K	R	371	382
PSM	VKLEAEIATYR	1134	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=5969	37.136625	2	1291.713642	1291.713602	K	R	371	382
PSM	MKEIAEAYLGK	1135	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	1-UNIMOD:35	ms_run[1]:scan=4346	27.604163333333336	2	1267.646687	1267.648225	K	T	127	138
PSM	ANTFVAELKGLDPAR	1136	sp|P40926|MDHM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	9-UNIMOD:188,15-UNIMOD:267	ms_run[1]:scan=9482	58.764738333333334	2	1616.892243	1616.885704	R	V	177	192
PSM	QQHVIETLIGKK	1137	sp|P48643|TCPE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:28,11-UNIMOD:188,12-UNIMOD:188	ms_run[1]:scan=7874	48.64145833333333	2	1387.8208	1387.8221	K	Q	503	515
PSM	SGYLAGDKLLPQR	1138	sp|P26038|MOES_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	8-UNIMOD:188,13-UNIMOD:267	ms_run[1]:scan=6279	38.981285	2	1432.799989	1432.800912	K	V	144	157
PSM	CQHAAEIITDLLR	1139	sp|Q96AE4|FUBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:385,1-UNIMOD:4,13-UNIMOD:267	ms_run[1]:scan=12829	81.46901166666667	2	1531.7664	1531.7687	R	S	332	345
PSM	NRPSSGSLIQVVTTEGR	1140	sp|P09417|DHPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	2-UNIMOD:267,17-UNIMOD:267	ms_run[1]:scan=7162	44.287056666666665	2	1819.966492	1819.965513	K	T	220	237
PSM	YGVIILDEAHER	1141	sp|O43143|DHX15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=6882	42.59343333333333	2	1413.718562	1413.725229	R	T	254	266
PSM	TPTQTNGSNVPFKPR	1142	sp|P78347|GTF2I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	13-UNIMOD:188,15-UNIMOD:267	ms_run[1]:scan=3761	24.254751666666667	2	1659.856351	1658.871116	R	G	703	718
PSM	TPTQTNGSNVPFKPR	1143	sp|P78347|GTF2I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=3771	24.31405	2	1643.827652	1642.842718	R	G	703	718
PSM	QLDDLKVELSQLR	1144	sp|P42766|RL35_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:28,6-UNIMOD:188,13-UNIMOD:267	ms_run[1]:scan=11617	72.79545333333333	2	1554.8542	1554.8583	K	V	20	33
PSM	DRWEEAGPPSALSSSAPGQGPEADGQWASADFR	1145	sp|Q9BTC0|DIDO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	2-UNIMOD:267,33-UNIMOD:267	ms_run[1]:scan=9209	57.028615	3	3448.538832	3448.545928	K	E	2039	2072
PSM	KMVQQSDLGQYVTFLR	1146	sp|Q9H553|ALG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=9998	62.10102166666667	2	1912.980010	1911.987668	K	S	286	302
PSM	NHTLALTETGSVFAFGENK	1147	sp|Q9P258|RCC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=9566	59.301175	2	2035.000864	2035.001070	R	M	212	231
PSM	AAGKGPLATGGIK	1148	sp|Q9Y2S6|TMA7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	4-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=2657	17.912	2	1151.7065	1151.7065	K	K	47	60
PSM	AFHNEAQVNPER	1149	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:267	ms_run[2]:scan=2105	14.779	2	1420.6723	1420.6723	R	K	469	481
PSM	AFLSTHPNTETVFEAFLK	1150	sp|Q96S44|PRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	18-UNIMOD:188	ms_run[2]:scan=12203	76.76	2	2057.0565	2057.0565	K	S	206	224
PSM	AFTGREFDELNPSAQR	1151	sp|P16615-5|AT2A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6929	42.891	2	1836.8755	1836.8755	K	D	651	667
PSM	AGAGLSSLCLVLSTRPHS	1152	sp|O95865|DDAH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	9-UNIMOD:4	ms_run[2]:scan=9863	61.225	3	1824.9516	1824.9516	K	-	268	286
PSM	AHNNELEPTPGNTLR	1153	sp|P24928|RPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	15-UNIMOD:267	ms_run[2]:scan=3828	24.649	2	1671.8204	1671.8204	K	Q	720	735
PSM	AHTMTDDVTFWK	1154	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:188	ms_run[2]:scan=7733	47.754	2	1456.6752	1456.6752	K	W	101	113
PSM	AIEPPPLDAVIEAEHTLR	1155	sp|Q08211|DHX9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11553	72.362	2	1970.0473	1970.0473	K	E	820	838
PSM	AKPAMPQDSVPSPR	1156	sp|P53396|ACLY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=3624	23.466	2	1479.7504	1479.7504	K	S	470	484
PSM	ALFAGDIEEMEERR	1157	sp|Q9BQ52-3|RNZ2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:267,14-UNIMOD:267	ms_run[2]:scan=8524	52.647	2	1684.7994	1684.7994	K	E	397	411
PSM	ALLEKVPAELICLDPR	1158	sp|O15213|WDR46_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:4	ms_run[2]:scan=10656	66.36	2	1836.0179	1836.0179	K	A	504	520
PSM	ALPFWNEEIVPQIKEGK	1159	sp|Q8N0Y7|PGAM4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	14-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=11112	69.395	2	2009.1025	2009.1025	R	R	163	180
PSM	AQIHDLVLVGGSTR	1160	sp|P0DMV8-2|HS71A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	14-UNIMOD:267	ms_run[2]:scan=6354	39.414	2	1474.8131	1474.8131	K	I	274	288
PSM	AQVARPGGDTIFGK	1161	sp|P49773|HINT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	14-UNIMOD:188	ms_run[2]:scan=4790	30.175	2	1421.7722	1421.7722	K	I	8	22
PSM	DKLNNLVLFDK	1162	sp|P62851|RS25_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=8254	50.981	2	1329.7695	1329.7695	R	A	42	53
PSM	DQLRPTQLLQNVAR	1163	sp|Q9NZM1-2|MYOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8182	50.546	2	1650.9166	1650.9166	R	F	1627	1641
PSM	EADGILKPLPK	1164	sp|P49588|SYAC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5092	31.993	2	1179.6863	1179.6863	R	K	225	236
PSM	EFTQGVKPDWTIAR	1165	sp|Q8WWC4|MAIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7250	44.829	2	1646.8417	1646.8417	R	I	270	284
PSM	EKIGPIATPDYIQNAPGLPK	1166	sp|Q9NR19|ACSA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=9011	55.698	2	2133.1873	2133.1873	R	T	637	657
PSM	ELKENGELLPILR	1167	sp|O76003|GLRX3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8963	55.402	2	1522.8719	1522.8719	K	G	320	333
PSM	ELLNPVVEFVSHPSTTCR	1168	sp|P78527-2|PRKDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	17-UNIMOD:4,18-UNIMOD:267	ms_run[2]:scan=10637	66.238	2	2094.0443	2094.0443	R	E	2453	2471
PSM	EYFSWEGAFQHVGK	1169	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9986	62.025	2	1683.7682	1683.7682	R	A	415	429
PSM	FEDHEGLPTVVK	1170	sp|P49589-2|SYCC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:188	ms_run[2]:scan=5491	34.333	2	1375.7079	1375.7079	R	L	629	641
PSM	FGTVLTEHVAAAELGAR	1171	sp|O43598-2|DNPH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8140	50.282	3	1740.9159	1740.9159	R	G	49	66
PSM	FIHQQPQSSSPVYGSSAK	1172	sp|P49023-2|PAXI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	18-UNIMOD:188	ms_run[2]:scan=3312	21.675	3	1952.9688	1952.9688	R	T	76	94
PSM	FKATISALEAK	1173	sp|P35580|MYH10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5569	34.791	2	1177.6707	1177.6707	K	I	1812	1823
PSM	FKDPGLVDQLVK	1174	sp|P49591|SYSC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7734	47.759	2	1357.7606	1357.7606	R	A	27	39
PSM	FLIPNASQAESKVFYLK	1175	sp|P63104-2|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=10459	65.075	2	1966.0967	1966.0967	K	M	29	46
PSM	FLPAVSDENSKR	1176	sp|P46087-2|NOP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=3726	24.045	2	1361.6939	1361.6939	R	L	31	43
PSM	GAIREYQTQLIQR	1177	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	4-UNIMOD:267,13-UNIMOD:267	ms_run[2]:scan=5215	32.72	2	1594.8694	1594.8694	R	V	599	612
PSM	GAIREYQTQLIQR	1178	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5221	32.754	2	1574.8529	1574.8529	R	V	599	612
PSM	GAVHQLCQSLAGK	1179	sp|P09417-2|DHPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	7-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=4207	26.827	2	1373.7181	1373.7181	K	N	124	137
PSM	GCLELIKETGVPIAGR	1180	sp|P11586|C1TC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:4	ms_run[2]:scan=8211	50.711	3	1711.9291	1711.9291	K	H	151	167
PSM	GEGAGPPPPLPPAQPGAEGGGDR	1181	sp|Q9NVI7-2|ATD3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=4934	31.07	2	2079.9974	2079.9974	K	G	13	36
PSM	GFKDQIYDIFQK	1182	sp|P60842-2|IF4A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9983	62.003	2	1500.7613	1500.7613	R	L	191	203
PSM	GGSRGEEVGELSR	1183	sp|P09543-2|CN37_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	4-UNIMOD:267,13-UNIMOD:267	ms_run[2]:scan=2159	15.087	2	1351.6595	1351.6595	K	G	337	350
PSM	GIVEFSGKPAAR	1184	sp|Q15233-2|NONO_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=4104	26.238	2	1230.6721	1230.6721	K	K	102	114
PSM	GKGFSVVADTPELQR	1185	sp|Q14847-3|LASP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6398	39.663	3	1602.8366	1602.8366	K	I	39	54
PSM	GPNVFQGYLKDPAK	1186	sp|P33121|ACSL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7295	45.095	2	1532.7987	1532.7987	K	T	512	526
PSM	GSIFVVFDSIESAKK	1187	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	14-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=11484	71.893	2	1637.9067	1637.9067	K	F	152	167
PSM	GYAFNHSADFETVR	1188	sp|P61160|ARP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	14-UNIMOD:267	ms_run[2]:scan=6159	38.25	3	1622.7353	1622.7353	R	M	201	215
PSM	HFEATDILVSK	1189	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6704	41.481	2	1258.6558	1258.6558	R	I	1175	1186
PSM	HLTPEPDIVASTK	1190	sp|Q5JSH3-4|WDR44_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:188	ms_run[2]:scan=4607	29.142	2	1412.7607	1412.7607	R	K	192	205
PSM	HNNLYLVATSK	1191	sp|Q9BXS5|AP1M1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=4528	28.681	2	1258.667	1258.6670	K	K	62	73
PSM	HPDASVNFSEFSK	1192	sp|P09429|HMGB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6137	38.127	2	1463.6681	1463.6681	K	K	31	44
PSM	HPESNTAGMDIFAK	1193	sp|Q9Y696|CLIC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	14-UNIMOD:188	ms_run[2]:scan=6074	37.767	2	1522.7182	1522.7182	K	F	111	125
PSM	HPSAVTACNLDLENLITDSNR	1194	sp|Q9UBF2-2|COPG2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	8-UNIMOD:4,21-UNIMOD:267	ms_run[2]:scan=10091	62.702	2	2349.1258	2349.1258	K	S	318	339
PSM	HQEPVYSVAFSPDGR	1195	sp|Q9BZK7|TBL1R_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6409	39.728	2	1687.7954	1687.7954	K	Y	441	456
PSM	HSEAFEALQQK	1196	sp|Q07065|CKAP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:188	ms_run[2]:scan=3861	24.838	2	1292.6456	1292.6456	R	S	395	406
PSM	HVEAVYIDIADR	1197	sp|Q00169|PIPNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6719	41.566	2	1399.7096	1399.7096	K	S	135	147
PSM	HVLTGSADNSCR	1198	sp|Q13347|EIF3I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=904	8.2325	2	1325.6022	1325.6022	K	L	66	78
PSM	HVQSLEPDPGTPGSER	1199	sp|Q9NX46|ARHL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=3299	21.598	2	1704.8067	1704.8067	R	T	54	70
PSM	HVVPNEVVVQR	1200	sp|P06396-2|GELS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:267	ms_run[2]:scan=3479	22.636	2	1284.7178	1284.7178	K	L	127	138
PSM	IAVHPDYQGMGYGSR	1201	sp|Q9H0A0-2|NAT10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5226	32.785	3	1649.762	1649.7620	R	A	557	572
PSM	ICVNGDDAHPLWK	1202	sp|P36969-2|GPX4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=6325	39.244	2	1529.7392	1529.7392	K	W	106	119
PSM	IDIQIKDAIGR	1203	sp|P26639|SYTC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6765	41.848	2	1240.7139	1240.7139	K	Y	544	555
PSM	IENLSNLHQLQMLELGSNR	1204	sp|Q15435-5|PP1R7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	19-UNIMOD:267	ms_run[2]:scan=9959	61.851	3	2218.1404	2218.1404	K	I	120	139
PSM	IFHTVTTTDDPVIR	1205	sp|O15371-2|EIF3D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	14-UNIMOD:267	ms_run[2]:scan=5838	36.381	3	1623.8496	1623.8496	R	K	174	188
PSM	IFHTVTTTDDPVIR	1206	sp|O15371-2|EIF3D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	14-UNIMOD:267	ms_run[2]:scan=5863	36.51	2	1623.8496	1623.8496	R	K	174	188
PSM	IFSGSSHQDLSQK	1207	sp|P60891|PRPS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=2481	16.915	2	1432.6947	1432.6947	K	I	6	19
PSM	IFVGGIKEDTEEYNLR	1208	sp|P51991-2|ROA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7535	46.533	3	1881.9472	1881.9472	K	D	106	122
PSM	IGRIEDVTPIPSDSTR	1209	sp|P62263|RS14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6027	37.494	2	1754.9163	1754.9163	K	R	126	142
PSM	IHMGSCAENTAK	1210	sp|P24752|THIL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	6-UNIMOD:4	ms_run[2]:scan=1263	10.071	2	1317.5806	1317.5806	K	K	191	203
PSM	IHVLEAQDLIAK	1211	sp|Q9BSJ8|ESYT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:188	ms_run[2]:scan=7445	46.008	2	1354.7916	1354.7916	R	D	651	663
PSM	IKAEYEGDGIPTVFVAVAGR	1212	sp|P22234|PUR6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10175	63.253	3	2091.1001	2091.1001	R	S	312	332
PSM	IKAEYEGDGIPTVFVAVAGR	1213	sp|P22234|PUR6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:188,20-UNIMOD:267	ms_run[2]:scan=10185	63.318	2	2107.1285	2103.1403	R	S	312	332
PSM	ILNLSGNELKSER	1214	sp|Q9UBU9-2|NXF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5656	35.301	2	1471.7995	1471.7995	K	E	295	308
PSM	IMNVIGEPIDERGPIK	1215	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:35	ms_run[2]:scan=6587	40.799	3	1795.9502	1795.9502	R	T	144	160
PSM	INSGGKLPNFGFVVFDDSEPVQK	1216	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	6-UNIMOD:188,23-UNIMOD:188	ms_run[2]:scan=11335	70.891	3	2505.2942	2505.2942	R	V	371	394
PSM	IQFKPDDGTTPER	1217	sp|Q96AE4|FUBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=3824	24.628	2	1502.7365	1502.7365	R	I	309	322
PSM	IQVLVEPDHFK	1218	sp|P17931|LEG3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:188	ms_run[2]:scan=6632	41.056	2	1329.7388	1329.7388	K	V	200	211
PSM	IRELESQISELQEDLESER	1219	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10885	67.891	2	2302.1288	2302.1288	K	A	1106	1125
PSM	IRLEETLEQLAK	1220	sp|P22059|OSBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9283	57.496	2	1441.814	1441.8140	R	Q	302	314
PSM	ISHGEVLEWQK	1221	sp|Q9BXP5-5|SRRT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:188	ms_run[2]:scan=5235	32.838	2	1330.6977	1330.6977	R	T	617	628
PSM	ISMPEVDLNLKGPK	1222	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=8426	52.025	2	1551.8733	1551.8733	K	M	4129	4143
PSM	ISSIQSIVPALEIANAHR	1223	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	18-UNIMOD:267	ms_run[2]:scan=10588	65.913	2	1928.0719	1928.0719	K	K	251	269
PSM	IVGPSGAAVPCKVEPGLGADNSVVR	1224	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:4	ms_run[2]:scan=6886	42.622	3	2448.2795	2448.2795	K	F	1008	1033
PSM	IVSGIITPIHEQWEK	1225	sp|Q92530|PSMF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8085	49.947	2	1748.9461	1748.9461	R	A	134	149
PSM	KASGPPVSELITK	1226	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=5191	32.584	3	1337.7957	1337.7957	R	A	34	47
PSM	KATGPPVSELITK	1227	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=5415	33.903	3	1351.8114	1351.8114	R	A	37	50
PSM	KEFSPFGSITSAK	1228	sp|Q13310-2|PABP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7060	43.668	2	1397.7191	1397.7191	R	V	312	325
PSM	KFIAYQFTDTPLQIK	1229	sp|O00267-2|SPT5H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9836	61.053	3	1811.9822	1811.9822	R	S	195	210
PSM	KFLDGIYVSEK	1230	sp|P32969|RL9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6710	41.516	2	1297.6918	1297.6918	R	G	174	185
PSM	KGAYDIFLNAK	1231	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=7401	45.748	2	1250.7062	1250.7062	K	E	1049	1060
PSM	KGAYDIFLNAK	1232	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7402	45.753	2	1238.6659	1238.6659	K	E	1049	1060
PSM	KGLDPYNVLAPK	1233	sp|P10606|COX5B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=6980	43.205	2	1325.7746	1325.7746	K	G	57	69
PSM	KICYQEVSQCFGVLSSR	1234	sp|Q16531|DDB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=8651	53.443	3	2059.9819	2059.9819	R	I	723	740
PSM	KLSLGQYDNDAGGQLPFSK	1235	sp|Q68CZ2-2|TENS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8130	50.222	3	2037.0167	2037.0167	R	C	534	553
PSM	KLVIVGDGACGK	1236	sp|P61586|RHOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	10-UNIMOD:4	ms_run[2]:scan=3556	23.08	2	1215.6645	1215.6645	K	T	7	19
PSM	KNILLTIGSYK	1237	sp|P27708|PYR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=7965	49.211	2	1260.7844	1260.7844	K	N	1313	1324
PSM	KVCDIAAELAR	1238	sp|O00410-2|IPO5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:4	ms_run[2]:scan=6092	37.873	2	1244.6547	1244.6547	K	N	48	59
PSM	KVEDLFLTFAK	1239	sp|Q13813-3|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10257	63.782	2	1309.7282	1309.7282	R	K	2068	2079
PSM	LDLAGRDLTDYLMK	1240	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10383	64.583	2	1622.8338	1622.8338	R	I	178	192
PSM	LEGVLAEVAQHYQDTLIR	1241	sp|P46940|IQGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11974	75.217	3	2054.0797	2054.0797	K	A	568	586
PSM	LFEYRNQGDEEGTEIDTLQFR	1242	sp|O15160-2|RPAC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9157	56.69	3	2559.1878	2559.1878	R	L	121	142
PSM	LFTAESLIGLKNPEK	1243	sp|P48444-2|COPD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9335	57.83	2	1658.9243	1658.9243	K	S	249	264
PSM	LGRIEADSESQEDIIR	1244	sp|P55957|BID_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5604	34.999	3	1829.9119	1829.9119	R	N	69	85
PSM	LGSAVVTRGDECGLALGR	1245	sp|P54886-2|P5CS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:4	ms_run[2]:scan=6121	38.036	2	1829.9418	1829.9418	K	L	77	95
PSM	LHEENFEITTLR	1246	sp|Q96Q11-2|TRNT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:267	ms_run[2]:scan=7130	44.093	2	1510.7655	1510.7655	R	I	115	127
PSM	LHVGNISPTCTNK	1247	sp|Q9BWF3|RBM4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	10-UNIMOD:4	ms_run[2]:scan=3677	23.764	2	1439.7191	1439.7191	K	E	80	93
PSM	LIQLMEEIMAEKENK	1248	sp|Q92841|DDX17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10670	66.453	3	1817.9267	1817.9267	K	T	406	421
PSM	LKPEDITQIQPQQLVLR	1249	sp|P05556-2|ITB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9647	59.834	3	2018.1524	2018.1524	K	L	106	123
PSM	LKVGLQVVAVK	1250	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=6468	40.084	2	1164.7997	1164.7997	R	A	291	302
PSM	LMEVMNHVLGK	1251	sp|P09327|VILI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7486	46.238	2	1269.6573	1269.6573	K	R	222	233
PSM	LNENHSGELWK	1252	sp|Q13418-3|ILK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:188	ms_run[2]:scan=3918	25.148	2	1331.6565	1331.6565	K	G	65	76
PSM	LQAEIEGLKGQR	1253	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=4277	27.225	2	1340.7412	1340.7412	R	A	317	329
PSM	LRITESEEVVSR	1254	sp|P02545-2|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=4695	29.652	2	1416.7573	1416.7573	R	E	61	73
PSM	LSAEAEKVLALPEPSPAAPTLR	1255	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8994	55.589	2	2259.2474	2259.2474	R	S	1011	1033
PSM	LSFQHDPETSVLVLR	1256	sp|Q14697|GANAB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8612	53.204	3	1739.9206	1739.9206	R	K	915	930
PSM	LVNLKELADEALQK	1257	sp|Q9NR19|ACSA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10639	66.25	3	1582.893	1582.8930	K	C	223	237
PSM	MALNHPYFNDLDNQIK	1258	sp|P06493-2|CDK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8160	50.406	3	1931.92	1931.9200	K	K	223	239
PSM	MDSFDEDLARPSGLLAQER	1259	sp|Q9Y2W1|TR150_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:35	ms_run[2]:scan=8598	53.113	2	2165.0059	2165.0059	R	K	573	592
PSM	MSMKEVDEQMLNVQNK	1260	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:35,4-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=6015	37.418	2	1950.9252	1950.9252	R	N	321	337
PSM	MTGTLETQFTCPFCNHEK	1261	sp|P60002|ELOF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:35,11-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=7631	47.135	2	2215.9337	2215.9337	K	S	16	34
PSM	NDSVIVDTFHGLFK	1262	sp|Q13107-2|UBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	14-UNIMOD:188	ms_run[2]:scan=11744	73.649	2	1596.8243	1596.8243	R	S	396	410
PSM	NEVDMQVLHLLGPK	1263	sp|P47897-2|SYQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	14-UNIMOD:188	ms_run[2]:scan=10259	63.793	2	1597.8593	1597.8593	K	L	156	170
PSM	NILFVITKPDVYK	1264	sp|Q9BZK3|NACP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	8-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=9627	59.702	2	1560.9318	1560.9318	K	S	100	113
PSM	NKLAELEEALQK	1265	sp|P13647|K2C5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:188	ms_run[2]:scan=8228	50.816	2	1390.7763	1390.7763	R	A	430	442
PSM	NLDIERPTYTNLNR	1266	sp|P68366-2|TBA4A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	6-UNIMOD:267,14-UNIMOD:267	ms_run[2]:scan=6199	38.482	2	1737.8913	1737.8913	R	L	201	215
PSM	NLHQSGFSLSGAQIDDNIPR	1267	sp|Q16555|DPYL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	20-UNIMOD:267	ms_run[2]:scan=8086	49.953	3	2178.0693	2178.0693	R	R	533	553
PSM	NSSYFVEWIPNNVK	1268	sp|Q13509-2|TBB3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	14-UNIMOD:188	ms_run[2]:scan=10843	67.613	2	1701.8458	1701.8458	K	V	265	279
PSM	QAIKELPQFATGENLPR	1269	sp|Q9BZZ5-1|API5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7769	47.982	2	1911.0214	1911.0214	R	V	9	26
PSM	QFNYTHICAGASAFGK	1270	sp|P13804-2|ETFA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	8-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=7171	44.342	2	1776.8349	1776.8349	K	N	53	69
PSM	QGDTGDWIGTFLGHK	1271	sp|Q9Y3F4|STRAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	15-UNIMOD:188	ms_run[2]:scan=10917	68.105	2	1636.7941	1636.7941	R	G	45	60
PSM	QKISFLENNLEQLTK	1272	sp|P33176|KINH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=9746	60.46	2	1816.0133	1816.0133	K	V	830	845
PSM	QLREYQELMNVK	1273	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6868	42.509	2	1549.7923	1549.7923	R	L	370	382
PSM	QVEPLDPPAGSAPGEHVFVK	1274	sp|P54577|SYYC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7010	43.374	3	2073.0531	2073.0531	R	G	451	471
PSM	REPLPSLEAVYLITPSEK	1275	sp|P61764|STXB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10767	67.112	2	2041.1096	2041.1096	R	S	65	83
PSM	RFDDAVVQSDMK	1276	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=4716	29.762	2	1409.6609	1409.6609	R	H	77	89
PSM	RLAPEYEAAATR	1277	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=3239	21.264	2	1346.6943	1346.6943	K	L	62	74
PSM	RLEAELETVSR	1278	sp|Q9UDT6-2|CLIP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=4693	29.637	2	1301.6939	1301.6939	R	K	841	852
PSM	RTEEGPTLSYGR	1279	sp|P43243|MATR3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=3308	21.649	2	1364.6684	1364.6684	R	D	149	161
PSM	RTGAIVDVPVGEELLGR	1280	sp|P25705-2|ATPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9397	58.223	3	1779.9843	1779.9843	K	V	83	100
PSM	SDFGKFVLSSGK	1281	sp|P27797|CALR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6762	41.827	2	1270.6558	1270.6558	K	F	44	56
PSM	SFTETMSSLSPGKPWQTK	1282	sp|Q9HB07|MYG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=8195	50.624	2	2023.0123	2023.0123	R	L	111	129
PSM	SIYGERFPDENFK	1283	sp|P23284|PPIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6747	41.741	2	1600.7522	1600.7522	K	L	117	130
PSM	SKESVPEFPLSPPK	1284	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7009	43.369	2	1540.8137	1540.8137	R	K	28	42
PSM	SLDMDSIIAEVK	1285	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10864	67.757	2	1319.6643	1319.6643	R	A	253	265
PSM	SLTNDWEDHLAVK	1286	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:188	ms_run[2]:scan=7638	47.177	2	1532.7567	1532.7567	K	H	307	320
PSM	SMVEVLADHPGELVR	1287	sp|Q01196-6|RUNX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8330	51.447	2	1650.8399	1650.8399	R	T	50	65
PSM	SNPFAHLAEPLDPVQPGKK	1288	sp|P21399|ACOC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:1,18-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=9968	61.908	3	2098.125	2098.1250	M	F	2	21
PSM	SQLDIIIHSLK	1289	sp|P13010|XRCC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:188	ms_run[2]:scan=9744	60.449	2	1271.7545	1271.7545	K	K	145	156
PSM	SRPNASGGAACSGPGPEPAVFCEPVVK	1290	sp|Q6L8Q7-2|PDE12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:267,11-UNIMOD:4,22-UNIMOD:4,27-UNIMOD:188	ms_run[2]:scan=6878	42.57	3	2713.2923	2709.3042	K	L	98	125
PSM	SWEEQMIEVGRK	1291	sp|Q00059|TFAM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7497	46.306	2	1490.7188	1490.7188	K	D	217	229
PSM	TIAEQLAEKINAK	1292	sp|Q7L014|DDX46_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7518	46.429	2	1427.7984	1427.7984	K	L	895	908
PSM	TLHSTFQPNISQGK	1293	sp|Q9NZM1-2|MYOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=4312	27.409	2	1556.7947	1556.7947	R	L	1704	1718
PSM	TLVGICSEHQSR	1294	sp|Q9H3U1-2|UN45A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	6-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=3150	20.735	2	1395.6804	1395.6804	R	T	203	215
PSM	TLVGICSEHQSR	1295	sp|Q9H3U1-2|UN45A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	6-UNIMOD:4	ms_run[2]:scan=3154	20.756	2	1385.6721	1385.6721	R	T	203	215
PSM	TPGNNLHEVETAQGQR	1296	sp|Q8N9N8|EIF1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	16-UNIMOD:267	ms_run[2]:scan=2991	19.83	3	1759.8477	1759.8477	R	F	33	49
PSM	TPGNNLHEVETAQGQR	1297	sp|Q8N9N8|EIF1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=2994	19.846	3	1749.8394	1749.8394	R	F	33	49
PSM	TPTQTNGSNVPFKPR	1298	sp|P78347-2|GTF2I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=3462	22.537	2	1642.8427	1642.8427	R	G	662	677
PSM	TPVEPEVAIHR	1299	sp|P60866|RS20_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=4061	25.987	2	1246.667	1246.6670	K	I	9	20
PSM	TRIIDVVYNASNNELVR	1300	sp|P62241|RS8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:267,17-UNIMOD:267	ms_run[2]:scan=9161	56.718	3	1995.0652	1995.0652	K	T	76	93
PSM	TYQELLVNQNPIAQPLASRR	1301	sp|Q9NX24|NHP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	19-UNIMOD:267,20-UNIMOD:267	ms_run[2]:scan=8623	53.271	3	2330.261	2330.2610	R	L	23	43
PSM	VCAHITNIPFSITK	1302	sp|Q9NTZ6|RBM12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:4	ms_run[2]:scan=8075	49.891	2	1599.8443	1599.8443	K	M	544	558
PSM	VCDEPHPLLVK	1303	sp|P35250-2|RFC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:4	ms_run[2]:scan=4352	27.633	2	1305.6751	1305.6751	K	E	220	231
PSM	VETPSHPGGVSEEFWER	1304	sp|Q92620|PRP16_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7112	43.981	3	1941.8857	1941.8857	R	S	115	132
PSM	VGHSELVGEIIR	1305	sp|P38606-2|VATA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:267	ms_run[2]:scan=6407	39.717	2	1317.728	1317.7280	R	L	12	24
PSM	VKEIGSTMSGR	1306	sp|O00422|SAP18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=1721	12.602	2	1163.5969	1163.5969	R	K	103	114
PSM	VSFELFADKVPK	1307	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	9-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=8965	55.417	2	1390.7899	1390.7899	R	T	20	32
PSM	YGDFRADDADEFGYSR	1308	sp|Q7KZF4|SND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6787	41.984	2	1882.7758	1882.7758	R	-	895	911
PSM	YLGHVEVDESR	1309	sp|P49757-8|NUMB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:267	ms_run[2]:scan=3542	22.998	2	1312.6287	1312.6287	K	G	43	54
PSM	YRADTLGELDLER	1310	sp|Q86TX2|ACOT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7276	44.987	2	1549.7736	1549.7736	R	A	52	65
PSM	YWSTNAHEIEGTVFDR	1311	sp|Q9H4L5-2|OSBL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	16-UNIMOD:267	ms_run[2]:scan=8664	53.516	3	1933.8834	1933.8834	K	S	696	712
PSM	YYGGGSEGGRAPK	1312	sp|P14866|HNRPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=993	8.6853	2	1297.6051	1297.6051	R	R	47	60
PSM	YYRESADPLGAWLQDAR	1313	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10630	66.192	2	2009.9595	2009.9595	R	R	1179	1196
PSM	SLDMDSIIAEVK	1314	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	12-UNIMOD:188	ms_run[1]:scan=10872	67.80866333333333	2	1326.690631	1325.684397	R	A	253	265
PSM	QSVENDIHGLRK	1315	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:28,11-UNIMOD:267,12-UNIMOD:188	ms_run[1]:scan=4714	29.75317833333333	2	1393.7272	1393.7280	R	V	176	188
PSM	LFVGNLPADITEDEFKR	1316	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=10361	64.44481166666667	2	1963.007930	1963.005092	R	L	299	316
PSM	EKFENLGIQPPK	1317	sp|P17980|PRS6A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=6016	37.42481166666666	2	1398.747616	1398.750716	K	G	210	222
PSM	LKPNLGNGADLPNYR	1318	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	2-UNIMOD:188,15-UNIMOD:267	ms_run[1]:scan=6203	38.505134999999996	2	1657.8742	1656.8912	K	W	159	174
PSM	QTELFAHFIQPAAQK	1319	sp|O60264|SMCA5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:28,15-UNIMOD:188	ms_run[1]:scan=11388	71.25091833333333	2	1716.8890	1716.8926	K	T	98	113
PSM	AQHLSPAPGLAQPAAPAQASAAIPAAGK	1320	sp|Q9BW04|SARG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	28-UNIMOD:188	ms_run[1]:scan=6408	39.722496666666665	3	2567.386339	2567.391549	R	A	381	409
PSM	QLDDLKVELSQLR	1321	sp|P42766|RL35_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:28	ms_run[1]:scan=11618	72.8011	2	1538.8257	1538.8299	K	V	20	33
PSM	HVEAVYIDIADR	1322	sp|Q00169|PIPNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	12-UNIMOD:267	ms_run[1]:scan=6728	41.622890000000005	2	1410.728040	1409.717848	K	S	135	147
PSM	VGAHAGEYGAEALER	1323	sp|P69905|HBA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=4332	27.525221666666667	2	1528.726797	1528.727020	K	M	18	33
PSM	YFSLIPTGFADEDINKR	1324	sp|Q9HBU6|EKI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=11068	69.10437666666667	2	1984.987597	1984.989442	K	F	259	276
PSM	VAPEEHPTLLTEAPLNPK	1325	sp|P62736|ACTA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	18-UNIMOD:188	ms_run[1]:scan=7461	46.10308666666666	2	1961.025999	1961.056522	R	A	98	116
PSM	IQEFCNLHQSKEENLISS	1326	sp|P53384|NUBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	5-UNIMOD:4	ms_run[1]:scan=6553	40.598796666666665	2	2176.037449	2175.026633	R	-	303	321
PSM	AALQELLSKGLIK	1327	sp|P62851|RS25_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	9-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=10193	63.37	3	1394.89	1394.8900	R	L	86	99
PSM	AASTASHRPIK	1328	sp|Q6NXS1|IPP2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:1	ms_run[2]:scan=1086	9.1637	2	1179.636	1179.6360	M	G	2	13
PSM	ADEDPIMGFHQMFLLK	1329	sp|P61970|NTF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=12143	76.362	2	1890.9008	1890.9008	K	N	91	107
PSM	AENGKLVINGNPITIFQER	1330	sp|P04406-2|G3P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10116	62.867	3	2112.1328	2112.1328	K	D	20	39
PSM	AGKPVICATQMLESMIK	1331	sp|P14618-3|KPYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	7-UNIMOD:4	ms_run[2]:scan=11890	74.641	2	1875.962	1875.9620	R	K	305	322
PSM	AHSSMVGVNLPQK	1332	sp|P00558-2|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	5-UNIMOD:35	ms_run[2]:scan=3253	21.339	2	1382.6976	1382.6976	R	A	144	157
PSM	AHSSMVGVNLPQK	1333	sp|P00558-2|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	5-UNIMOD:35,13-UNIMOD:188	ms_run[2]:scan=3254	21.344	2	1388.7178	1388.7178	R	A	144	157
PSM	AHSSMVGVNLPQK	1334	sp|P00558-2|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:188	ms_run[2]:scan=4374	27.754	2	1372.7228	1372.7228	R	A	144	157
PSM	AITFFTEDDKPLLR	1335	sp|Q9Y2R4|DDX52_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9686	60.07	2	1664.8774	1664.8774	K	S	512	526
PSM	ALSRQEMQEVQSSR	1336	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3324	21.743	2	1647.7999	1647.7999	K	S	175	189
PSM	AMKGAGTDEGCLIEILASR	1337	sp|P09525-2|ANXA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	3-UNIMOD:188,11-UNIMOD:4,19-UNIMOD:267	ms_run[2]:scan=10499	65.341	2	2007.01	2003.0219	R	T	16	35
PSM	ARAETEELIR	1338	sp|P29590-14|PML_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:267,10-UNIMOD:267	ms_run[2]:scan=3127	20.605	2	1206.6471	1206.6471	R	E	271	281
PSM	ARLEIEPEWAYGK	1339	sp|Q00688|FKBP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7961	49.185	2	1560.7936	1560.7936	K	K	188	201
PSM	ASLAAILEHSLFSTEQK	1340	sp|Q14149|MORC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	17-UNIMOD:188	ms_run[2]:scan=12850	81.624	2	1849.9881	1849.9881	K	L	164	181
PSM	AVDIPHMDIEALK	1341	sp|P62906|RL10A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:188	ms_run[2]:scan=8995	55.595	2	1456.7691	1456.7691	K	K	79	92
PSM	AVTPPMPLLTPATPGGLPPAAAVAAAAATAK	1342	sp|Q9UHX1-4|PUF60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	6-UNIMOD:35	ms_run[2]:scan=11551	72.35	3	2809.5412	2809.5412	K	I	242	273
PSM	CHAIIDEQPLIFK	1343	sp|P0CW19-2|LIMS3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=8357	51.612	2	1588.8379	1588.8379	K	N	200	213
PSM	CTVFHGAQVEDAFR	1344	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=6778	41.926	3	1645.7546	1645.7546	K	Y	1828	1842
PSM	CYSCGEFGHIQK	1345	sp|P62633-7|CNBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:4,4-UNIMOD:4	ms_run[2]:scan=4106	26.248	2	1484.6177	1484.6177	K	D	102	114
PSM	DFSMADKVLPTIPK	1346	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9478	58.742	2	1560.8222	1560.8222	R	E	573	587
PSM	DQLRPTQLLQNVAR	1347	sp|Q9NZM1-2|MYOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8186	50.569	3	1650.9166	1650.9166	R	F	1627	1641
PSM	DVGRPNFEEGGPTSVGR	1348	sp|Q6Y7W6-4|GGYF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	4-UNIMOD:267,17-UNIMOD:267	ms_run[2]:scan=5058	31.792	3	1792.8607	1792.8607	K	K	176	193
PSM	EAAASGLPLMVIIHK	1349	sp|O95881|TXD12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10322	64.196	2	1548.8698	1548.8698	K	S	49	64
PSM	EAILEYILHQK	1350	sp|Q9Y314|NOSIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=11078	69.169	2	1355.7449	1355.7449	R	K	68	79
PSM	EGRLEDVENLGCR	1351	sp|Q9UJX3-2|APC7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:4	ms_run[2]:scan=5430	33.986	2	1545.7206	1545.7206	R	L	318	331
PSM	EQQHVMEELFQSSFR	1352	sp|P78527-2|PRKDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10038	62.355	2	1893.8679	1893.8679	R	R	1769	1784
PSM	FAADAVKLER	1353	sp|P37837|TALDO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4699	29.672	2	1118.6084	1118.6084	K	M	315	325
PSM	FFDEESYSLLRK	1354	sp|P51571|SSRD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8171	50.478	2	1532.7511	1532.7511	R	A	106	118
PSM	FMDQHPEMDFSK	1355	sp|Q9Y266|NUDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6082	37.814	2	1510.6221	1510.6221	K	A	316	328
PSM	FQQVPTDALANKLFGAPEPSTIAR	1356	sp|Q6PKG0-3|LARP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10608	66.045	3	2570.3493	2570.3493	R	S	665	689
PSM	GDAPSPEEKLHLITR	1357	sp|P54577|SYYC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:1	ms_run[2]:scan=6636	41.076	3	1703.8842	1703.8842	M	N	2	17
PSM	GDAPSPEEKLHLITR	1358	sp|P54577|SYYC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:1	ms_run[2]:scan=6639	41.096	2	1703.8842	1703.8842	M	N	2	17
PSM	GEHPGLSIGDVAK	1359	sp|P09429|HMGB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:188	ms_run[2]:scan=5006	31.486	2	1284.6769	1284.6769	K	K	115	128
PSM	GEVFSVLEFAPSNHSFK	1360	sp|Q9C0C9|UBE2O_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10956	68.356	2	1893.9261	1893.9261	K	K	926	943
PSM	GGGPQAQSHGEAR	1361	sp|Q7L2J0|MEPCE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:267	ms_run[2]:scan=456	5.8064	2	1260.5835	1260.5835	R	L	87	100
PSM	GHPDLQGQPAEEIFESVGDR	1362	sp|P49257|LMAN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	20-UNIMOD:267	ms_run[2]:scan=9333	57.817	3	2190.0217	2190.0217	K	E	310	330
PSM	GIVEFASKPAAR	1363	sp|P23246-2|SFPQ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4616	29.193	2	1244.6877	1244.6877	K	K	414	426
PSM	GLFLPEDENLREK	1364	sp|Q12797-10|ASPH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7312	45.198	2	1558.7991	1558.7991	K	G	581	594
PSM	GNSLTLIDLPGHESLR	1365	sp|Q9Y5M8|SRPRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	16-UNIMOD:267	ms_run[2]:scan=8840	54.634	2	1730.9191	1730.9191	R	L	110	126
PSM	GSIFVVFDSIESAKK	1366	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=11483	71.887	2	1625.8665	1625.8665	K	F	152	167
PSM	GSRVDIETPNLEGTLTGPR	1367	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	3-UNIMOD:267,19-UNIMOD:267	ms_run[2]:scan=7919	48.925	3	2031.05	2031.0500	K	L	538	557
PSM	GTITDAPGFDPLRDAEVLR	1368	sp|P50995-2|ANX11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:267,19-UNIMOD:267	ms_run[2]:scan=10354	64.403	2	2062.0598	2062.0598	R	K	159	178
PSM	HGLSEKGDSQPSAS	1369	sp|Q56VL3|OCAD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=823	7.8099	2	1398.6375	1398.6375	K	-	141	155
PSM	HNINIGITNVDVK	1370	sp|Q9Y5Y0-2|FLVC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:188	ms_run[2]:scan=6741	41.701	2	1441.7985	1441.7985	R	A	242	255
PSM	HPSAVTACNLDLENLITDSNR	1371	sp|Q9UBF2-2|COPG2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	8-UNIMOD:4,21-UNIMOD:267	ms_run[2]:scan=10086	62.672	3	2349.1258	2349.1258	K	S	318	339
PSM	HSGPNSADSANDGFVR	1372	sp|P52597|HNRPF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	16-UNIMOD:267	ms_run[2]:scan=2603	17.602	3	1639.7214	1639.7214	K	L	99	115
PSM	HSVVAGGGGGEGR	1373	sp|Q6PKG0-3|LARP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=646	6.8597	2	1138.5479	1138.5479	R	K	962	975
PSM	HTGPNSPDTANDGFVR	1374	sp|P55795|HNRH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3278	21.479	3	1683.7601	1683.7601	K	L	99	115
PSM	HVVPNEVVVQR	1375	sp|P06396-2|GELS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3484	22.666	2	1274.7095	1274.7095	K	L	127	138
PSM	HYTNASDGLCTR	1376	sp|P06239-3|LCK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:4	ms_run[2]:scan=1959	13.944	2	1393.6045	1393.6045	R	L	208	220
PSM	IAEELPKEPQGIIACCNPVPPLVR	1377	sp|Q01780-2|EXOSX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	15-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=9614	59.615	2	2699.4139	2699.4139	K	Q	540	564
PSM	IEEIKDFLLTAR	1378	sp|P63173|RL38_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9717	60.276	2	1446.8082	1446.8082	K	R	5	17
PSM	IELGDVTPHNIK	1379	sp|Q9GZZ1-2|NAA50_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:188	ms_run[2]:scan=6060	37.689	2	1340.7395	1340.7395	R	Q	6	18
PSM	IFINNEWHESK	1380	sp|P47895|AL1A3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:188	ms_run[2]:scan=5745	35.838	2	1421.7035	1421.7035	K	S	34	45
PSM	IGDLQAFQGHGAGNLAGLK	1381	sp|P08195-2|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	19-UNIMOD:188	ms_run[2]:scan=8074	49.886	3	1871.9949	1871.9949	R	G	126	145
PSM	IGKIEGFEVLK	1382	sp|Q15435-5|PP1R7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7537	46.545	2	1231.7176	1231.7176	R	K	29	40
PSM	IGQGYLIKDGK	1383	sp|P39023|RL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	8-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=3889	24.988	2	1202.7062	1202.7062	K	L	287	298
PSM	IGQGYLIKDGK	1384	sp|P39023|RL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3893	25.005	2	1190.6659	1190.6659	K	L	287	298
PSM	IHIDPEIQDGSPTTSR	1385	sp|P50479-2|PDLI4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	16-UNIMOD:267	ms_run[2]:scan=5218	32.739	3	1774.8725	1774.8725	R	R	102	118
PSM	IHVLEAQDLIAK	1386	sp|Q9BSJ8|ESYT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7453	46.055	2	1348.7715	1348.7715	R	D	651	663
PSM	IIKDFMIQGGDPTGTGR	1387	sp|Q9Y3C6|PPIL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6994	43.289	3	1804.9142	1804.9142	R	G	56	73
PSM	IKELQNAGDR	1388	sp|Q15149-7|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=1246	9.9892	2	1142.6044	1142.6044	K	L	640	650
PSM	ILFSSREEQQDILSK	1389	sp|O14976-2|GAK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7118	44.013	2	1791.9367	1791.9367	K	F	655	670
PSM	ILSCGEVIHVK	1390	sp|Q9H2U2|IPYR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	4-UNIMOD:4	ms_run[2]:scan=5164	32.423	2	1253.6802	1253.6802	K	I	177	188
PSM	INKESLLPVAK	1391	sp|Q16851-2|UGPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	3-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=4920	30.985	2	1222.7688	1222.7688	R	D	185	196
PSM	ISSIQSIVPALEIANAHR	1392	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10576	65.839	3	1918.0636	1918.0636	K	K	251	269
PSM	IVELPAPADFLSLSSETKPK	1393	sp|Q6P2E9-2|EDC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	18-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=11778	73.879	2	2153.2022	2153.2022	R	L	191	211
PSM	IVSLFAEHNDLQYAAPGGLIGVGTK	1394	sp|Q2VIR3-2|IF2GL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	25-UNIMOD:188	ms_run[2]:scan=11125	69.484	3	2575.3742	2575.3742	K	I	318	343
PSM	KALDIAENEMPGLMR	1395	sp|P23526|SAHH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	14-UNIMOD:35	ms_run[2]:scan=7145	44.182	2	1702.8382	1702.8382	R	M	20	35
PSM	KALDIAENEMPGLMR	1396	sp|P23526|SAHH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8311	51.324	3	1686.8433	1686.8433	R	M	20	35
PSM	KASGPPVSELITK	1397	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5190	32.58	3	1325.7555	1325.7555	R	A	34	47
PSM	KCEPIIMTVPR	1398	sp|Q9ULV4|COR1C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:4	ms_run[2]:scan=5933	36.924	2	1342.7101	1342.7101	R	K	342	353
PSM	KDAEAWFTSR	1399	sp|P08727|K1C19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5904	36.759	2	1209.5778	1209.5778	R	T	265	275
PSM	KFLDGNELTLADCNLLPK	1400	sp|O00299|CLIC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:4	ms_run[2]:scan=10592	65.943	3	2060.0612	2060.0612	R	L	166	184
PSM	KGEGLPNFDNNNIK	1401	sp|Q9UBS4|DJB11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=5534	34.583	2	1570.8142	1570.8142	K	G	302	316
PSM	KITIGQAPTEK	1402	sp|P11586|C1TC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=2882	19.194	2	1196.7167	1196.7167	R	G	543	554
PSM	KLLLSATSGEK	1403	sp|Q9NW13-2|RBM28_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3450	22.466	2	1145.6656	1145.6656	R	G	364	375
PSM	KLVTDQNISENWR	1404	sp|P24666-4|PPAC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5767	35.963	3	1601.8162	1601.8162	R	V	29	42
PSM	KPIAGQVVTAMGK	1405	sp|P49023-2|PAXI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=4522	28.643	2	1310.7783	1310.7783	K	T	329	342
PSM	KTGNFQVTELGR	1406	sp|O75643|U520_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4998	31.441	2	1348.7099	1348.7099	K	I	975	987
PSM	KTSYLTELIDR	1407	sp|Q9P289-3|STK26_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8183	50.551	2	1337.7191	1337.7191	K	F	218	229
PSM	LAIKLPDDQIPK	1408	sp|Q01813-2|PFKAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7512	46.392	2	1349.7919	1349.7919	R	T	389	401
PSM	LGGKLTGTANK	1409	sp|P09874|PARP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	4-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=1193	9.7165	2	1070.6487	1070.6487	K	A	415	426
PSM	LGGNYGPTVLVQQEALKR	1410	sp|O15382-2|BCAT2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7617	47.043	2	1942.0636	1942.0636	K	G	138	156
PSM	LGGSPFGPAGTGKTESVK	1411	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=4644	29.349	2	1700.9136	1700.9136	R	A	1900	1918
PSM	LGSAVVTRGDECGLALGR	1412	sp|P54886-2|P5CS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:4	ms_run[2]:scan=6118	38.022	3	1829.9418	1829.9418	K	L	77	95
PSM	LGYEEHIPGQTR	1413	sp|O75153|CLU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:267	ms_run[2]:scan=4229	26.959	2	1408.6974	1408.6974	R	D	344	356
PSM	LGYEEHIPGQTR	1414	sp|O75153|CLU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4230	26.964	2	1398.6892	1398.6892	R	D	344	356
PSM	LIDRENFVDIVDAK	1415	sp|Q9GZY4|COA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8547	52.791	2	1645.8675	1645.8675	K	L	75	89
PSM	LKPFLGSSDCVNQISGK	1416	sp|Q9BZF1-3|OSBL8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:4	ms_run[2]:scan=6640	41.101	3	1848.9404	1848.9404	K	L	566	583
PSM	LKQEQGVESEPLFPILK	1417	sp|Q8WUQ7|CATIN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=9919	61.588	2	1966.1178	1966.1178	K	Q	468	485
PSM	LLEDFGDGGAFPEIHVAQYPLDMGR	1418	sp|Q13573|SNW1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=12130	76.277	3	2746.3061	2746.3061	R	K	54	79
PSM	LLEVLSGEILPKPTK	1419	sp|O15020-2|SPTN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9687	60.076	3	1635.9811	1635.9811	R	G	94	109
PSM	LLEVLSGEILPKPTK	1420	sp|O15020-2|SPTN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9688	60.082	2	1635.9811	1635.9811	R	G	94	109
PSM	LLVGNDDVHIIAR	1421	sp|Q7Z6Z7-2|HUWE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7077	43.765	2	1433.7991	1433.7991	R	S	2606	2619
PSM	LMCSLCHCPGATIGCDVK	1422	sp|Q8IWS0-4|PHF6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	3-UNIMOD:4,6-UNIMOD:4,8-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=6009	37.382	3	2077.8876	2077.8876	K	T	80	98
PSM	LPATEKPVLLSK	1423	sp|Q9Y4L1|HYOU1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	6-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=5002	31.468	2	1306.8263	1306.8263	K	D	878	890
PSM	LQELPDAVPHGEMPR	1424	sp|P33992|MCM5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6510	40.335	2	1687.8352	1687.8352	K	H	229	244
PSM	LQISHEAAACITGLR	1425	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:4	ms_run[2]:scan=7014	43.398	3	1638.8512	1638.8512	K	A	1090	1105
PSM	LSFQHDPETSVLVLR	1426	sp|Q14697|GANAB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	15-UNIMOD:267	ms_run[2]:scan=8610	53.189	3	1749.9289	1749.9289	R	K	915	930
PSM	LSQERPGVLLNQFPCENLLTVK	1427	sp|Q14166|TTL12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	15-UNIMOD:4	ms_run[2]:scan=10984	68.549	3	2554.3577	2554.3577	K	D	347	369
PSM	LTRDETNYGIPQR	1428	sp|P63244|RACK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	3-UNIMOD:267,13-UNIMOD:267	ms_run[2]:scan=3896	25.023	2	1581.8014	1581.8014	K	A	45	58
PSM	LTRDETNYGIPQR	1429	sp|P63244|RACK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3890	24.993	3	1561.7849	1561.7849	K	A	45	58
PSM	LTRDETNYGIPQR	1430	sp|P63244|RACK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3898	25.033	2	1561.7849	1561.7849	K	A	45	58
PSM	LVAIVDVIDQNR	1431	sp|P50914|RL14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9813	60.903	2	1353.7616	1353.7616	K	A	24	36
PSM	LVARPEPATGYTLEFR	1432	sp|Q16658|FSCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7462	46.109	3	1818.9628	1818.9628	R	S	202	218
PSM	LVARPEPATGYTLEFR	1433	sp|Q16658|FSCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7477	46.186	2	1818.9628	1818.9628	R	S	202	218
PSM	LVILEGELERAEER	1434	sp|P67936|TPM4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8380	51.753	2	1654.889	1654.8890	K	A	133	147
PSM	LVKPGNQNTQVTEAWNK	1435	sp|Q9UQ80|PA2G4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	3-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=4724	29.804	3	1938.0362	1938.0362	R	V	156	173
PSM	MEEIVEGCTGALHILAR	1436	sp|P35222|CTNB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:35,8-UNIMOD:4	ms_run[2]:scan=8166	50.445	3	1913.9339	1913.9339	R	D	566	583
PSM	MFVGGLSWDTSKK	1437	sp|Q99729-3|ROAA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8139	50.276	2	1454.7228	1454.7228	K	D	72	85
PSM	MLFKDDYPSSPPK	1438	sp|P63279|UBC9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:35,4-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=5115	32.124	2	1551.7682	1551.7682	R	C	62	75
PSM	MQHNLEQQIQAR	1439	sp|Q13813-3|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:35,12-UNIMOD:267	ms_run[2]:scan=3286	21.525	2	1520.7393	1520.7393	R	N	2284	2296
PSM	MVQVHELSCEGISK	1440	sp|Q15437|SC23B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:35,9-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=4539	28.75	2	1637.7849	1637.7849	R	S	172	186
PSM	MVRPNQDGTLIASCSNDQTVR	1441	sp|P43034|LIS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	14-UNIMOD:4	ms_run[2]:scan=5052	31.752	2	2361.1165	2361.1165	R	V	239	260
PSM	MVRPNQDGTLIASCSNDQTVR	1442	sp|P43034|LIS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	3-UNIMOD:267,14-UNIMOD:4,21-UNIMOD:267	ms_run[2]:scan=5032	31.641	3	2381.1331	2381.1331	R	V	239	260
PSM	MWDLSSNQAIQIAQHDAPVK	1443	sp|P78406|RAE1L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:35	ms_run[2]:scan=9136	56.514	3	2267.1005	2267.1005	K	T	112	132
PSM	NAAPILHLSGMDVTIVK	1444	sp|Q53H12|AGK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	17-UNIMOD:188	ms_run[2]:scan=9935	61.694	2	1783.9962	1783.9962	K	T	83	100
PSM	NDLEEAFIHFMGK	1445	sp|Q9BRR6-2|ADPGK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=12705	80.427	2	1549.7235	1549.7235	R	G	113	126
PSM	NDSVIVDTFHGLFK	1446	sp|Q13107-2|UBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=11755	73.722	2	1590.8042	1590.8042	R	S	396	410
PSM	NGRVEIIANDQGNR	1447	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=2924	19.441	2	1554.7863	1554.7863	K	I	47	61
PSM	NHEEEISTLR	1448	sp|P08727|K1C19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=2888	19.228	2	1226.5891	1226.5891	K	G	217	227
PSM	NIGENEGGIDKFSR	1449	sp|Q04446|GLGB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4635	29.297	2	1534.7376	1534.7376	K	G	58	72
PSM	NIYGNIEDLVVHIK	1450	sp|O00116|ADAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	14-UNIMOD:188	ms_run[2]:scan=12141	76.35	2	1631.8978	1631.8978	K	M	324	338
PSM	NIYGNIEDLVVHIK	1451	sp|O00116|ADAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=12142	76.356	2	1625.8777	1625.8777	K	M	324	338
PSM	NKTGAAPIIDVVR	1452	sp|P46776|RL27A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5678	35.435	2	1352.7776	1352.7776	K	S	93	106
PSM	NKTGAAPIIDVVR	1453	sp|P46776|RL27A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5685	35.478	3	1352.7776	1352.7776	K	S	93	106
PSM	NLDGISHAPNAVK	1454	sp|Q92820|GGH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3685	23.812	2	1334.6943	1334.6943	K	T	254	267
PSM	NNEDISIIPPLFTVSVDHR	1455	sp|P51571|SSRD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	19-UNIMOD:267	ms_run[2]:scan=12350	77.753	2	2175.12	2175.1200	R	G	121	140
PSM	NQVSYVRPAEPAFLAR	1456	sp|Q96AT1|K1143_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7266	44.926	2	1816.9584	1816.9584	R	F	5	21
PSM	QLIIVHGPPEASQDLAECCR	1457	sp|Q9P2I0|CPSF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	18-UNIMOD:4,19-UNIMOD:4	ms_run[2]:scan=7226	44.678	3	2292.0991	2292.0991	R	A	560	580
PSM	QLLTDFCTHLPNLPDSTAK	1458	sp|Q9BT78-2|CSN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	7-UNIMOD:4	ms_run[2]:scan=10179	63.276	2	2170.0729	2170.0729	R	E	64	83
PSM	QLREYQELMNVK	1459	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6701	41.468	2	1549.7923	1549.7923	R	L	370	382
PSM	QRYEILTPNSIPK	1460	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6666	41.258	2	1557.8515	1557.8515	R	G	719	732
PSM	QTFEAAILTQLHPR	1461	sp|Q9NPD3|EXOS4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	14-UNIMOD:267	ms_run[2]:scan=10386	64.601	2	1633.8816	1633.8816	R	S	105	119
PSM	QVCPLDNREWEFQK	1462	sp|P62877|RBX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	3-UNIMOD:4	ms_run[2]:scan=7414	45.82	2	1847.8625	1847.8625	R	Y	92	106
PSM	RALQAAIQQLAEAQPEATAK	1463	sp|Q92616|GCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:267,20-UNIMOD:188	ms_run[2]:scan=8138	50.27	2	2123.167	2119.1788	R	N	68	88
PSM	RAPDQAAEIGSR	1464	sp|Q3ZCQ8-2|TIM50_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:267,12-UNIMOD:267	ms_run[2]:scan=1472	11.19	2	1289.6591	1289.6591	R	G	135	147
PSM	RDQDNMQAELNR	1465	sp|P33176|KINH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=2901	19.302	2	1488.6739	1488.6739	R	L	465	477
PSM	RGDTYELQVR	1466	sp|Q9H0U3|MAGT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3763	24.266	2	1235.6258	1235.6258	K	G	150	160
PSM	RGDTYELQVR	1467	sp|Q9H0U3|MAGT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:267,10-UNIMOD:267	ms_run[2]:scan=3800	24.485	2	1255.6424	1255.6424	K	G	150	160
PSM	RGEYIYTGNAK	1468	sp|Q15291-2|RBBP5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=2629	17.75	2	1270.6306	1270.6306	R	G	162	173
PSM	RPISADSAIMNPASK	1469	sp|Q00610-2|CLH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4583	29.005	2	1556.7981	1556.7981	R	V	64	79
PSM	RTVQSLEIDLDSMR	1470	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:267,14-UNIMOD:267	ms_run[2]:scan=8417	51.971	3	1681.8572	1681.8572	R	N	301	315
PSM	SAHATAPVNIAGSR	1471	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	14-UNIMOD:267	ms_run[2]:scan=2892	19.249	2	1360.7087	1360.7087	R	T	2343	2357
PSM	SDFGKFVLSSGK	1472	sp|P27797|CALR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6776	41.915	2	1270.6558	1270.6558	K	F	44	56
PSM	SDFGKFVLSSGK	1473	sp|P27797|CALR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	5-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=6766	41.854	2	1282.696	1282.6960	K	F	44	56
PSM	SFLSQGQVLKLEAK	1474	sp|P48047|ATPO_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8016	49.522	2	1546.8719	1546.8719	K	T	163	177
PSM	SFVAHCPELLTEDVIR	1475	sp|Q9P2D3-2|HTR5B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	6-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=9106	56.324	2	1894.9487	1894.9487	R	K	620	636
PSM	SGYLAGDKLLPQR	1476	sp|P26038|MOES_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6139	38.137	2	1416.7725	1416.7725	K	V	144	157
PSM	SHEGETAYIR	1477	sp|Q07955|SRSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:267	ms_run[2]:scan=1925	13.759	2	1171.5497	1171.5497	R	V	182	192
PSM	SIDQFANLVLHQTVER	1478	sp|O15116|LSM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=11616	72.789	3	1868.9745	1868.9745	R	I	34	50
PSM	SKGVFVQSVLPYFVATK	1479	sp|Q53GQ0|DHB12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=11220	70.113	2	1881.0803	1881.0803	R	L	222	239
PSM	SLKDMEESIR	1480	sp|P14314-2|GLU2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5515	34.475	2	1206.5914	1206.5914	R	N	380	390
PSM	SNMGHPEPASGLAALAK	1481	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	3-UNIMOD:35	ms_run[2]:scan=5502	34.396	2	1665.8145	1665.8145	K	V	327	344
PSM	SRAEAESMYQIK	1482	sp|P05787|K2C8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3794	24.45	2	1411.6766	1411.6766	R	Y	274	286
PSM	SVFALTNGIYPHK	1483	sp|Q02878|RL6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:188	ms_run[2]:scan=8387	51.796	2	1451.7868	1451.7868	R	L	273	286
PSM	SYDVPPPPMEPDHPFYSNISK	1484	sp|Q8N0Y7|PGAM4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8430	52.048	2	2416.1045	2416.1045	R	D	118	139
PSM	TAEVLANKIVPFFK	1485	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	8-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=10432	64.9	2	1587.9427	1587.9427	R	L	2061	2075
PSM	TAQNHPMLVELK	1486	sp|Q9Y4Z0|LSM4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5368	33.621	2	1379.7231	1379.7231	K	N	9	21
PSM	TAQNHPMLVELK	1487	sp|Q9Y4Z0|LSM4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:188	ms_run[2]:scan=5370	33.637	2	1385.7432	1385.7432	K	N	9	21
PSM	TFVNITPAEVGVLVGKDR	1488	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10695	66.616	3	1914.0575	1914.0575	K	S	39	57
PSM	TLHSTFQPNISQGK	1489	sp|Q9NZM1-2|MYOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	14-UNIMOD:188	ms_run[2]:scan=4314	27.421	2	1562.8148	1562.8148	R	L	1704	1718
PSM	TPCSSLLPLLNAHAATSGK	1490	sp|Q9NUQ6-2|SPS2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	3-UNIMOD:4	ms_run[2]:scan=9002	55.641	3	1937.004	1937.0040	R	Q	296	315
PSM	TPCSSLLPLLNAHAATSGK	1491	sp|Q9NUQ6-2|SPS2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	3-UNIMOD:4,19-UNIMOD:188	ms_run[2]:scan=9022	55.767	2	1943.0242	1943.0242	R	Q	296	315
PSM	TPEIVAPQSAHAAFNK	1492	sp|O95470|SGPL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5304	33.242	2	1679.8631	1679.8631	K	A	232	248
PSM	TVKELLDGGANPLQR	1493	sp|Q9H078-5|CLPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7341	45.367	2	1609.8788	1609.8788	R	N	80	95
PSM	TWKEVCFACVDGK	1494	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	3-UNIMOD:188,6-UNIMOD:4,9-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=6969	43.144	2	1610.7624	1610.7624	R	E	1252	1265
PSM	TWKEVCFACVDGK	1495	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	6-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=6970	43.15	2	1598.7221	1598.7221	R	E	1252	1265
PSM	VAHMETSLGQAR	1496	sp|P48681|NEST_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=2966	19.686	2	1298.6401	1298.6401	R	E	197	209
PSM	VAKLDTSQWPLLLK	1497	sp|O60832-2|DKC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10558	65.723	2	1610.9396	1610.9396	K	N	44	58
PSM	VIACDGGGGALGHPK	1498	sp|O75380|NDUS6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	4-UNIMOD:4	ms_run[2]:scan=2550	17.307	2	1407.6929	1407.6929	R	V	84	99
PSM	VIGVKSEGEIAR	1499	sp|P50395-2|GDIB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3345	21.864	2	1256.7089	1256.7089	K	C	220	232
PSM	VKIPEGTILTMDMLTVK	1500	sp|Q9NR45|SIAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=11525	72.173	3	1900.0816	1900.0816	K	V	299	316
PSM	VLAEDEELYGDFEDLETGDVHKGK	1501	sp|Q14692|BMS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10248	63.725	3	2707.2501	2707.2501	K	S	772	796
PSM	VLEKLGVTVR	1502	sp|P61160|ARP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5148	32.324	2	1112.6917	1112.6917	R	-	385	395
PSM	VNFPENGFLSPDKLSLLEK	1503	sp|P31689|DNJA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=11544	72.301	2	2146.131	2146.1310	K	L	326	345
PSM	VTYHPDGPEGQAYDVDFTPPFR	1504	sp|Q15046|SYK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9425	58.405	3	2507.1394	2507.1394	K	R	371	393
PSM	WDTERVFEVNASNLEK	1505	sp|Q9P2J5|SYLC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8891	54.959	3	1935.9327	1935.9327	K	Q	24	40
PSM	YFQIGTIVDNPADFYHSR	1506	sp|Q5QJE6|TDIF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10817	67.441	2	2142.0171	2142.0171	K	I	687	705
PSM	YGKIETIEVMEDR	1507	sp|P51991-2|ROA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6644	41.124	2	1581.7709	1581.7709	K	Q	127	140
PSM	YGLIYHASLVGQTSPK	1508	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	16-UNIMOD:188	ms_run[2]:scan=7004	43.343	3	1738.9349	1738.9349	K	H	338	354
PSM	YYRESADPLGAWLQDAR	1509	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	3-UNIMOD:267,17-UNIMOD:267	ms_run[2]:scan=10628	66.18	2	2029.9761	2029.9761	R	R	1179	1196
PSM	LSAEAEKVLALPEPSPAAPTLR	1510	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	7-UNIMOD:188,22-UNIMOD:267	ms_run[1]:scan=8983	55.51835833333334	3	2275.275891	2275.275846	R	S	1180	1202
PSM	MSLPDVDLDLKGPK	1511	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	11-UNIMOD:188,14-UNIMOD:188	ms_run[1]:scan=9096	56.26059166666666	2	1538.844699	1538.841689	K	M	1067	1081
PSM	QSVENDIHGLRK	1512	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:28,11-UNIMOD:267,12-UNIMOD:188	ms_run[1]:scan=4885	30.777356666666666	2	1393.7272	1393.7280	R	V	176	188
PSM	CSVIRDSLLQDGEFSMDLR	1513	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:385,1-UNIMOD:4,5-UNIMOD:267,16-UNIMOD:35,19-UNIMOD:267	ms_run[1]:scan=11403	71.35205	3	2259.0344	2259.0409	K	T	71	90
PSM	LFNEHIEALTK	1514	sp|O14776|TCRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=6607	40.91547	2	1314.705055	1313.697952	K	K	945	956
PSM	MFNGEKINYTEGR	1515	sp|P06744|G6PI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=4958	31.211176666666667	2	1557.744271	1557.724577	R	A	84	97
PSM	MFNGEKINYTEGR	1516	sp|P06744|G6PI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:35,6-UNIMOD:188,13-UNIMOD:267	ms_run[1]:scan=4662	29.454684999999998	2	1590.7312	1589.7472	R	A	84	97
PSM	QQHVIETLIGK	1517	sp|P48643|TCPE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:28	ms_run[1]:scan=8957	55.370725	2	1247.6878	1247.6869	K	K	503	514
PSM	QQHVIETLIGKK	1518	sp|P48643|TCPE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:28	ms_run[1]:scan=7875	48.64621666666667	2	1375.7812	1375.7818	K	Q	503	515
PSM	LKPNLGNGADLPNYR	1519	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	2-UNIMOD:188,15-UNIMOD:267	ms_run[1]:scan=6193	38.44548833333334	3	1657.873952	1656.891852	K	W	159	174
PSM	GDAPSPEEKLHLITR	1520	sp|P54577|SYYC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:1,9-UNIMOD:188,15-UNIMOD:267	ms_run[1]:scan=6675	41.31201	2	1719.9119	1719.9121	M	N	2	17
PSM	SVNIKEICWNLQNIR	1521	sp|Q9BXP5|SRRT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	5-UNIMOD:188,8-UNIMOD:4,15-UNIMOD:267	ms_run[1]:scan=10077	62.61189	3	1903.039935	1902.011650	R	L	472	487
PSM	QQELDNLLHEKR	1522	sp|Q12788|TBL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:28	ms_run[1]:scan=7851	48.49774	2	1504.7635	1504.7629	R	Y	654	666
PSM	IDRYTQQGFGNLPICMAK	1523	sp|Q6UB35|C1TM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	15-UNIMOD:4	ms_run[1]:scan=8653	53.45343666666667	3	2112.035046	2111.029216	K	T	892	910
PSM	VVTYGMANLLTGPKR	1524	sp|Q99536|VAT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	14-UNIMOD:188,15-UNIMOD:267	ms_run[1]:scan=8365	51.661181666666664	2	1634.919282	1634.914896	K	N	282	297
PSM	QAIKELPQFATGENLPR	1525	sp|Q9BZZ5|API5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:28	ms_run[1]:scan=9739	60.41450666666667	2	1893.9938	1893.9943	R	V	81	98
PSM	RLDEYTQEEIDAFPR	1526	sp|Q9BYD1|RM13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=7970	49.23713	3	1881.891610	1880.890457	K	L	154	169
PSM	VHACGVNPVETYIR	1527	sp|Q08257|QOR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	4-UNIMOD:4	ms_run[1]:scan=6301	39.109361666666665	2	1614.799823	1613.798411	K	S	42	56
PSM	IQHILCTGNLCTK	1528	sp|Q9UBQ0|VPS29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	6-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=5122	32.167381666666664	2	1556.783300	1556.780318	K	E	31	44
PSM	KYAVLYQPLFDK	1529	sp|P55209|NP1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:188,12-UNIMOD:188	ms_run[1]:scan=8577	52.980291666666666	2	1495.838419	1495.847760	R	R	105	117
PSM	FSHQASGFQCDLTTNNR	1530	sp|Q9NVV4|PAPD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	10-UNIMOD:4	ms_run[1]:scan=4909	30.914051666666666	2	1983.864933	1981.870073	R	I	315	332
PSM	HQEPVYSVAFSPDGR	1531	sp|Q9BZK7|TBL1R_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	15-UNIMOD:267	ms_run[1]:scan=6388	39.60846166666666	2	1697.803004	1697.803703	K	Y	441	456
PSM	ENSSCGRFDITIGPK	1532	sp|Q9Y2T2|AP3M1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	5-UNIMOD:4	ms_run[1]:scan=6352	39.403286666666666	2	1680.823889	1679.793720	K	Q	284	299
PSM	PSPSGGDSVLPKSISSAHDTR	1533	sp|Q9Y6R4|M3K4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	21-UNIMOD:267	ms_run[1]:scan=5664	35.348303333333334	2	2104.0542	2104.0422	R	G	1205	1226
PSM	KNPEVPVNFAEFSK	1534	sp|O15347|HMGB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=7940	49.056605	2	1604.822697	1604.819858	K	K	30	44
PSM	AAHLCAEAALR	1535	sp|Q9UQ80|PA2G4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	5-UNIMOD:4	ms_run[2]:scan=3572	23.172	2	1181.5975	1181.5975	K	L	145	156
PSM	AAHLCAEAALR	1536	sp|Q9UQ80|PA2G4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	5-UNIMOD:4,11-UNIMOD:267	ms_run[2]:scan=3599	23.326	2	1191.6058	1191.6058	K	L	145	156
PSM	AEGFVDALHR	1537	sp|Q96I24|FUBP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:267	ms_run[2]:scan=5435	34.016	2	1123.565	1123.5650	K	V	16	26
PSM	AFVRPSGTEDVVR	1538	sp|O95394|AGM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	4-UNIMOD:267,13-UNIMOD:267	ms_run[2]:scan=4289	27.284	2	1451.7636	1451.7636	R	V	493	506
PSM	AGAHLQGGAK	1539	sp|P04406-2|G3P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:188	ms_run[2]:scan=578	6.5037	2	914.50294	914.5029	K	R	66	76
PSM	AGDRQPEWLEEQQGR	1540	sp|Q14980-2|NUMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	4-UNIMOD:267,15-UNIMOD:267	ms_run[2]:scan=5034	31.651	3	1817.856	1817.8560	R	Q	944	959
PSM	AGKEESGVSVSNSQPTNESHSIK	1541	sp|Q99808|S29A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=2343	16.119	2	2371.1252	2371.1252	R	A	261	284
PSM	AGLLQVYIHTQK	1542	sp|Q92979|NEP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:188	ms_run[2]:scan=7372	45.568	2	1375.7919	1375.7919	R	N	103	115
PSM	AKDGLVVFGK	1543	sp|Q12765-2|SCRN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:188,10-UNIMOD:188	ms_run[2]:scan=5325	33.371	2	1044.637	1044.6370	R	N	37	47
PSM	AKDGLVVFGK	1544	sp|Q12765-2|SCRN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5328	33.387	2	1032.5968	1032.5968	R	N	37	47
PSM	ALFAGDIEEMEERR	1545	sp|Q9BQ52-3|RNZ2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8525	52.653	2	1664.7828	1664.7828	K	E	397	411
PSM	ALTNLPHTDFTLCK	1546	sp|Q9UBQ5-2|EIF3K_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=7880	48.674	2	1635.8386	1635.8386	K	C	73	87
PSM	AQVARPGGDTIFGK	1547	sp|P49773|HINT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4949	31.161	2	1415.7521	1415.7521	K	I	8	22
PSM	ARPEDVISEGR	1548	sp|P25325|THTM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:267,11-UNIMOD:267	ms_run[2]:scan=3338	21.827	2	1247.6373	1247.6373	R	G	283	294
PSM	ATVSAPFGKFQGK	1549	sp|Q15149-7|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	9-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=5527	34.54	2	1348.7542	1348.7542	K	T	2876	2889
PSM	AVANRTDACFIR	1550	sp|P35998|PRS7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	5-UNIMOD:267,9-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=3876	24.917	2	1412.7098	1412.7098	R	V	228	240
PSM	CFNDLKAEELLLK	1551	sp|P55212|CASP6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:4	ms_run[2]:scan=9352	57.939	2	1591.828	1591.8280	K	I	87	100
PSM	CPEALFQPSFLGMESCGIHETTFNSIMK	1552	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:4,16-UNIMOD:4,28-UNIMOD:188	ms_run[2]:scan=12544	79.118	3	3236.4746	3236.4746	R	C	257	285
PSM	CTTDHISAAGPWLK	1553	sp|Q99798|ACON_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:4	ms_run[2]:scan=6542	40.53	2	1555.7453	1555.7453	K	F	592	606
PSM	CVSSPHFQVAER	1554	sp|Q13362-2|2A5G_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:4	ms_run[2]:scan=4118	26.31	2	1415.6616	1415.6616	K	A	334	346
PSM	CYSCGEFGHIQK	1555	sp|P62633-7|CNBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:4,4-UNIMOD:4,12-UNIMOD:188	ms_run[2]:scan=4107	26.253	2	1490.6378	1490.6378	K	D	102	114
PSM	DAVPATLHLLPCEVAVDGPAPVGR	1556	sp|Q8TDP1|RNH2C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:4	ms_run[2]:scan=10240	63.67	2	2453.2737	2453.2737	R	F	23	47
PSM	DSNNLCLHFNPR	1557	sp|P09382|LEG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	6-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=6252	38.815	2	1495.6866	1495.6866	K	F	38	50
PSM	EHAPSIIFMDEIDSIGSSR	1558	sp|P62195-2|PRS8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11638	72.931	3	2102.9943	2102.9943	R	L	232	251
PSM	EKIGPIATPDYIQNAPGLPK	1559	sp|Q9NR19|ACSA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9014	55.715	2	2121.147	2121.1470	R	T	637	657
PSM	ELIIGDRQTGK	1560	sp|P25705-2|ATPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=3438	22.395	2	1228.6776	1228.6776	R	T	158	169
PSM	FAIGSQVSEHSIIK	1561	sp|P33992|MCM5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6947	43.007	2	1514.8093	1514.8093	R	D	683	697
PSM	FAIGSQVSEHSIIK	1562	sp|P33992|MCM5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	14-UNIMOD:188	ms_run[2]:scan=6953	43.046	2	1520.8294	1520.8294	R	D	683	697
PSM	FDLLASNFPPLPGSSSR	1563	sp|Q71RC2-6|LARP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11652	73.029	2	1803.9155	1803.9155	K	M	406	423
PSM	FGQYNKEDPTSFR	1564	sp|Q15437|SC23B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5015	31.54	2	1587.7318	1587.7318	K	L	559	572
PSM	FGRDEDPVCLQLDDILSK	1565	sp|Q9NX01|TXN4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	9-UNIMOD:4	ms_run[2]:scan=11090	69.25	3	2119.0256	2119.0256	R	T	30	48
PSM	FKLITEDVQGK	1566	sp|P61247|RS3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=5853	36.458	2	1288.743	1288.7430	K	N	84	95
PSM	FLNAENAQKFK	1567	sp|P43487-2|RANG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4328	27.505	2	1308.6826	1308.6826	R	T	142	153
PSM	FLTFKDCDPGEVNK	1568	sp|Q9NYK5|RM39_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	5-UNIMOD:188,7-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=6352	39.403	2	1680.822	1680.8220	K	A	127	141
PSM	GAGKAPLNVQFNSPLPGDAVK	1569	sp|O75369-6|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	4-UNIMOD:188,21-UNIMOD:188	ms_run[2]:scan=8081	49.929	3	2091.1515	2091.1515	K	D	874	895
PSM	GAGKAPLNVQFNSPLPGDAVK	1570	sp|O75369-6|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8094	50.001	3	2079.1113	2079.1113	K	D	874	895
PSM	GAGTNEDALIEILTTR	1571	sp|P12429|ANXA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=12229	76.928	2	1672.8632	1672.8632	K	T	105	121
PSM	GGAIDRYWPTADGR	1572	sp|P52788-2|SPSY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6662	41.232	2	1533.7324	1533.7324	R	L	64	78
PSM	GHVFEESQVAGTPMFVVK	1573	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	18-UNIMOD:188	ms_run[2]:scan=8441	52.12	3	1966.9918	1966.9918	R	A	768	786
PSM	GHVTQDAPIPGSPLYTIK	1574	sp|Q15029-2|U5S1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7330	45.303	3	1892.9996	1892.9996	R	A	820	838
PSM	GHYTEGAELVDSVLDVVR	1575	sp|Q13509-2|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	18-UNIMOD:267	ms_run[2]:scan=12410	78.165	3	1967.9828	1967.9828	K	K	32	50
PSM	GHYTEGAELVDSVLDVVR	1576	sp|Q13509-2|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	18-UNIMOD:267	ms_run[2]:scan=12417	78.212	2	1967.9828	1967.9828	K	K	32	50
PSM	GIKPVTLELGGK	1577	sp|P49189-2|AL9A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6058	37.678	2	1210.7285	1210.7285	K	S	177	189
PSM	GIRPFPSEETTENDDDVYR	1578	sp|P52735-3|VAV2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6208	38.537	3	2239.0029	2239.0029	K	S	125	144
PSM	GITHIGYTDLPSR	1579	sp|Q13423|NNTM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5798	36.146	2	1428.7361	1428.7361	K	M	367	380
PSM	GIYAYGFEKPSAIQQR	1580	sp|P38919|IF4A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	9-UNIMOD:188,16-UNIMOD:267	ms_run[2]:scan=6913	42.794	2	1842.9599	1838.9718	R	A	52	68
PSM	GKQNVIMFVGLQGSGK	1581	sp|P61011-2|SRP54_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8023	49.567	2	1661.8923	1661.8923	K	T	50	66
PSM	GKVLDAIIQEK	1582	sp|Q9NTJ3-2|SMC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5974	37.168	2	1212.7078	1212.7078	R	K	597	608
PSM	GLSRQPALSAACLGPEVTTQYGGQYR	1583	sp|P13798|ACPH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:4	ms_run[2]:scan=8066	49.837	3	2779.3712	2779.3712	R	T	19	45
PSM	GLVYETSVLDPDEGIRFR	1584	sp|O75390|CISY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9883	61.354	2	2065.048	2065.0480	K	G	77	95
PSM	GTGRIPDQLVILDMK	1585	sp|P49755|TMEDA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9531	59.072	2	1654.9076	1654.9076	K	H	113	128
PSM	GVDEVTIVNILTNR	1586	sp|P07355-2|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	14-UNIMOD:267	ms_run[2]:scan=11975	75.223	3	1551.8496	1551.8496	K	S	68	82
PSM	GVMLAVDAVIAELKK	1587	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=13213	85.064	2	1555.9008	1555.9008	R	Q	143	158
PSM	GWIPGNEENKQK	1588	sp|Q9NZM1-2|MYOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=3654	23.644	2	1410.7294	1410.7294	K	T	1777	1789
PSM	GYDYGPHFQGILEASLEGDSGR	1589	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10820	67.465	3	2367.0768	2367.0768	R	L	998	1020
PSM	GYLGPEQLPDCLKGCDVVVIPAGVPR	1590	sp|P40926|MDHM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=10804	67.357	3	2808.4303	2808.4303	K	K	79	105
PSM	HCLLTCEECK	1591	sp|Q56VL3|OCAD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:4,6-UNIMOD:4,9-UNIMOD:4,10-UNIMOD:188	ms_run[2]:scan=2848	18.995	2	1354.5775	1354.5775	R	I	129	139
PSM	HFVALSTNTTK	1592	sp|P06744-2|G6PI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:188	ms_run[2]:scan=3230	21.213	2	1223.6606	1223.6606	K	V	253	264
PSM	HGGEDYVFSLLTGYCEPPTGVSLR	1593	sp|P08574|CY1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	15-UNIMOD:4	ms_run[2]:scan=12500	78.815	3	2653.2483	2653.2483	R	E	205	229
PSM	HGSNIEAMSK	1594	sp|Q9BWD1|THIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:188	ms_run[2]:scan=1212	9.8158	2	1078.5173	1078.5173	R	L	224	234
PSM	HGSNIEAMSK	1595	sp|Q9BWD1|THIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=1218	9.8482	2	1072.4971	1072.4971	R	L	224	234
PSM	HIDLVEGDEGR	1596	sp|P19367-4|HXK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:267	ms_run[2]:scan=3638	23.549	2	1248.5974	1248.5974	R	M	232	243
PSM	HIEAAFDQEAAAVLMAR	1597	sp|Q15437|SC23B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10263	63.815	3	1841.9094	1841.9094	R	L	514	531
PSM	HIYYITGETK	1598	sp|P07900-2|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:188	ms_run[2]:scan=3941	25.288	2	1229.6388	1229.6388	K	D	612	622
PSM	HNINIGITNVDVK	1599	sp|Q9Y5Y0-2|FLVC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6726	41.607	2	1435.7783	1435.7783	R	A	242	255
PSM	HNVQTLDIISR	1600	sp|Q06203|PUR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5566	34.77	2	1294.6993	1294.6993	R	S	261	272
PSM	IAAAGLDVTSPEPLPTNHPLLTLK	1601	sp|Q9UBQ7|GRHPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10103	62.785	3	2467.3686	2467.3686	K	N	263	287
PSM	IAVHPDYQGMGYGSR	1602	sp|Q9H0A0-2|NAT10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	15-UNIMOD:267	ms_run[2]:scan=5222	32.759	3	1659.7703	1659.7703	R	A	557	572
PSM	IDASELSFPFHESILK	1603	sp|P42166|LAP2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	16-UNIMOD:188	ms_run[2]:scan=11250	70.312	2	1837.9557	1837.9557	K	V	485	501
PSM	IFHELTQTDK	1604	sp|P11586|C1TC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=3510	22.817	2	1230.6245	1230.6245	R	A	464	474
PSM	IFQKGESPVDYDGGR	1605	sp|Q15084-3|PDIA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4765	30.037	3	1666.7951	1666.7951	K	T	239	254
PSM	IGAEVYHNLK	1606	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:188	ms_run[2]:scan=3707	23.944	2	1148.6285	1148.6285	R	N	184	194
PSM	IGAEVYHNLK	1607	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=3708	23.948	2	1142.6084	1142.6084	R	N	184	194
PSM	IGNFLNYGSHTGDADGFK	1608	sp|Q27J81|INF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7929	48.989	3	1911.8751	1911.8751	R	I	764	782
PSM	IGYLNDRVDELLEK	1609	sp|Q9H0P0-3|5NT3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9341	57.868	2	1675.8781	1675.8781	K	Y	246	260
PSM	IKLYSESLAR	1610	sp|P50395-2|GDIB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5183	32.537	2	1178.6659	1178.6659	R	Y	164	174
PSM	IKSDYAQLLEDMQNAFR	1611	sp|P38606-2|VATA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=12896	81.997	2	2040.9939	2040.9939	K	S	564	581
PSM	IRELESQISELQEDLESER	1612	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:267,19-UNIMOD:267	ms_run[2]:scan=10876	67.832	3	2322.1454	2322.1454	K	A	1106	1125
PSM	IREPLTAQQLETTTER	1613	sp|Q6P1N0-2|C2D1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5988	37.248	3	1884.9905	1884.9905	R	W	790	806
PSM	ISGLIYEETR	1614	sp|P62805|H4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6244	38.764	2	1179.6136	1179.6136	R	G	47	57
PSM	ISMPDVDLNLKGPK	1615	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=8347	51.552	2	1537.8577	1537.8577	K	L	1323	1337
PSM	IVELPAPADFLSLSSETKPK	1616	sp|Q6P2E9-2|EDC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11728	73.538	2	2141.162	2141.1620	R	L	191	211
PSM	KAGNFYVPAEPK	1617	sp|P18124|RL7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4580	28.989	2	1319.6874	1319.6874	R	L	77	89
PSM	KALDIAENEMPGLMR	1618	sp|P23526|SAHH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:188,15-UNIMOD:267	ms_run[2]:scan=8306	51.298	2	1702.8717	1698.8836	R	M	20	35
PSM	KATGPPVSELITK	1619	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5271	33.054	3	1339.7711	1339.7711	R	A	37	50
PSM	KDCEVVMMIGLPGAGK	1620	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	3-UNIMOD:4	ms_run[2]:scan=8972	55.448	3	1703.8409	1703.8409	K	T	476	492
PSM	KFADIGNTVK	1621	sp|P11172|UMPS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:188,10-UNIMOD:188	ms_run[2]:scan=3798	24.476	2	1103.6378	1103.6378	R	K	314	324
PSM	KGCVITISGR	1622	sp|O00154-6|BACH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	3-UNIMOD:4	ms_run[2]:scan=3390	22.119	2	1089.5965	1089.5965	R	M	235	245
PSM	KGESGQSWPR	1623	sp|Q15185-3|TEBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=1737	12.691	2	1130.5469	1130.5469	R	L	79	89
PSM	KGFSEGLWEIENNPTVK	1624	sp|P51858-2|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=8747	54.046	3	1959.014	1959.0140	R	A	73	90
PSM	KGLDPYNVLAPK	1625	sp|P10606|COX5B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6978	43.195	2	1313.7343	1313.7343	K	G	57	69
PSM	KGPGLAVQSGDK	1626	sp|Q96PK6|RBM14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=1404	10.801	2	1155.6248	1155.6248	K	T	153	165
PSM	KGVNLPGAAVDLPAVSEK	1627	sp|P14618-3|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7816	48.28	3	1763.9781	1763.9781	K	D	192	210
PSM	KIADSIGCSTNNILFLTDVTR	1628	sp|Q9UHY7-2|ENOPH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	8-UNIMOD:4	ms_run[2]:scan=11018	68.779	3	2337.1998	2337.1998	R	E	49	70
PSM	KIYIGDQVQK	1629	sp|Q9UIA9|XPO7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:188,10-UNIMOD:188	ms_run[2]:scan=3242	21.278	2	1202.7062	1202.7062	R	S	559	569
PSM	KLELDILPLQEANAELSEK	1630	sp|P12270|TPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11495	71.965	3	2152.1627	2152.1627	R	S	1299	1318
PSM	KLMNTNDLEESR	1631	sp|Q99538-3|LGMN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=3777	24.347	2	1448.6929	1448.6929	R	Q	318	330
PSM	KLTPVQVLEYGEAIAK	1632	sp|Q9BX66-4|SRBS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=10920	68.122	2	1770.033	1770.0330	K	F	510	526
PSM	KNLVELAELELK	1633	sp|Q9UNH7-2|SNX6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10513	65.424	2	1397.813	1397.8130	R	H	259	271
PSM	KNMQITILTCR	1634	sp|O95456-2|PSMG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:4	ms_run[2]:scan=6357	39.431	2	1376.7268	1376.7268	R	H	139	150
PSM	KPNEGADGQWK	1635	sp|Q8NC51-4|PAIRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=1209	9.8026	2	1228.5836	1228.5836	R	K	289	300
PSM	KPNEGADGQWK	1636	sp|Q8NC51-4|PAIRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=1210	9.807	2	1240.6239	1240.6239	R	K	289	300
PSM	KPTFMDEEVQSILTK	1637	sp|P82650|RT22_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=10167	63.2	3	1776.937	1776.9370	K	M	67	82
PSM	KQPPVSPGTALVGSQK	1638	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=3878	24.933	3	1592.8886	1592.8886	R	E	31	47
PSM	KTAFGIISTVK	1639	sp|P78346|RPP30_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=6376	39.537	2	1175.7317	1175.7317	R	K	236	247
PSM	KTYITDPVSAPCAPPLQPK	1640	sp|Q93052|LPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:4	ms_run[2]:scan=6936	42.938	3	2082.082	2082.0820	K	G	353	372
PSM	KVPGVTAIELDEDTGTFR	1641	sp|P51114-3|FXR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8229	50.822	3	1946.9949	1946.9949	R	I	161	179
PSM	LDLAGRDLTDYLMK	1642	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:35	ms_run[2]:scan=9272	57.432	2	1638.8287	1638.8287	R	I	178	192
PSM	LDTHPAMVTVLEMGAAR	1643	sp|Q12931-2|TRAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9498	58.863	3	1810.907	1810.9070	R	H	550	567
PSM	LEGVLAEVAQHYQDTLIR	1644	sp|P46940|IQGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	18-UNIMOD:267	ms_run[2]:scan=11972	75.205	3	2064.0879	2064.0879	K	A	568	586
PSM	LEGVLAEVAQHYQDTLIR	1645	sp|P46940|IQGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11983	75.277	2	2054.0797	2054.0797	K	A	568	586
PSM	LFECSNKTGR	1646	sp|P09327|VILI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	4-UNIMOD:4	ms_run[2]:scan=1745	12.738	2	1210.5765	1210.5765	R	F	621	631
PSM	LGFAGLVQEISFGTTKDK	1647	sp|P48643-2|TCPE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	16-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=12185	76.641	2	1922.0552	1922.0552	K	M	260	278
PSM	LGFAGLVQEISFGTTKDK	1648	sp|P48643-2|TCPE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=12186	76.647	2	1910.0149	1910.0149	K	M	260	278
PSM	LGFDKENVYDELR	1649	sp|O60264|SMCA5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7879	48.668	2	1596.7784	1596.7784	K	Q	962	975
PSM	LGVIEDHSNR	1650	sp|Q58FF3|ENPLL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=2269	15.698	2	1138.5731	1138.5731	K	T	151	161
PSM	LKDLEALLNSK	1651	sp|P02545-2|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=8207	50.694	2	1254.7586	1254.7586	R	E	134	145
PSM	LKELIFEETAR	1652	sp|P28482-2|MK01_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6757	41.801	2	1347.7398	1347.7398	K	F	299	310
PSM	LKNTSEQDQPMGGWEMIR	1653	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:188,18-UNIMOD:267	ms_run[2]:scan=7989	49.354	2	2135.0111	2131.0229	R	K	456	474
PSM	LLGQFTLIGIPPAPR	1654	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11868	74.492	2	1591.945	1591.9450	K	G	499	514
PSM	LNKPYIYGPTSQGER	1655	sp|P19447|ERCC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4481	28.388	2	1721.8737	1721.8737	R	M	575	590
PSM	LPATEKPVLLSK	1656	sp|Q9Y4L1|HYOU1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5003	31.473	2	1294.786	1294.7860	K	D	878	890
PSM	LREYEAALNSK	1657	sp|P20700|LMNB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=3420	22.291	2	1292.6725	1292.6725	K	D	135	146
PSM	LRITESEEVVSR	1658	sp|P02545-2|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:267,12-UNIMOD:267	ms_run[2]:scan=4686	29.602	2	1436.7738	1436.7738	R	E	61	73
PSM	LSGHQFENYSFK	1659	sp|Q9Y6M1-5|IF2B2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:188	ms_run[2]:scan=5772	35.99	2	1461.6984	1461.6984	K	I	77	89
PSM	LSHIAEDVGR	1660	sp|P98171|RHG04_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=2674	18.012	2	1095.5673	1095.5673	R	L	132	142
PSM	LVAIVDPHIK	1661	sp|Q14697|GANAB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6000	37.327	2	1103.6703	1103.6703	K	V	463	473
PSM	LYNKDAVIEFLLDK	1662	sp|Q9BY42|RTF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11789	73.952	2	1679.9134	1679.9134	R	S	56	70
PSM	MFVGGLSWDTSKK	1663	sp|Q99729-3|ROAA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:35,12-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=6896	42.685	2	1482.758	1482.7580	K	D	72	85
PSM	MGLKDTPTQEDWLVSVLPEGSR	1664	sp|Q9NQW7-2|XPP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:35	ms_run[2]:scan=11020	68.791	3	2473.2159	2473.2159	K	V	95	117
PSM	NGRVEIIANDQGNR	1665	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	3-UNIMOD:267,14-UNIMOD:267	ms_run[2]:scan=2906	19.335	2	1574.8028	1574.8028	K	I	47	61
PSM	NGRVEIIANDQGNR	1666	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=2925	19.446	3	1554.7863	1554.7863	K	I	47	61
PSM	NGSLTNHFSFEK	1667	sp|P22102|PUR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5739	35.803	2	1379.647	1379.6470	K	K	794	806
PSM	NHQSAAEYNIFEGMELR	1668	sp|Q14195|DPYL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10113	62.85	3	2007.9109	2007.9109	K	G	424	441
PSM	NHTLALTETGSVFAFGENK	1669	sp|Q9P258|RCC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9439	58.498	3	2035.0011	2035.0011	R	M	212	231
PSM	NILFVITKPDVYK	1670	sp|Q9BZK3|NACP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9637	59.772	2	1548.8916	1548.8916	K	S	100	113
PSM	NLDGISHAPNAVK	1671	sp|Q92820|GGH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:188	ms_run[2]:scan=3682	23.795	2	1340.7144	1340.7144	K	T	254	267
PSM	NNISILKEDPFLFCR	1672	sp|Q6ZN28|MACC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	14-UNIMOD:4	ms_run[2]:scan=11010	68.725	2	1864.9506	1864.9506	R	E	91	106
PSM	NPPGFAFVEFEDPRDAEDAVR	1673	sp|Q16629-3|SRSF7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10828	67.518	2	2377.0975	2377.0975	R	G	45	66
PSM	NSTFAEEFAHSIR	1674	sp|Q2M389-2|WASC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:267	ms_run[2]:scan=8294	51.22	2	1517.7138	1517.7138	K	S	281	294
PSM	NTNGSQFFITTVPTPHLDGK	1675	sp|Q08752|PPID_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9590	59.457	2	2173.0804	2173.0804	R	H	126	146
PSM	NTNGSQFFITTVPTPHLDGK	1676	sp|Q08752|PPID_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	20-UNIMOD:188	ms_run[2]:scan=9606	59.564	2	2179.1005	2179.1005	R	H	126	146
PSM	PFDPNDRCYECGEK	1677	sp|Q16629-3|SRSF7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	8-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=3559	23.094	2	1785.7087	1785.7087	R	G	99	113
PSM	PQNEYIELHR	1678	sp|O95478|NSA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:267	ms_run[2]:scan=4263	27.147	2	1307.6498	1307.6498	M	K	2	12
PSM	QGAPTSFLPPEASQLKPDR	1679	sp|Q9BUJ2-3|HNRL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8003	49.445	2	2038.0484	2038.0484	K	Q	104	123
PSM	QLEMILNKPGLK	1680	sp|P42330|AK1C3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6750	41.757	2	1382.7956	1382.7956	R	Y	172	184
PSM	QLYHLGVVEAYSGLTK	1681	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8839	54.629	3	1776.941	1776.9410	R	K	249	265
PSM	QLYHLGVVEAYSGLTK	1682	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	16-UNIMOD:188	ms_run[2]:scan=8815	54.474	2	1782.9612	1782.9612	R	K	249	265
PSM	QVQHILASASPSGR	1683	sp|O94979-5|SC31A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=3359	21.942	2	1449.7688	1449.7688	R	A	179	193
PSM	RATVLESEGTR	1684	sp|Q9UJZ1-2|STML2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:267,11-UNIMOD:267	ms_run[2]:scan=1645	12.16	2	1237.653	1237.6530	K	E	156	167
PSM	REEEEFNTGPLSVLTQSVK	1685	sp|P62316-2|SMD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10603	66.014	3	2162.0855	2162.0855	K	N	9	28
PSM	RSPNEEYVEVGR	1686	sp|P31321|KAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=3289	21.54	2	1433.6899	1433.6899	R	L	306	318
PSM	RYELPAPSSGQK	1687	sp|O75934|SPF27_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=3388	22.109	2	1331.6834	1331.6834	K	N	86	98
PSM	SCLLHQFTEK	1688	sp|P61106|RAB14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:4,10-UNIMOD:188	ms_run[2]:scan=5499	34.381	2	1267.6326	1267.6326	K	K	25	35
PSM	SDSFENPVLQQHFR	1689	sp|P12956|XRCC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7320	45.246	3	1702.8063	1702.8063	R	N	475	489
PSM	SEELNKDLNPFTPLVGIR	1690	sp|Q86U90|YRDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10873	67.814	3	2041.0844	2041.0844	R	I	156	174
PSM	SFEDRVGTIK	1691	sp|O43399-6|TPD54_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4154	26.528	2	1150.5982	1150.5982	K	S	123	133
PSM	SFGAEEHEVCR	1692	sp|Q03519-2|TAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:4	ms_run[2]:scan=2910	19.357	2	1319.5564	1319.5564	R	Y	344	355
PSM	SGCKVDLGGFAGLFDLK	1693	sp|P22102|PUR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	3-UNIMOD:4	ms_run[2]:scan=12409	78.159	2	1782.8975	1782.8975	R	A	464	481
PSM	SKTFNPGAGLPTDK	1694	sp|P09661|RU2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=4663	29.46	2	1443.7761	1443.7761	R	K	178	192
PSM	SLADIAREEASNFR	1695	sp|P25788-2|PSA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9672	59.985	3	1577.7798	1577.7798	R	S	87	101
PSM	SLERAEAGDNLGALVR	1696	sp|P49411|EFTU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	4-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=6568	40.689	3	1689.8913	1689.8913	K	G	312	328
PSM	SLHDALCVVK	1697	sp|P17987|TCPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	7-UNIMOD:4,10-UNIMOD:188	ms_run[2]:scan=5254	32.952	2	1146.6163	1146.6163	R	R	391	401
PSM	SLPDCTPHPNSISIDAGPR	1698	sp|Q9Y2H0-3|DLGP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	5-UNIMOD:4	ms_run[2]:scan=6229	38.667	2	2032.9636	2032.9636	R	Q	193	212
PSM	SNRDELELELAENR	1699	sp|Q14980-2|NUMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	3-UNIMOD:267,14-UNIMOD:267	ms_run[2]:scan=6428	39.836	2	1706.8338	1706.8338	R	K	228	242
PSM	SPQPDPVGTPTIFKPQSK	1700	sp|P46013-2|KI67_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6351	39.398	3	1923.0102	1923.0102	R	R	1863	1881
PSM	SQQERDWVLNEFK	1701	sp|P17844-2|DDX5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8370	51.693	2	1677.8111	1677.8111	K	H	297	310
PSM	SRNTDEMVELR	1702	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:267,11-UNIMOD:267	ms_run[2]:scan=3942	25.292	2	1368.6571	1368.6571	R	I	36	47
PSM	STYNHLSSWLTDAR	1703	sp|P61106|RAB14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	14-UNIMOD:267	ms_run[2]:scan=8237	50.873	2	1659.7881	1659.7881	R	N	97	111
PSM	SVDDVLSHFAQR	1704	sp|Q86Y56-2|DAAF5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:267	ms_run[2]:scan=8388	51.802	2	1382.6818	1382.6818	K	L	242	254
PSM	SVSGFLHFDTATK	1705	sp|Q92621|NU205_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8021	49.556	2	1408.6987	1408.6987	R	V	1165	1178
PSM	TCFVDCLIEQTHPEIR	1706	sp|Q15029-2|U5S1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:4,6-UNIMOD:4	ms_run[2]:scan=10209	63.468	3	2016.9397	2016.9397	K	K	108	124
PSM	TFGMAEEYHR	1707	sp|Q8N1F7|NUP93_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4269	27.182	2	1239.5343	1239.5343	R	E	121	131
PSM	TIAEQLAEKINAK	1708	sp|Q7L014|DDX46_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	9-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=7515	46.414	2	1439.8387	1439.8387	K	L	895	908
PSM	TIDLSNNKIESLPPLLIGK	1709	sp|Q8N9N7|LRC57_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	8-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=11026	68.832	3	2076.2233	2076.2233	R	F	42	61
PSM	TLAEIAKVELDNMPLR	1710	sp|Q15233-2|NONO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11317	70.77	3	1811.9815	1811.9815	R	G	31	47
PSM	TLAEIAKVELDNMPLR	1711	sp|Q15233-2|NONO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	7-UNIMOD:188,16-UNIMOD:267	ms_run[2]:scan=11337	70.902	2	1828.0099	1824.0218	R	G	31	47
PSM	TLEGELHDLR	1712	sp|P02545-2|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6178	38.357	2	1181.6041	1181.6041	R	G	157	167
PSM	TQGFLALFSGDTGEIKSEVR	1713	sp|Q9Y230-2|RUVB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11648	72.998	3	2154.0957	2154.0957	R	E	209	229
PSM	TRIIDVVYNASNNELVR	1714	sp|P62241|RS8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9163	56.729	3	1975.0487	1975.0487	K	T	76	93
PSM	TSCALTIHAIGR	1715	sp|Q5VYK3|ECM29_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	3-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=5376	33.669	2	1308.6848	1308.6848	K	Y	1457	1469
PSM	TVSSHEVFLQR	1716	sp|Q9Y5X3|SNX5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:267	ms_run[2]:scan=4195	26.762	2	1311.6811	1311.6811	K	L	139	150
PSM	VFSWLQQEGHLSEEEMAR	1717	sp|P22102|PUR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	18-UNIMOD:267	ms_run[2]:scan=9700	60.164	3	2185.0138	2185.0138	R	T	712	730
PSM	VGESVFHTTR	1718	sp|Q9P0J0|NDUAD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:267	ms_run[2]:scan=3316	21.696	2	1141.5755	1141.5755	K	W	106	116
PSM	VGGSSVDLHR	1719	sp|O60716|CTND1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=1731	12.657	2	1025.5254	1025.5254	R	F	265	275
PSM	VKIPEGTILTMDMLTVK	1720	sp|Q9NR45|SIAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11530	72.204	2	1888.0413	1888.0413	K	V	299	316
PSM	VKISFQPAVAGIK	1721	sp|Q9NQX7-2|ITM2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7339	45.356	2	1356.8129	1356.8129	M	G	2	15
PSM	VKLADIQIEQLNR	1722	sp|O60925|PFD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7752	47.87	2	1538.878	1538.8780	K	T	27	40
PSM	VLIVSEDPELPYMRPPLSK	1723	sp|O95831-6|AIFM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10244	63.695	2	2182.1708	2182.1708	R	E	72	91
PSM	VLVVHDGFEGLAK	1724	sp|P08237-2|PFKAM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:188	ms_run[2]:scan=7040	43.548	2	1388.7759	1388.7759	R	G	402	415
PSM	VRVELSNGEK	1725	sp|P84103-2|SRSF3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=2169	15.143	2	1129.6091	1129.6091	R	R	76	86
PSM	VRVTELEDEVR	1726	sp|Q9BV38|WDR18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:267,11-UNIMOD:267	ms_run[2]:scan=5559	34.732	2	1363.721	1363.7210	R	N	400	411
PSM	VRYSLDPENPTK	1727	sp|P18621|RL17_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4620	29.212	2	1417.7201	1417.7201	M	S	2	14
PSM	VSLANLKPNPGSK	1728	sp|Q9P015|RM15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4751	29.96	2	1323.751	1323.7510	R	K	22	35
PSM	VTLLEGDHVR	1729	sp|O75534-2|CSDE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:267	ms_run[2]:scan=4350	27.622	2	1147.6225	1147.6225	K	F	277	287
PSM	VTPTRTEIIILATR	1730	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	5-UNIMOD:267,14-UNIMOD:267	ms_run[2]:scan=7712	47.624	2	1602.9572	1602.9572	R	T	41	55
PSM	YFQIGTIVDNPADFYHSR	1731	sp|Q5QJE6|TDIF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	18-UNIMOD:267	ms_run[2]:scan=10814	67.422	3	2152.0253	2152.0253	K	I	687	705
PSM	YGDFRADDADEFGYSR	1732	sp|Q7KZF4|SND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	5-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=6798	42.059	3	1902.7924	1902.7924	R	-	895	911
PSM	YGGPPPDSVYSGQQPSVGTEIFVGKIPR	1733	sp|O60506-4|HNRPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	25-UNIMOD:188,28-UNIMOD:267	ms_run[2]:scan=9668	59.957	3	2947.5051	2943.5169	K	D	144	172
PSM	YKDGVVTIGCVGFPNVGK	1734	sp|P36915|GNL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:4	ms_run[2]:scan=8731	53.943	3	1908.9768	1908.9768	R	S	356	374
PSM	QLREYQELMNVK	1735	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28	ms_run[1]:scan=9643	59.80779833333333	2	1532.7667	1532.7652	R	L	370	382
PSM	QSVENDIHGLRK	1736	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28	ms_run[1]:scan=4719	29.776328333333332	2	1377.6992	1377.6996	R	V	176	188
PSM	QSVENDIHGLRK	1737	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28	ms_run[1]:scan=4723	29.79935	2	1377.6992	1377.6996	R	V	176	188
PSM	VIPELNGKLTGMAFR	1738	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	8-UNIMOD:188,15-UNIMOD:267	ms_run[1]:scan=9495	58.846655000000005	2	1661.917717	1660.930546	K	V	220	235
PSM	HEELMLGDPCLK	1739	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	10-UNIMOD:4	ms_run[1]:scan=6741	41.701005	2	1440.674655	1440.674122	K	D	651	663
PSM	IVAPGKGILAADESTGSIAK	1740	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=6517	40.379151666666665	3	1897.051313	1897.052043	R	R	23	43
PSM	NLGIGKVSSFEEK	1741	sp|P40926|MDHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	6-UNIMOD:188,13-UNIMOD:188	ms_run[1]:scan=5975	37.173568333333336	2	1418.782107	1418.780803	K	M	302	315
PSM	SNRDELELELAENR	1742	sp|Q14980|NUMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0		ms_run[1]:scan=6409	39.72815166666667	2	1687.7942	1686.8172	R	K	228	242
PSM	FCSLPEKGTLTEAFPVLGGK	1743	sp|P29144|TPP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	2-UNIMOD:4,7-UNIMOD:188,20-UNIMOD:188	ms_run[1]:scan=10516	65.44614333333334	3	2162.148919	2162.148436	K	A	709	729
PSM	CSVIRDSLLQDGEFSMDLR	1744	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:385,1-UNIMOD:4,5-UNIMOD:267,16-UNIMOD:35,19-UNIMOD:267	ms_run[1]:scan=11411	71.40665	2	2259.0316	2259.0409	K	T	71	90
PSM	NPDRVLIGGDETPEGQR	1745	sp|O60701|UGDH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:267,17-UNIMOD:267	ms_run[1]:scan=4578	28.979278333333333	3	1871.888561	1871.924042	K	A	174	191
PSM	QQHVIETLIGKK	1746	sp|P48643|TCPE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28,11-UNIMOD:188,12-UNIMOD:188	ms_run[1]:scan=7865	48.588186666666665	3	1387.8219	1387.8221	K	Q	503	515
PSM	QQHVIETLIGKK	1747	sp|P48643|TCPE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28,11-UNIMOD:188,12-UNIMOD:188	ms_run[1]:scan=7861	48.56037333333333	2	1387.8208	1387.8221	K	Q	503	515
PSM	CDRVDQLTAQLADLAAR	1748	sp|P18206|VINC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=12052	75.73774499999999	2	1897.9261	1897.9311	K	G	545	562
PSM	SQLDIIIHSLK	1749	sp|P13010|XRCC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=9755	60.524285	2	1265.737235	1265.734337	K	K	145	156
PSM	IAEELPKEPQGIIACCNPVPPLVR	1750	sp|Q01780|EXOSX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	15-UNIMOD:4,16-UNIMOD:4	ms_run[1]:scan=9612	59.60310333333333	3	2701.412325	2699.413879	K	Q	540	564
PSM	FFSDCKIQNGAQGIR	1751	sp|P31943|HNRH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	5-UNIMOD:4	ms_run[1]:scan=5710	35.62450333333333	2	1740.826059	1739.841339	R	F	30	45
PSM	RNIPETLELSAEAK	1752	sp|Q96EV2|RBM33_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=6435	39.878973333333334	2	1569.818447	1569.836236	R	A	240	254
PSM	TKFTIENVTR	1753	sp|Q9NRX1|PNO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	2-UNIMOD:188,10-UNIMOD:267	ms_run[1]:scan=4952	31.176765000000003	2	1223.684794	1223.684485	K	T	190	200
PSM	SEAEEAITSFNGHKPPGSSEPITVK	1754	sp|Q15717|ELAV1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=6751	41.76246666666667	3	2612.258621	2611.276576	R	F	158	183
PSM	NPPGFAFVEFEDPRDAEDAVR	1755	sp|Q16629|SRSF7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	14-UNIMOD:267,21-UNIMOD:267	ms_run[1]:scan=10837	67.57769666666667	3	2397.121351	2397.114027	R	G	45	66
PSM	CTLLLMLDHQPPQYK	1756	sp|Q92925|SMRD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=12841	81.55808833333333	2	1838.9023	1838.9054	K	L	298	313
PSM	FAADAVKLER	1757	sp|P37837|TALDO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	7-UNIMOD:188,10-UNIMOD:267	ms_run[1]:scan=4697	29.66130833333333	2	1134.635716	1134.636806	K	M	315	325
PSM	CFNDLKAEELLLK	1758	sp|P55212|CASP6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=12136	76.31347333333333	2	1574.7983	1574.8009	K	I	87	100
PSM	ALNDKFASLIGK	1759	sp|Q6KB66|K2C80_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=8004	49.45115	2	1275.720953	1275.718687	K	V	89	101
PSM	LFNLSKEDDVR	1760	sp|P62753|RS6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=5829	36.32667166666667	2	1335.686114	1334.683030	K	Q	144	155
PSM	VISGHQEALR	1761	sp|Q8IVS2|FABD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	10-UNIMOD:267	ms_run[1]:scan=1378	10.669523333333334	2	1119.611417	1118.607175	R	F	237	247
PSM	QIQEEITGNTEALSGRHER	1762	sp|Q9NVD7|PARVA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28	ms_run[1]:scan=7278	44.99651666666667	2	2150.0342	2150.0347	R	D	229	248
PSM	IVHLQETCDLGK	1763	sp|Q9BYT8|NEUL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	8-UNIMOD:4	ms_run[1]:scan=4519	28.625661666666662	2	1411.728163	1411.712950	R	I	146	158
PSM	RQATDDATLLIVNR	1764	sp|O75150|BRE1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=6441	39.91710333333333	2	1585.847207	1584.858369	K	Y	83	97
PSM	IRLESEEEGVPSTAIR	1765	sp|P06493|CDK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=5793	36.120178333333335	3	1786.932687	1784.926842	K	E	35	51
PSM	AAGARPLTSPESLSR	1766	sp|P46379-2|BAG6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	5-UNIMOD:267,15-UNIMOD:267	ms_run[2]:scan=3867	24.868	2	1531.8221	1531.8221	K	D	1067	1082
PSM	AALSEMVEYITHNR	1767	sp|Q13362-2|2A5G_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11295	70.62	2	1632.793	1632.7930	R	N	71	85
PSM	ACPRPEGLNFQDLK	1768	sp|P15927|RFA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:4	ms_run[2]:scan=6739	41.689	2	1643.809	1643.8090	K	N	218	232
PSM	AFEGQAHGADR	1769	sp|Q8TDB8-3|GTR14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=844	7.9179	2	1157.5214	1157.5214	R	S	129	140
PSM	AFLSTHPNTETVFEAFLK	1770	sp|Q96S44|PRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=12190	76.677	3	2051.0364	2051.0364	K	S	206	224
PSM	AGEAGKLEEVMQELR	1771	sp|Q9BR76|COR1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9854	61.17	3	1658.8298	1658.8298	R	A	447	462
PSM	AGHCAVAINTR	1772	sp|P51610-2|HCFC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	4-UNIMOD:4,11-UNIMOD:267	ms_run[2]:scan=1647	12.171	2	1178.5854	1178.5854	R	L	323	334
PSM	AIAHYEQSADYYKGEESNSSANK	1773	sp|P54920|SNAA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=3754	24.211	3	2561.1306	2561.1306	K	C	141	164
PSM	AIKELEEWYAR	1774	sp|P09496-5|CLCA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7743	47.815	2	1406.7194	1406.7194	K	Q	87	98
PSM	AIYHDLEQSIR	1775	sp|Q9UNF0-2|PACN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:267	ms_run[2]:scan=5966	37.119	2	1353.6916	1353.6916	K	A	265	276
PSM	ALKGIGTDEFTLNR	1776	sp|P12429|ANXA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7210	44.582	2	1533.8151	1533.8151	R	I	261	275
PSM	ALSAIADLLTNEHER	1777	sp|O60716|CTND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10023	62.263	3	1651.8529	1651.8529	K	V	711	726
PSM	ALTDKVTDLLGGLFSK	1778	sp|O43615|TIM44_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	5-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=13134	84.18	2	1688.9751	1688.9751	R	T	278	294
PSM	APAQKAPAPK	1779	sp|P50914|RL14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=519	6.1727	2	977.56581	977.5658	K	A	200	210
PSM	APNISMPDVDLNLKGPK	1780	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	14-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=8832	54.584	2	1819.9905	1819.9905	K	I	2450	2467
PSM	ARDDLITDLLNEAK	1781	sp|P36543-2|VATE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11613	72.768	3	1585.8312	1585.8312	R	Q	64	78
PSM	ARPEDVISEGR	1782	sp|P25325|THTM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=3321	21.728	2	1227.6208	1227.6208	R	G	283	294
PSM	ATFIKVPQNQNGK	1783	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	5-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=4059	25.978	2	1455.8237	1455.8237	K	S	509	522
PSM	CHVPLAQAQALVTSELEK	1784	sp|Q96C01|F136A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:4,18-UNIMOD:188	ms_run[2]:scan=10424	64.847	3	1999.0504	1999.0504	R	F	57	75
PSM	DDGLFSGDPNWFPKK	1785	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	14-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=10006	62.153	2	1733.8452	1733.8452	R	S	140	155
PSM	DITLFHAMDTLQR	1786	sp|O94776-2|MTA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10339	64.306	2	1559.7766	1559.7766	R	N	55	68
PSM	DTFNHLTTWLEDAR	1787	sp|P61019-2|RAB2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	14-UNIMOD:267	ms_run[2]:scan=11054	69.015	2	1727.8143	1727.8143	R	Q	68	82
PSM	DTGIFLDLMHLK	1788	sp|P12956|XRCC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	9-UNIMOD:35,12-UNIMOD:188	ms_run[2]:scan=10534	65.566	2	1423.7477	1423.7477	R	K	195	207
PSM	EAAASGLPLMVIIHK	1789	sp|O95881|TXD12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	15-UNIMOD:188	ms_run[2]:scan=10295	64.023	2	1554.8899	1554.8899	K	S	49	64
PSM	ECREPELGLEELLR	1790	sp|Q9NZL4-2|HPBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:4,3-UNIMOD:267,14-UNIMOD:267	ms_run[2]:scan=10568	65.787	2	1761.8834	1761.8834	R	H	206	220
PSM	FAQHGTFEYEYSQR	1791	sp|P23246-2|SFPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5212	32.702	3	1761.7747	1761.7747	R	W	480	494
PSM	FCACPEEAAHALELR	1792	sp|Q9NP81|SYSM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:4,4-UNIMOD:4	ms_run[2]:scan=8061	49.803	3	1772.7974	1772.7974	R	K	63	78
PSM	FCNTVHDIVNR	1793	sp|Q9UKF6|CPSF3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:4	ms_run[2]:scan=4567	28.912	2	1373.651	1373.6510	R	G	222	233
PSM	FGWDCHGLPVEYEIDK	1794	sp|P41252|SYIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	5-UNIMOD:4	ms_run[2]:scan=9851	61.152	3	1963.8774	1963.8774	R	T	83	99
PSM	FTGLSKEELLK	1795	sp|P08195-2|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	6-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=6189	38.427	2	1275.7477	1275.7477	K	V	60	71
PSM	GAKEGIILFK	1796	sp|P05455|LA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6432	39.864	2	1074.6437	1074.6437	R	E	267	277
PSM	GCLELIKETGVPIAGR	1797	sp|P11586|C1TC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:4,7-UNIMOD:188,16-UNIMOD:267	ms_run[2]:scan=8200	50.654	2	1727.9575	1723.9693	K	H	151	167
PSM	GFCFLEYEDHK	1798	sp|O43390|HNRPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	3-UNIMOD:4	ms_run[2]:scan=8293	51.214	2	1443.6129	1443.6129	R	S	290	301
PSM	GGGPQAQSHGEAR	1799	sp|Q7L2J0|MEPCE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=461	5.8397	2	1250.5752	1250.5752	R	L	87	100
PSM	GHLENNPALEK	1800	sp|P05388-2|RLA0_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:188	ms_run[2]:scan=1848	13.316	2	1226.6351	1226.6351	R	L	67	78
PSM	GHPDLQGQPAEEIFESVGDR	1801	sp|P49257|LMAN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9318	57.718	3	2180.0134	2180.0134	K	E	310	330
PSM	GIISAADRLEAAEMYR	1802	sp|P11172|UMPS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	8-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=8607	53.171	2	1784.8994	1784.8994	R	K	452	468
PSM	GIVFEDVKVPK	1803	sp|P11310|ACADM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	8-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=7214	44.606	2	1241.7422	1241.7422	R	E	249	260
PSM	GKLDGNQDLIR	1804	sp|P48735-2|IDHP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=3719	24.005	2	1227.6571	1227.6571	R	F	331	342
PSM	GKLDVQFSGLTK	1805	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=6559	40.635	2	1303.7539	1303.7539	K	G	905	917
PSM	GKVLDAIIQEK	1806	sp|Q9NTJ3-2|SMC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=5965	37.114	2	1224.748	1224.7480	R	K	597	608
PSM	GKYSEVFEAINITNNER	1807	sp|P19784|CSK22_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8857	54.743	3	1982.9698	1982.9698	R	V	49	66
PSM	GPNVFQGYLKDPAK	1808	sp|P33121|ACSL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=7306	45.16	2	1544.839	1544.8390	K	T	512	526
PSM	GREEWESAALQNANTK	1809	sp|Q5T4S7-3|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:267,16-UNIMOD:188	ms_run[2]:scan=5233	32.822	2	1818.8831	1814.8950	R	C	4876	4892
PSM	GTGRIPDQLVILDMK	1810	sp|P49755|TMEDA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9529	59.061	3	1654.9076	1654.9076	K	H	113	128
PSM	GYGFVHFETQEAAER	1811	sp|P11940-2|PABP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7033	43.508	3	1739.7903	1739.7903	K	A	139	154
PSM	GYNPGLLVHPDLAYLQAEGGGDR	1812	sp|P19838|NFKB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10151	63.093	3	2411.187	2411.1870	R	Q	164	187
PSM	HFEATDILVSK	1813	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:188	ms_run[2]:scan=6683	41.362	2	1264.6759	1264.6759	R	I	1175	1186
PSM	HGYAPSDLPVK	1814	sp|Q9Y5Q8-2|TF3C5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:188	ms_run[2]:scan=4258	27.124	2	1188.6235	1188.6235	K	A	319	330
PSM	HIAEVSQEVTR	1815	sp|P61764|STXB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:267	ms_run[2]:scan=2575	17.448	2	1277.6603	1277.6603	K	S	295	306
PSM	HISDSVFLEAAK	1816	sp|P23368|MAOM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:188	ms_run[2]:scan=6461	40.041	2	1321.6973	1321.6973	R	A	485	497
PSM	HISDSVFLEAAK	1817	sp|P23368|MAOM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6472	40.104	2	1315.6772	1315.6772	R	A	485	497
PSM	HIYYITGETK	1818	sp|P07900-2|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=3943	25.297	2	1223.6186	1223.6186	K	D	612	622
PSM	HLSSCAAPAPLTSAER	1819	sp|Q6IBS0|TWF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	5-UNIMOD:4	ms_run[2]:scan=3912	25.11	2	1666.8097	1666.8097	K	E	137	153
PSM	HNTAVSQLTK	1820	sp|Q9NTJ3-2|SMC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:188	ms_run[2]:scan=1560	11.681	2	1103.6031	1103.6031	R	A	513	523
PSM	HSVPLPTELSSEAK	1821	sp|Q6UXV4|MIC27_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5629	35.141	2	1493.7726	1493.7726	K	T	219	233
PSM	IDISNVKIPK	1822	sp|Q02878|RL6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6369	39.503	2	1125.6758	1125.6758	K	H	201	211
PSM	IFREDYSITTK	1823	sp|Q9BUQ8|DDX23_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5097	32.017	2	1371.7034	1371.7034	R	G	372	383
PSM	IGRIEDVTPIPSDSTR	1824	sp|P62263|RS14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	3-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=6037	37.554	2	1774.9328	1774.9328	K	R	126	142
PSM	ILDKCNEIINWLDK	1825	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	5-UNIMOD:4	ms_run[2]:scan=10369	64.496	3	1772.9131	1772.9131	K	N	570	584
PSM	ILLLNEMEKLEK	1826	sp|P35573|GDE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10500	65.347	2	1471.832	1471.8320	R	T	9	21
PSM	ILLLNEMEKLEK	1827	sp|P35573|GDE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	9-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=10511	65.413	2	1483.8723	1483.8723	R	T	9	21
PSM	IPQSHIQQICETILTSGENLAR	1828	sp|O43813|LANC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:4,22-UNIMOD:267	ms_run[2]:scan=11486	71.905	3	2517.2885	2517.2885	K	K	174	196
PSM	IQHILCTGNLCTK	1829	sp|Q9UBQ0|VPS29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	6-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=5093	31.998	3	1556.7803	1556.7803	K	E	31	44
PSM	IRDEMVATEQER	1830	sp|P16615-5|AT2A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:267,12-UNIMOD:267	ms_run[2]:scan=2916	19.394	2	1495.7204	1495.7204	K	T	235	247
PSM	IRDEMVATEQER	1831	sp|P16615-5|AT2A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2918	19.404	2	1475.7038	1475.7038	K	T	235	247
PSM	IREIADGLCLEVEGK	1832	sp|P13693|TCTP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	9-UNIMOD:4	ms_run[2]:scan=7876	48.651	3	1700.8767	1700.8767	K	M	20	35
PSM	IRELESQISELQEDLESER	1833	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10890	67.927	3	2302.1288	2302.1288	K	A	1106	1125
PSM	IRLESEEEGVPSTAIR	1834	sp|P06493-2|CDK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=5785	36.071	3	1804.9434	1804.9434	K	E	35	51
PSM	IVSSSDVGHDEYSTQSLVKK	1835	sp|Q01082-3|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=4796	30.214	3	2178.0804	2178.0804	K	H	753	773
PSM	KAGNFYVPAEPK	1836	sp|P18124|RL7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=4579	28.984	2	1331.7276	1331.7276	R	L	77	89
PSM	KFADIGNTVK	1837	sp|P11172|UMPS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=3807	24.527	2	1091.5975	1091.5975	R	K	314	324
PSM	KFDQLLAEEK	1838	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5280	33.104	2	1219.6449	1219.6449	K	T	1445	1455
PSM	KFDQLLAEEK	1839	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:188,10-UNIMOD:188	ms_run[2]:scan=5281	33.109	2	1231.6851	1231.6851	K	T	1445	1455
PSM	KGEVFLYEIGGNIGER	1840	sp|Q8N392-2|RHG18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9347	57.904	3	1779.9155	1779.9155	K	C	576	592
PSM	KIGLETVGVK	1841	sp|Q16881-7|TRXR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=4787	30.159	2	1042.6386	1042.6386	R	I	261	271
PSM	KITIGQGNTEK	1842	sp|Q6UB35|C1TM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=1436	10.964	2	1199.6913	1199.6913	R	G	586	597
PSM	KIYIGDQVQK	1843	sp|Q9UIA9|XPO7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=3246	21.298	2	1190.6659	1190.6659	R	S	559	569
PSM	KLELDILPLQEANAELSEK	1844	sp|P12270|TPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=11527	72.185	3	2164.203	2164.2030	R	S	1299	1318
PSM	KLLLSATSGEK	1845	sp|Q9NW13-2|RBM28_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=3441	22.411	2	1157.7058	1157.7058	R	G	364	375
PSM	KLQEQEVFFK	1846	sp|Q9H2G2-2|SLK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5913	36.81	2	1294.6921	1294.6921	R	M	1165	1175
PSM	KLTPITYPQGLAMAK	1847	sp|P63000|RAC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7553	46.646	3	1630.9116	1630.9116	K	E	133	148
PSM	KPDQPYEWLSYK	1848	sp|P33121|ACSL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7932	49.007	2	1552.7562	1552.7562	R	Q	113	125
PSM	KQGLEQFINK	1849	sp|O60493-2|SNX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5275	33.073	2	1203.6612	1203.6612	R	V	87	97
PSM	KVIDDTNITR	1850	sp|P05783|K1C18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2699	18.156	2	1173.6354	1173.6354	R	L	187	197
PSM	KVQVPNCDEIFYAGTGNLLLR	1851	sp|P53621|COPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	7-UNIMOD:4	ms_run[2]:scan=11114	69.408	3	2406.2366	2406.2366	K	D	447	468
PSM	KVWLDPNETNEIANANSR	1852	sp|P84098|RL19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:188,18-UNIMOD:267	ms_run[2]:scan=6790	42.006	2	2086.0414	2082.0533	K	Q	21	39
PSM	LAQGLTHLGK	1853	sp|Q13200-2|PSMD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:188	ms_run[2]:scan=3630	23.501	2	1042.6231	1042.6231	R	G	605	615
PSM	LDTHPAMVTVLEMGAAR	1854	sp|Q12931-2|TRAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	17-UNIMOD:267	ms_run[2]:scan=9502	58.891	3	1820.9152	1820.9152	R	H	550	567
PSM	LEGLTDEINFLR	1855	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11156	69.686	2	1418.7405	1418.7405	R	Q	214	226
PSM	LFQEDPEAFLLYHR	1856	sp|O43159|RRP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10713	66.735	3	1776.8835	1776.8835	R	G	269	283
PSM	LFTAHNNMTNYATVWASK	1857	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8621	53.26	3	2067.9836	2067.9836	K	T	738	756
PSM	LFVGNLPADITEDEFKR	1858	sp|P23246-2|SFPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10364	64.466	3	1963.0051	1963.0051	R	L	299	316
PSM	LGFDKENVYDELR	1859	sp|O60264|SMCA5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7883	48.696	3	1596.7784	1596.7784	K	Q	962	975
PSM	LGSRPQPAEAYAEAVQR	1860	sp|Q5T447|HECD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5242	32.876	3	1841.9384	1841.9384	R	L	190	207
PSM	LGSRPQPAEAYAEAVQR	1861	sp|Q5T447|HECD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	4-UNIMOD:267,17-UNIMOD:267	ms_run[2]:scan=5247	32.908	3	1861.9549	1861.9549	R	L	190	207
PSM	LGVIEDHSNR	1862	sp|Q58FF3|ENPLL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:267	ms_run[2]:scan=2276	15.735	2	1148.5814	1148.5814	K	T	151	161
PSM	LHGLDEEAEQK	1863	sp|P33991|MCM4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2262	15.661	2	1267.6044	1267.6044	R	L	429	440
PSM	LHVGNISPTCTNK	1864	sp|Q9BWF3|RBM4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=3675	23.753	2	1445.7392	1445.7392	K	E	80	93
PSM	LKQNLEEQLDR	1865	sp|Q8WZA0|LZIC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=4092	26.164	2	1384.731	1384.7310	K	L	12	23
PSM	LKVGLQVVAVK	1866	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6473	40.109	3	1152.7594	1152.7594	R	A	291	302
PSM	LLASTLVHSVK	1867	sp|Q9NYF8-3|BCLF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6070	37.743	2	1166.7023	1166.7023	R	K	568	579
PSM	LLDVVHPAAK	1868	sp|Q99832|TCPH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=4221	26.912	2	1061.6233	1061.6233	K	T	68	78
PSM	LLGQFTLIGIPPAPR	1869	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=12017	75.504	2	1591.945	1591.9450	K	G	499	514
PSM	LLLETHLPSK	1870	sp|O00567|NOP56_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:188	ms_run[2]:scan=6100	37.92	2	1155.6959	1155.6959	R	K	78	88
PSM	LLSLLEKDEFK	1871	sp|P35270|SPRE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8378	51.741	2	1333.7493	1333.7493	K	S	241	252
PSM	LMELHGEGSSSGK	1872	sp|P61247|RS3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	13-UNIMOD:188	ms_run[2]:scan=2624	17.72	2	1336.6388	1336.6388	K	A	228	241
PSM	LQAEIEGLKGQR	1873	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:267	ms_run[2]:scan=4290	27.289	2	1350.7495	1350.7495	R	A	317	329
PSM	LQISHEAAACITGLR	1874	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=7013	43.394	3	1648.8594	1648.8594	K	A	1090	1105
PSM	LRLQAEEVAQQK	1875	sp|Q15149-7|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=3908	25.087	2	1411.7783	1411.7783	R	S	1612	1624
PSM	LSHIAEDVGR	1876	sp|P98171|RHG04_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:267	ms_run[2]:scan=2688	18.09	2	1105.5755	1105.5755	R	L	132	142
PSM	LSPDAIPGKWTSQDSLLGMEFSGR	1877	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11219	70.107	3	2591.269	2591.2690	K	D	1583	1607
PSM	LSPELLNTGRFETK	1878	sp|P52789|HXK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7195	44.487	2	1603.857	1603.8570	K	D	324	338
PSM	LTEHQVAEPPEDWPALIWQQQR	1879	sp|Q6P2E9-2|EDC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11537	72.252	3	2670.319	2670.3190	R	E	557	579
PSM	LTEHQVAEPPEDWPALIWQQQR	1880	sp|Q6P2E9-2|EDC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	22-UNIMOD:267	ms_run[2]:scan=11573	72.502	3	2680.3273	2680.3273	R	E	557	579
PSM	LTEPQHGLGSQR	1881	sp|Q13586-2|STIM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:267	ms_run[2]:scan=2117	14.848	2	1331.6821	1331.6821	R	G	503	515
PSM	LVAIVDVIDQNR	1882	sp|P50914|RL14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:267	ms_run[2]:scan=9800	60.82	2	1363.7699	1363.7699	K	A	24	36
PSM	LYFLQCETCHSR	1883	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	6-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=6491	40.221	2	1612.7126	1612.7126	R	C	297	309
PSM	LYFLQCETCHSR	1884	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	6-UNIMOD:4,9-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=6519	40.389	2	1622.7209	1622.7209	R	C	297	309
PSM	LYHVSDSEGNLVVR	1885	sp|P09327|VILI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5910	36.796	3	1586.8053	1586.8053	K	E	255	269
PSM	LYPNMTAVLLHNTQLDQR	1886	sp|Q8TCS8|PNPT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10283	63.946	3	2126.0943	2126.0943	K	K	698	716
PSM	MIYASSKDAIK	1887	sp|P60981-2|DEST_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:35	ms_run[2]:scan=2283	15.768	2	1241.6326	1241.6326	K	K	98	109
PSM	MKGLEEPEMDPK	1888	sp|Q1KMD3|HNRL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:35	ms_run[2]:scan=3513	22.832	2	1418.6422	1418.6422	R	S	495	507
PSM	MLFKDDYPSSPPK	1889	sp|P63279|UBC9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:35	ms_run[2]:scan=5113	32.113	2	1539.7279	1539.7279	R	C	62	75
PSM	MMANGILKVPAINVNDSVTK	1890	sp|P23526|SAHH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9428	58.423	2	2114.1228	2114.1228	K	S	167	187
PSM	MVVPGLDGAQIPRDPSQQELPR	1891	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:35	ms_run[2]:scan=7669	47.369	3	2418.2325	2418.2325	K	L	1159	1181
PSM	MVVPGLDGAQIPRDPSQQELPR	1892	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8694	53.712	2	2402.2376	2402.2376	K	L	1159	1181
PSM	NDSQHLFIEPR	1893	sp|Q8TEQ6|GEMI5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:267	ms_run[2]:scan=5425	33.96	2	1364.6712	1364.6712	R	T	142	153
PSM	NEEDAAELVALAQAVNAR	1894	sp|P22314-2|UBA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	18-UNIMOD:267	ms_run[2]:scan=11263	70.402	2	1892.9467	1892.9467	R	A	311	329
PSM	NFYVEHPEVAR	1895	sp|Q92841|DDX17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=4812	30.312	2	1359.6571	1359.6571	K	L	133	144
PSM	NFYVEHPEVAR	1896	sp|Q92841|DDX17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:267	ms_run[2]:scan=4817	30.345	2	1369.6654	1369.6654	K	L	133	144
PSM	NGLSLAALKK	1897	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5397	33.799	2	1013.6233	1013.6233	R	A	58	68
PSM	NGLSLAALKK	1898	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	9-UNIMOD:188,10-UNIMOD:188	ms_run[2]:scan=5406	33.85	2	1025.6636	1025.6636	R	A	58	68
PSM	NIVDKTASFVAR	1899	sp|Q15459-2|SF3A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6337	39.312	2	1319.7197	1319.7197	R	N	51	63
PSM	NRGDLTADSVQR	1900	sp|P49069|CAMLG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:267,12-UNIMOD:267	ms_run[2]:scan=1890	13.558	2	1350.6755	1350.6755	R	G	135	147
PSM	NRGDLTADSVQR	1901	sp|P49069|CAMLG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=1902	13.626	2	1330.6589	1330.6589	R	G	135	147
PSM	NVIFQPVAELKK	1902	sp|Q01813-2|PFKAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7301	45.132	2	1384.8078	1384.8078	R	Q	718	730
PSM	QLYVLGHEAMK	1903	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6022	37.461	2	1287.6645	1287.6645	R	R	18	29
PSM	QSVENDIHGLR	1904	sp|P05783|K1C18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:267	ms_run[2]:scan=4217	26.886	2	1276.6399	1276.6399	R	K	176	187
PSM	QTELFAHFIQPAAQK	1905	sp|O60264|SMCA5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8588	53.049	2	1727.8995	1727.8995	K	T	98	113
PSM	RALQAAIQQLAEAQPEATAK	1906	sp|Q92616|GCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:267,20-UNIMOD:188	ms_run[2]:scan=8144	50.308	3	2123.167	2119.1788	R	N	68	88
PSM	RAQQQAEAER	1907	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:267,10-UNIMOD:267	ms_run[2]:scan=443	5.7352	2	1205.6016	1205.6016	R	A	1581	1591
PSM	REEQIVQLLNSVQAK	1908	sp|Q9H2U1|DHX36_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:267,15-UNIMOD:188	ms_run[2]:scan=9403	58.265	2	1769.997	1766.0089	R	N	91	106
PSM	RGDTVATLSER	1909	sp|P22102|PUR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:267,11-UNIMOD:267	ms_run[2]:scan=2591	17.54	2	1223.6373	1223.6373	K	V	965	976
PSM	RLEDLSESIVNDFAYMK	1910	sp|P49755|TMEDA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	16-UNIMOD:35	ms_run[2]:scan=10860	67.727	2	2044.9776	2044.9776	R	K	153	170
PSM	RLQEETGAK	1911	sp|Q5VWX1|KHDR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=624	6.7461	2	1030.5407	1030.5407	K	M	90	99
PSM	RQLETLGQEK	1912	sp|P05787|K2C8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2124	14.889	2	1200.6463	1200.6463	R	L	149	159
PSM	RQVQDESQR	1913	sp|Q15149-7|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:267,9-UNIMOD:267	ms_run[2]:scan=448	5.7626	2	1164.575	1164.5750	R	K	1469	1478
PSM	RSPNEEYVEVGR	1914	sp|P31321|KAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:267,12-UNIMOD:267	ms_run[2]:scan=3298	21.592	2	1453.7064	1453.7064	R	L	306	318
PSM	SASVNKEPVSLPGIMR	1915	sp|Q8WWI1-3|LMO7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7288	45.054	2	1683.8978	1683.8978	R	R	1157	1173
PSM	SHPLDPIDTVDFER	1916	sp|P47897-2|SYQ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	14-UNIMOD:267	ms_run[2]:scan=8117	50.143	2	1649.7925	1649.7925	R	E	85	99
PSM	SKDIFDQLAK	1917	sp|P25205|MCM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6705	41.485	2	1163.6186	1163.6186	R	S	292	302
PSM	SKGAVAIADAIR	1918	sp|P46060|RAGP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=4996	31.431	2	1170.6721	1170.6721	R	G	278	290
PSM	SKLTFSCLGGSDNFK	1919	sp|Q15185-3|TEBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	7-UNIMOD:4	ms_run[2]:scan=7185	44.429	3	1659.7927	1659.7927	K	H	34	49
PSM	SLEEKIGCLLK	1920	sp|P05455|LA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	8-UNIMOD:4	ms_run[2]:scan=8555	52.841	2	1288.7061	1288.7061	K	F	225	236
PSM	SLGSVQAPSYGARPVSSAASVYAGAGGSGSR	1921	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6902	42.721	2	2853.4005	2853.4005	R	I	15	46
PSM	SNFAEALAAHK	1922	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5289	33.153	2	1157.5829	1157.5829	K	Y	32	43
PSM	SNFAEALAAHK	1923	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:188	ms_run[2]:scan=5293	33.175	2	1163.6031	1163.6031	K	Y	32	43
PSM	SNMDNMFESYINNLRR	1924	sp|P05787|K2C8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	15-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=11612	72.761	2	2022.9155	2022.9155	R	Q	134	150
PSM	SPQPDPVGTPTIFKPQSK	1925	sp|P46013-2|KI67_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6356	39.425	2	1923.0102	1923.0102	R	R	1863	1881
PSM	SPYQEFTDHLVK	1926	sp|P15880|RS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7789	48.11	2	1462.7092	1462.7092	K	T	264	276
PSM	SRGEGPEAEFQSLTPSQIK	1927	sp|Q9H425-2|CA198_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7911	48.875	3	2060.0174	2060.0174	R	S	68	87
PSM	SRNTDEMVELR	1928	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:267,7-UNIMOD:35,11-UNIMOD:267	ms_run[2]:scan=2197	15.3	2	1384.652	1384.6520	R	I	36	47
PSM	STFVLDEFKR	1929	sp|P26641|EF1G_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7572	46.759	2	1240.6452	1240.6452	K	K	286	296
PSM	SVDCFLHDFASK	1930	sp|O00186|STXB3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	4-UNIMOD:4	ms_run[2]:scan=8567	52.917	2	1424.6395	1424.6395	K	S	87	99
PSM	TCFSPNRVIGLSSDLQQVGGASAR	1931	sp|O00303|EIF3F_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:4	ms_run[2]:scan=9230	57.163	2	2519.2551	2519.2551	K	I	255	279
PSM	TCHSFIINEK	1932	sp|Q99613-2|EIF3C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:4	ms_run[2]:scan=3952	25.344	2	1247.5969	1247.5969	K	M	741	751
PSM	TLEGELHDLR	1933	sp|P02545-2|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:267	ms_run[2]:scan=6171	38.322	2	1191.6123	1191.6123	R	G	157	167
PSM	TLPLCVIGGDHK	1934	sp|Q8NFH4|NUP37_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	5-UNIMOD:4,12-UNIMOD:188	ms_run[2]:scan=6648	41.151	2	1314.7061	1314.7061	R	L	307	319
PSM	TLPLCVIGGDHK	1935	sp|Q8NFH4|NUP37_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	5-UNIMOD:4	ms_run[2]:scan=6651	41.167	2	1308.686	1308.6860	R	L	307	319
PSM	TQQWTAICPLKER	1936	sp|Q9H2C0|GAN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	8-UNIMOD:4	ms_run[2]:scan=6722	41.584	2	1629.8297	1629.8297	R	R	445	458
PSM	TWKEVCFACVDGK	1937	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	3-UNIMOD:188,6-UNIMOD:4,9-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=6968	43.14	3	1610.7624	1610.7624	R	E	1252	1265
PSM	VAKLDTSQWPLLLK	1938	sp|O60832-2|DKC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	3-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=10542	65.618	2	1622.9798	1622.9798	K	N	44	58
PSM	VAYVSFGPHAGK	1939	sp|P50914|RL14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:188	ms_run[2]:scan=4935	31.076	2	1237.6551	1237.6551	R	L	12	24
PSM	VAYVSFGPHAGK	1940	sp|P50914|RL14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=4945	31.136	2	1231.635	1231.6350	R	L	12	24
PSM	VELDNMPLRGK	1941	sp|Q15233-2|NONO_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5309	33.275	2	1270.6704	1270.6704	K	Q	38	49
PSM	VETGILRPGMVVTFAPVNITTEVK	1942	sp|Q05639|EF1A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11609	72.743	3	2570.4142	2570.4142	R	S	267	291
PSM	VFDKEGNGTVMGAELR	1943	sp|P05976-2|MYL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5670	35.387	3	1721.8407	1721.8407	R	H	94	110
PSM	VFSWLQQEGHLSEEEMAR	1944	sp|P22102|PUR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9705	60.194	3	2175.0055	2175.0055	R	T	712	730
PSM	VHELNEEIGK	1945	sp|Q9Y383-3|LC7L2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2889	19.233	2	1166.5932	1166.5932	R	L	123	133
PSM	VKLAAVDATVNQVLASR	1946	sp|Q15084-3|PDIA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:188,17-UNIMOD:267	ms_run[2]:scan=9774	60.649	2	1770.0334	1766.0453	K	Y	212	229
PSM	VLAEMREQYEAMAER	1947	sp|P13646-2|K1C13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	6-UNIMOD:267,15-UNIMOD:267	ms_run[2]:scan=7129	44.087	3	1844.8664	1844.8664	R	N	261	276
PSM	VQIEHISSLIK	1948	sp|O00231|PSD11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:188	ms_run[2]:scan=7064	43.691	2	1271.7545	1271.7545	R	L	345	356
PSM	VRLAEAEETAR	1949	sp|Q8N163-2|CCAR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2605	17.612	2	1243.6521	1243.6521	R	T	866	877
PSM	VSLERLDLDLTADSQPPVFK	1950	sp|Q13263-2|TIF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11009	68.719	3	2242.1845	2242.1845	R	V	406	426
PSM	VTLLEGDHVR	1951	sp|O75534-2|CSDE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=4348	27.613	2	1137.6142	1137.6142	K	F	277	287
PSM	VTPTRTEIIILATR	1952	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7705	47.581	2	1582.9406	1582.9406	R	T	41	55
PSM	WCDCKLPNSK	1953	sp|Q13148|TADBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:4,4-UNIMOD:4	ms_run[2]:scan=3234	21.232	2	1306.5798	1306.5798	R	Q	172	182
PSM	WSPTHEQQLISGSLDNIVK	1954	sp|Q9GZL7|WDR12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10097	62.745	3	2151.096	2151.0960	K	L	350	369
PSM	YDGHLPIEIK	1955	sp|P43490|NAMPT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:188	ms_run[2]:scan=6551	40.588	2	1189.6439	1189.6439	K	A	108	118
PSM	YFTDAGLKELSDFLR	1956	sp|Q9Y6E2|BZW2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=12778	81.041	2	1773.8938	1773.8938	K	V	233	248
PSM	YGDFRADDADEFGYSR	1957	sp|Q7KZF4|SND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6792	42.019	3	1882.7758	1882.7758	R	-	895	911
PSM	YGFGEAGKPK	1958	sp|Q13451|FKBP5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2521	17.138	2	1052.5291	1052.5291	R	F	223	233
PSM	YKETDLLILFK	1959	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11280	70.517	2	1381.7857	1381.7857	K	D	175	186
PSM	YQELPNSGPPHDR	1960	sp|P19525-2|E2AK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2873	19.142	2	1508.7008	1508.7008	K	R	27	40
PSM	YRDQFTDQQK	1961	sp|O43795-2|MYO1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=1877	13.479	2	1327.6157	1327.6157	K	L	868	878
PSM	YVDTPFGKPSDALILGK	1962	sp|Q13126-7|MTAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9354	57.951	3	1819.972	1819.9720	K	I	33	50
PSM	YVDTPFGKPSDALILGK	1963	sp|Q13126-7|MTAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9364	58.012	2	1819.972	1819.9720	K	I	33	50
PSM	YYRESADPLGAWLQDAR	1964	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10636	66.232	3	2009.9595	2009.9595	R	R	1179	1196
PSM	QLREYQELMNVK	1965	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28,3-UNIMOD:267,9-UNIMOD:35,12-UNIMOD:188	ms_run[1]:scan=7589	46.86031333333334	2	1564.7878	1564.7885	R	L	370	382
PSM	QLREYQELMNVK	1966	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28,3-UNIMOD:267,12-UNIMOD:188	ms_run[1]:scan=9654	59.87937666666667	2	1548.7949	1548.7936	R	L	370	382
PSM	QSVENDIHGLRK	1967	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28,11-UNIMOD:267,12-UNIMOD:188	ms_run[1]:scan=4083	26.110095	2	1394.7132	1393.7282	R	V	176	188
PSM	TYDATTHFETTCDDIKNIYK	1968	sp|P50395|GDIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	12-UNIMOD:4	ms_run[1]:scan=7498	46.310595	3	2435.094585	2435.095106	R	R	403	423
PSM	LAQANGWGVMVSHR	1969	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=6634	41.06564166666667	2	1525.745087	1524.761966	K	S	359	373
PSM	GNEEAQIFRPLK	1970	sp|Q15029|U5S1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	9-UNIMOD:267,12-UNIMOD:188	ms_run[1]:scan=6311	39.165225	2	1416.771369	1416.769611	R	F	570	582
PSM	ICGDIHGQYYDLLR	1971	sp|P62136|PP1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	2-UNIMOD:4,14-UNIMOD:267	ms_run[1]:scan=8037	49.65591833333333	2	1731.822742	1731.827809	K	L	61	75
PSM	DSNNLCLHFNPR	1972	sp|P09382|LEG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	6-UNIMOD:4	ms_run[1]:scan=6214	38.57011166666666	2	1486.673061	1485.678296	K	F	38	50
PSM	QQHVIETLIGK	1973	sp|P48643|TCPE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28,11-UNIMOD:188	ms_run[1]:scan=8960	55.38697333333333	2	1253.7077	1253.7070	K	K	503	514
PSM	NSSYVHGGLDSNGKPADAVYGQK	1974	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=4537	28.737313333333336	3	2364.095903	2363.114202	K	E	37	60
PSM	RTDIFGVEETAIGK	1975	sp|Q15459|SF3A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:267,14-UNIMOD:188	ms_run[1]:scan=7943	49.073883333333335	3	1550.828954	1550.827520	R	K	473	487
PSM	LKPNLGNGADLPNYR	1976	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=6192	38.44065166666667	3	1641.846201	1640.863454	K	W	159	174
PSM	CKEMCHPGECPFNCNQK	1977	sp|Q6ZNB6|NFXL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:385,1-UNIMOD:4,5-UNIMOD:4,10-UNIMOD:4,14-UNIMOD:4	ms_run[1]:scan=4855	30.588598333333334	3	2177.8173	2177.8204	R	V	779	796
PSM	EFPGFLENQKDPLAVDK	1978	sp|P60903|S10AA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:27,10-UNIMOD:188,17-UNIMOD:188	ms_run[1]:scan=11351	70.99346666666666	2	1940.0024	1940.0077	K	I	38	55
PSM	EKIGPIATPDYIQNAPGLPK	1979	sp|Q9NR19|ACSA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	2-UNIMOD:188,20-UNIMOD:188	ms_run[1]:scan=9018	55.74334833333333	3	2133.184503	2133.187264	R	T	637	657
PSM	QISVADLPGLIEGAHMNK	1980	sp|A4D1E9|GTPBA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28,18-UNIMOD:188	ms_run[1]:scan=12655	79.994525	2	1880.9720	1880.9756	K	G	197	215
PSM	TCFSPNRVIGLSSDLQQVGGASAR	1981	sp|O00303|EIF3F_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	2-UNIMOD:4	ms_run[1]:scan=9206	57.01024666666667	3	2521.260624	2519.255070	K	I	255	279
PSM	SLADIAREEASNFR	1982	sp|P25788|PSA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=9673	59.989943333333336	2	1578.784178	1577.779784	R	S	87	101
PSM	TIQGHLQSENFK	1983	sp|O15042|SR140_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	12-UNIMOD:188	ms_run[1]:scan=3857	24.812863333333333	2	1407.727191	1406.724957	R	Q	636	648
PSM	QLLTDFCTHLPNLPDSTAK	1984	sp|Q9BT78|CSN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28,7-UNIMOD:4	ms_run[1]:scan=11950	75.05626333333333	2	2153.0404	2153.0458	R	E	64	83
PSM	LAQGLTHLGK	1985	sp|Q13200|PSMD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=3640	23.558583333333335	2	1036.604683	1036.602929	R	G	764	774
PSM	TLVPHYCELVGANPK	1986	sp|Q96KG9|SCYL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	7-UNIMOD:4	ms_run[1]:scan=6690	41.397575	2	1697.851706	1696.860677	K	V	235	250
PSM	CKELFPIQMEGVK	1987	sp|O96008|TOM40_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:188,13-UNIMOD:188	ms_run[1]:scan=10642	66.26835666666666	2	1572.8125	1572.8078	K	L	90	103
PSM	KDPELWGSVLLESNPYR	1988	sp|Q00610|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:188,17-UNIMOD:267	ms_run[1]:scan=10393	64.64591999999999	2	2021.072370	2018.044390	R	R	951	968
PSM	LVINGNPITIFQERDPSK	1989	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	14-UNIMOD:267,18-UNIMOD:188	ms_run[1]:scan=10266	63.83765166666667	3	2057.118297	2056.128788	K	I	67	85
PSM	AAALEFLNRFEEAK	1990	sp|P31948-2|STIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10351	64.381	2	1607.8308	1607.8308	K	R	126	140
PSM	AALCHFCIDMLNAK	1991	sp|P54920|SNAA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	4-UNIMOD:4,7-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=8932	55.22	3	1668.7882	1668.7882	K	L	209	223
PSM	AARLDILDTAGQEEFGAMR	1992	sp|P62070-3|RRAS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9741	60.426	2	2063.0106	2063.0106	R	E	26	45
PSM	ACQSIYPLHDVFVR	1993	sp|P61247|RS3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:4	ms_run[2]:scan=8707	53.791	3	1703.8454	1703.8454	K	K	200	214
PSM	ADHGEPIGR	1994	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=804	7.7108	2	950.45699	950.4570	R	G	169	178
PSM	AGGEAGVTLGQPHLSR	1995	sp|Q2VIR3-2|IF2GL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	16-UNIMOD:267	ms_run[2]:scan=4894	30.83	3	1558.8091	1558.8091	M	Q	2	18
PSM	AGLAMPGPPLGPVLGQR	1996	sp|Q9Y3B7-3|RM11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10357	64.421	2	1629.9025	1629.9025	R	G	26	43
PSM	AGLLQVYIHTQK	1997	sp|Q92979|NEP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7366	45.529	2	1369.7718	1369.7718	R	N	103	115
PSM	AHSGAAPWQPLAAPSGASAQAAEQLQR	1998	sp|P51617-4|IRAK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	27-UNIMOD:267	ms_run[2]:scan=7994	49.388	3	2680.3345	2680.3345	R	G	475	502
PSM	AHSNPDFLPVDNCLQSVLGQR	1999	sp|Q5VSL9-2|STRP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	13-UNIMOD:4,21-UNIMOD:267	ms_run[2]:scan=11001	68.665	3	2376.152	2376.1520	R	V	691	712
PSM	AHVVPCFDASK	2000	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	6-UNIMOD:4	ms_run[2]:scan=4077	26.079	2	1229.5863	1229.5863	K	V	1152	1163
PSM	AKLQIELGK	2001	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4746	29.93	2	998.61243	998.6124	R	C	101	110
PSM	AKLQIELGK	2002	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:188,9-UNIMOD:188	ms_run[2]:scan=4749	29.95	2	1010.6527	1010.6527	R	C	101	110
PSM	ALELTGLKVFGNEIK	2003	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10510	65.408	3	1630.9294	1630.9294	K	L	363	378
PSM	ALGAHLEAEPK	2004	sp|Q9NUQ3-2|TXLNG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:188	ms_run[2]:scan=3054	20.189	2	1140.6235	1140.6235	R	S	364	375
PSM	ALQFLEEVKVSR	2005	sp|P40227-2|TCPZ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=8538	52.734	2	1417.7929	1417.7929	K	E	85	97
PSM	ANSFTVSSVAAPSWLHR	2006	sp|Q00341-2|VIGLN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	17-UNIMOD:267	ms_run[2]:scan=9217	57.08	3	1838.9303	1838.9303	K	F	328	345
PSM	APNISMPDVDLNLKGPK	2007	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	14-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=8788	54.306	3	1819.9905	1819.9905	K	I	2450	2467
PSM	AQAGEGVRPSPMQLELR	2008	sp|O00764-3|PDXK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6581	40.764	2	1837.9469	1837.9469	K	M	203	220
PSM	ARAETEELIR	2009	sp|P29590-14|PML_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=3125	20.595	2	1186.6306	1186.6306	R	E	271	281
PSM	ARQEELYSELQAR	2010	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:267,13-UNIMOD:267	ms_run[2]:scan=5642	35.221	3	1611.812	1611.8120	R	E	3187	3200
PSM	ASKPLPPAPAPDEYLVSPITGEK	2011	sp|Q15459-2|SF3A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=8636	53.352	3	2376.2577	2376.2577	K	I	332	355
PSM	ATAAFILANEHNVALFK	2012	sp|O00410-2|IPO5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10044	62.395	3	1828.9836	1828.9836	R	H	136	153
PSM	ATGREEGLEVGPPEVLDTLSQLLK	2013	sp|Q13459-2|MYO9B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=13726	91.496	3	2550.3541	2550.3541	R	V	420	444
PSM	CFSEENHEPLR	2014	sp|Q96QK1|VPS35_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:4	ms_run[2]:scan=3187	20.955	2	1416.6092	1416.6092	K	T	640	651
PSM	CITDPQTGLCLLPLKEK	2015	sp|Q15149-7|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=9419	58.365	2	1985.0326	1985.0326	R	K	4076	4093
PSM	CPEALFQPSFLGMESCGIHETTFNSIMK	2016	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:4,16-UNIMOD:4,27-UNIMOD:35,28-UNIMOD:188	ms_run[2]:scan=11786	73.934	3	3252.4695	3252.4695	R	C	257	285
PSM	DFSMADKVLPTIPK	2017	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	7-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=9477	58.736	2	1572.8624	1572.8624	R	E	573	587
PSM	DITLFHAMDTLQR	2018	sp|O94776-2|MTA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	13-UNIMOD:267	ms_run[2]:scan=10342	64.323	3	1569.7849	1569.7849	R	N	55	68
PSM	DMAAFNERPIIFALSNPTSK	2019	sp|P48163-2|MAOX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11477	71.845	3	2221.1201	2221.1201	K	A	318	338
PSM	DNIQGITKPAIR	2020	sp|P62805|H4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4605	29.133	2	1324.7463	1324.7463	R	R	25	37
PSM	DTYGVRPLFK	2021	sp|P08243-3|ASNS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6483	40.171	2	1194.6397	1194.6397	R	A	55	65
PSM	DVPLVHLDEITLFK	2022	sp|Q96ME1-4|FXL18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=12342	77.7	2	1637.9029	1637.9029	R	S	693	707
PSM	EFESVLVDAFSHVAR	2023	sp|Q9NQG5|RPR1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=12225	76.904	2	1704.8471	1704.8471	R	E	80	95
PSM	EGDVLTLLESEREAR	2024	sp|P62857|RS28_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9515	58.971	2	1715.869	1715.8690	R	R	52	67
PSM	EIEELKELLPEIR	2025	sp|P49321-2|NASP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11042	68.934	2	1609.8927	1609.8927	K	E	299	312
PSM	EKQPPIDNIIR	2026	sp|P52292|IMA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5523	34.522	2	1321.7354	1321.7354	R	A	107	118
PSM	ELNHMLSDTGNR	2027	sp|Q96FQ6|S10AG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:267	ms_run[2]:scan=3578	23.202	2	1395.644	1395.6440	K	K	45	57
PSM	ESAIVSRPLNPFTAK	2028	sp|Q9Y314|NOSIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7235	44.734	2	1628.8886	1628.8886	K	A	118	133
PSM	ESGRFQDVGPQAPVGSVYQK	2029	sp|Q9UJU6|DBNL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5784	36.065	3	2148.06	2148.0600	K	T	145	165
PSM	FAGDKGYLTK	2030	sp|P60903|S10AA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=3135	20.648	2	1098.571	1098.5710	K	E	19	29
PSM	FASENDLPEWKER	2031	sp|P43487-2|RANG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6333	39.29	2	1619.758	1619.7580	R	G	58	71
PSM	FCACPEEAAHALELR	2032	sp|Q9NP81|SYSM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:4,4-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=8047	49.717	3	1782.8057	1782.8057	R	K	63	78
PSM	FGNDGLHEPLDWAQEEGK	2033	sp|Q9Y606-2|TRUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=8243	50.913	3	2040.9177	2040.9177	R	V	319	337
PSM	FKGTESISK	2034	sp|Q00688|FKBP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=1317	10.353	2	995.52876	995.5288	R	V	72	81
PSM	FNEEHIPDSPFVVPVASPSGDAR	2035	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	23-UNIMOD:267	ms_run[2]:scan=9779	60.684	3	2476.1898	2476.1898	K	R	2303	2326
PSM	FNSLNELVDYHR	2036	sp|P62993-2|GRB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7997	49.407	2	1505.7263	1505.7263	K	S	84	96
PSM	FQLKGEYDASK	2037	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	4-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=4063	25.996	2	1296.6753	1296.6753	K	K	218	229
PSM	FRTDEADDVK	2038	sp|O60524-4|NEMF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2103	14.764	2	1194.5517	1194.5517	R	F	95	105
PSM	FTGLSKEELLK	2039	sp|P08195-2|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6190	38.432	2	1263.7075	1263.7075	K	V	60	71
PSM	GFCFLEYEDHK	2040	sp|O43390|HNRPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:4,11-UNIMOD:188	ms_run[2]:scan=8286	51.172	2	1449.633	1449.6330	R	S	290	301
PSM	GFGDLKSPAGLQVLNDYLADK	2041	sp|P24534|EF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	6-UNIMOD:188,21-UNIMOD:188	ms_run[2]:scan=11849	74.364	3	2232.1829	2232.1829	M	S	2	23
PSM	GGPNIITLADIVKDPVSR	2042	sp|Q8NEV1|CSK23_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11443	71.617	2	1864.0418	1864.0418	R	T	90	108
PSM	GGSRGEEVGELSR	2043	sp|P09543-2|CN37_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2151	15.041	2	1331.643	1331.6430	K	G	337	350
PSM	GHVSLAAELSK	2044	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4407	27.931	2	1110.6033	1110.6033	K	E	3050	3061
PSM	GIDRYNPENLATLER	2045	sp|Q9UBQ5-2|EIF3K_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	4-UNIMOD:267,15-UNIMOD:267	ms_run[2]:scan=7452	46.05	3	1779.9018	1779.9018	K	Y	17	32
PSM	GKGGEIQPVSVK	2046	sp|P61604|CH10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=2469	16.846	2	1209.712	1209.7120	K	V	55	67
PSM	GLDSFLNRDGEVK	2047	sp|Q96QC0|PP1RA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7082	43.794	2	1448.726	1448.7260	K	S	14	27
PSM	GLGHQVATDALVAMEK	2048	sp|Q9Y3I0|RTCB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	16-UNIMOD:188	ms_run[2]:scan=7794	48.143	3	1644.8601	1644.8601	R	A	264	280
PSM	GPWALEEESLVGREPEER	2049	sp|O00515|LAD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=8703	53.77	3	2082.0018	2082.0018	R	K	152	170
PSM	GSYVSIHSSGFR	2050	sp|O00148-3|DX39A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:267	ms_run[2]:scan=4709	29.725	2	1305.6341	1305.6341	K	D	36	48
PSM	GVNLDPLGKWSK	2051	sp|P46087-2|NOP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=8049	49.729	2	1324.7542	1324.7542	R	T	328	340
PSM	HAALQDIGK	2052	sp|Q9ULX3|NOB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2268	15.695	2	951.51378	951.5138	R	N	17	26
PSM	HCSQVDSVR	2053	sp|Q14247-3|SRC8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:4,9-UNIMOD:267	ms_run[2]:scan=762	7.4901	2	1096.4959	1096.4959	K	G	111	120
PSM	HGDLPDIQIK	2054	sp|P78527-2|PRKDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5953	37.042	2	1134.6033	1134.6033	R	H	2777	2787
PSM	HLSSLTDNEQADIFER	2055	sp|O60343-2|TBCD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	16-UNIMOD:267	ms_run[2]:scan=7261	44.894	3	1883.8889	1883.8889	R	V	483	499
PSM	HPSAVTACNLDLENLVTDSNR	2056	sp|Q9Y678|COPG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	8-UNIMOD:4	ms_run[2]:scan=9268	57.409	3	2325.1019	2325.1019	K	S	318	339
PSM	HSEIQQLER	2057	sp|Q12846|STX4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2810	18.782	2	1138.5731	1138.5731	R	S	207	216
PSM	HSGPNSADSANDGFVR	2058	sp|P52597|HNRPF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2598	17.574	3	1629.7132	1629.7132	K	L	99	115
PSM	HSQEELLQR	2059	sp|Q6P2E9-2|EDC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2564	17.391	2	1138.5731	1138.5731	R	L	585	594
PSM	HSQEELLQR	2060	sp|Q6P2E9-2|EDC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:267	ms_run[2]:scan=2568	17.41	2	1148.5814	1148.5814	R	L	585	594
PSM	HVLTTLGEK	2061	sp|P14649|MYL6B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2727	18.303	2	996.5604	996.5604	R	M	168	177
PSM	HVTQEFVSR	2062	sp|P16144-4|ITB4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:267	ms_run[2]:scan=2152	15.046	2	1111.565	1111.5650	R	T	1718	1727
PSM	HVTQEFVSR	2063	sp|P16144-4|ITB4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2157	15.072	2	1101.5567	1101.5567	R	T	1718	1727
PSM	IAAAGLDVTSPEPLPTNHPLLTLK	2064	sp|Q9UBQ7|GRHPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	24-UNIMOD:188	ms_run[2]:scan=10112	62.844	3	2473.3888	2473.3888	K	N	263	287
PSM	IAKEEIFGPVQPILK	2065	sp|P47895|AL1A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=8886	54.929	3	1693.0217	1693.0217	R	F	407	422
PSM	IFHTVTTTDDPVIR	2066	sp|O15371-2|EIF3D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5839	36.386	3	1613.8413	1613.8413	R	K	174	188
PSM	IIECTHCGCR	2067	sp|P41223|BUD31_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	4-UNIMOD:4,7-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=999	8.7135	2	1304.5424	1304.5424	R	G	131	141
PSM	IIGVDINKDK	2068	sp|P11766|ADHX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	8-UNIMOD:188,10-UNIMOD:188	ms_run[2]:scan=4209	26.838	2	1125.6796	1125.6796	R	F	219	229
PSM	IILDLISESPIKGR	2069	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:188,14-UNIMOD:267	ms_run[2]:scan=9964	61.88	2	1568.9472	1564.9591	K	A	184	198
PSM	ILFSSREEQQDILSK	2070	sp|O14976-2|GAK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7109	43.96	3	1791.9367	1791.9367	K	F	655	670
PSM	ILSCGEVIHVK	2071	sp|Q9H2U2|IPYR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	4-UNIMOD:4,11-UNIMOD:188	ms_run[2]:scan=5163	32.418	2	1259.7003	1259.7003	K	I	177	188
PSM	IQVQHPAAK	2072	sp|P49368-2|TCPG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:188	ms_run[2]:scan=1009	8.7681	2	996.58119	996.5812	K	S	32	41
PSM	ISQRDENGELR	2073	sp|O15355|PPM1G_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	4-UNIMOD:267,11-UNIMOD:267	ms_run[2]:scan=1173	9.6157	2	1335.6646	1335.6646	K	L	460	471
PSM	ITLPVDFVTADKFDENAK	2074	sp|P00558-2|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10580	65.862	3	2022.031	2022.0310	K	T	252	270
PSM	IYGFYDECKR	2075	sp|P62136|PP1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	8-UNIMOD:4	ms_run[2]:scan=5462	34.169	2	1349.6074	1349.6074	R	R	133	143
PSM	KAEAGAGSATEFQFR	2076	sp|P46783|RS10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:188,15-UNIMOD:267	ms_run[2]:scan=5223	32.764	2	1584.7867	1580.7986	K	G	139	154
PSM	KALDIAENEMPGLMR	2077	sp|P23526|SAHH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:35	ms_run[2]:scan=6220	38.61	2	1702.8382	1702.8382	R	M	20	35
PSM	KCEPIVMTVPR	2078	sp|Q9BR76|COR1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:4	ms_run[2]:scan=5401	33.819	2	1328.6945	1328.6945	R	K	344	355
PSM	KDCEVVMMIGLPGAGK	2079	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:188,3-UNIMOD:4,7-UNIMOD:35,16-UNIMOD:188	ms_run[2]:scan=8037	49.656	2	1731.876	1731.8760	K	T	476	492
PSM	KGIDYDFPSLILQK	2080	sp|Q9BYG3|MK67I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10624	66.151	3	1635.8872	1635.8872	K	T	179	193
PSM	KGPEADSEWR	2081	sp|Q14152-2|EIF3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2241	15.55	2	1173.5415	1173.5415	R	R	867	877
PSM	KGVAINFVK	2082	sp|P38919|IF4A3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:188,9-UNIMOD:188	ms_run[2]:scan=4912	30.936	2	986.63156	986.6316	R	N	374	383
PSM	KICYQEVSQCFGVLSSR	2083	sp|Q16531|DDB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:188,3-UNIMOD:4,10-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=8633	53.334	2	2076.0103	2072.0222	R	I	723	740
PSM	KICYQEVSQCFGVLSSR	2084	sp|Q16531|DDB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:188,3-UNIMOD:4,10-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=8641	53.383	2	2076.0103	2072.0222	R	I	723	740
PSM	KILDPNTGEPAPVLSSPPPADVSTFLAFPSPEK	2085	sp|P46060|RAGP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:188,33-UNIMOD:188	ms_run[2]:scan=11799	74.018	3	3429.811	3429.8110	R	L	413	446
PSM	KIVFVTGNAK	2086	sp|Q9BY32-3|ITPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=3651	23.625	2	1075.639	1075.6390	K	K	9	19
PSM	KLDSELTAR	2087	sp|O60610-2|DIAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2574	17.443	2	1031.5611	1031.5611	K	H	478	487
PSM	KLQANGPVAK	2088	sp|Q14978|NOLC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=985	8.6463	2	1024.6029	1024.6029	R	K	67	77
PSM	KLSGDQPAAR	2089	sp|Q13428-2|TCOF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=676	7.0302	2	1041.5567	1041.5567	R	T	1271	1281
PSM	KLVIVGDGACGK	2090	sp|P61586|RHOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:188,10-UNIMOD:4,12-UNIMOD:188	ms_run[2]:scan=3555	23.075	2	1227.7048	1227.7048	K	T	7	19
PSM	KPITTGGVTYR	2091	sp|Q14192|FHL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2596	17.564	2	1191.6612	1191.6612	K	E	167	178
PSM	KQGLEQFINK	2092	sp|O60493-2|SNX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:188,10-UNIMOD:188	ms_run[2]:scan=5273	33.063	2	1215.7014	1215.7014	R	V	87	97
PSM	KQLQAIEFNK	2093	sp|O76094-2|SRP72_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4338	27.56	2	1217.6768	1217.6768	K	A	240	250
PSM	KQLQAIEFNK	2094	sp|O76094-2|SRP72_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:188,10-UNIMOD:188	ms_run[2]:scan=4340	27.57	2	1229.7171	1229.7171	K	A	240	250
PSM	KQLQDEMLR	2095	sp|P02545-2|LMNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=3662	23.686	2	1159.6019	1159.6019	K	R	181	190
PSM	KSGVGNVFIK	2096	sp|Q13310-2|PABP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:188,10-UNIMOD:188	ms_run[2]:scan=4108	26.259	2	1059.6479	1059.6479	R	N	95	105
PSM	KVFIEDVSR	2097	sp|P00966|ASSY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4284	27.261	2	1091.5975	1091.5975	K	E	58	67
PSM	KVPGVTAIELDEDTGTFR	2098	sp|P51114-3|FXR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:188,18-UNIMOD:267	ms_run[2]:scan=8225	50.798	2	1963.0233	1959.0352	R	I	161	179
PSM	LAELLTQQHGLQCR	2099	sp|Q9H6R4-2|NOL6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	13-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=6038	37.56	3	1675.8703	1675.8703	R	A	765	779
PSM	LAIKLPDDQIPK	2100	sp|Q01813-2|PFKAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	4-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=7524	46.468	2	1361.8321	1361.8321	R	T	389	401
PSM	LAKENAPAIIFIDEIDAIATK	2101	sp|P43686-2|PRS6B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=13710	91.37	3	2255.2413	2255.2413	R	R	222	243
PSM	LEAMCFDGVKR	2102	sp|P47813|IF1AX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	5-UNIMOD:4	ms_run[2]:scan=5679	35.44	2	1324.6268	1324.6268	R	L	47	58
PSM	LFFVDTGSKEK	2103	sp|Q9NZM5|NOP53_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=6480	40.154	2	1281.7008	1281.7008	K	G	86	97
PSM	LGGKLTGTANK	2104	sp|P09874|PARP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=1192	9.712	2	1058.6084	1058.6084	K	A	415	426
PSM	LGSFNLEKVENPAEVIR	2105	sp|Q13426-3|XRCC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9361	57.994	3	1914.0211	1914.0211	R	E	108	125
PSM	LHAVNAEECNVLQGR	2106	sp|O75521-2|ECI2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:4	ms_run[2]:scan=5111	32.102	3	1708.8315	1708.8315	K	W	325	340
PSM	LIEDTEDWRPR	2107	sp|Q96HC4-3|PDLI5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:267,11-UNIMOD:267	ms_run[2]:scan=5725	35.718	2	1448.7163	1448.7163	R	T	141	152
PSM	LKEGDTIIVPGVEGPIVTQIR	2108	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10043	62.389	3	2233.2682	2233.2682	R	G	882	903
PSM	LKVGLQVVAVK	2109	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6469	40.089	2	1152.7594	1152.7594	R	A	291	302
PSM	LLAVQELLDREALEK	2110	sp|Q7L9B9|EEPD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10950	68.321	2	1738.9829	1738.9829	K	F	296	311
PSM	LLEVQGSRPGK	2111	sp|P62136|PP1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2675	18.017	2	1182.6721	1182.6721	R	N	16	27
PSM	LLSDPNYGVHLPAVK	2112	sp|Q9BTV4|TMM43_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7944	49.079	2	1621.8828	1621.8828	K	L	100	115
PSM	LMEVMNHVLGK	2113	sp|P09327|VILI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:35	ms_run[2]:scan=5429	33.981	2	1285.6523	1285.6523	K	R	222	233
PSM	LNENHSGELWK	2114	sp|Q13418-3|ILK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=3920	25.158	2	1325.6364	1325.6364	K	G	65	76
PSM	LNFGNKDQNVK	2115	sp|Q7L4I2-2|RSRC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2659	17.923	2	1275.6571	1275.6571	K	F	309	320
PSM	LQEVFGHAIK	2116	sp|P54136-2|SYRC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:188	ms_run[2]:scan=5457	34.138	2	1146.6493	1146.6493	R	A	8	18
PSM	LSPKAEEVATFFAK	2117	sp|P11387|TOP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=8249	50.948	2	1536.8188	1536.8188	K	M	249	263
PSM	LTFCHQGLSNVLDDPK	2118	sp|Q86TI2-4|DPP9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	4-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=7897	48.781	2	1848.9136	1848.9136	R	S	222	238
PSM	LTPLSHEVISR	2119	sp|Q2VIR3-2|IF2GL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4652	29.398	2	1250.6983	1250.6983	K	Q	28	39
PSM	LVINGNPITIFQERDPSK	2120	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10184	63.312	3	2040.1004	2040.1004	K	I	25	43
PSM	LVINGNPITIFQERDPSK	2121	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10178	63.27	2	2040.1004	2040.1004	K	I	25	43
PSM	LVNLKELADEALQK	2122	sp|Q9NR19|ACSA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	5-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=10631	66.198	3	1594.9333	1594.9333	K	C	223	237
PSM	LWDLENGKQIK	2123	sp|Q9GZS3|WDR61_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	8-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=6223	38.628	2	1354.7648	1354.7648	R	S	90	101
PSM	MEQERQEQEER	2124	sp|Q16643|DREB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:35,5-UNIMOD:267,11-UNIMOD:267	ms_run[2]:scan=457	5.8117	2	1526.6534	1526.6534	R	E	211	222
PSM	MLFKDDYPSSPPK	2125	sp|P63279|UBC9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5833	36.349	2	1523.733	1523.7330	R	C	62	75
PSM	MMANGILKVPAINVNDSVTK	2126	sp|P23526|SAHH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9387	58.16	3	2114.1228	2114.1228	K	S	167	187
PSM	MMITSQDVLHSWAVPTLGLK	2127	sp|P00403|COX2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:35	ms_run[2]:scan=11833	74.253	2	2242.149	2242.1490	R	T	152	172
PSM	MQASIEKGGSLPK	2128	sp|P06748|NPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:35,7-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=2507	17.057	2	1372.7423	1372.7423	K	V	251	264
PSM	MQNHGYENPTYK	2129	sp|Q06481-5|APLP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:35,12-UNIMOD:188	ms_run[2]:scan=1493	11.32	2	1502.6556	1502.6556	K	Y	504	516
PSM	MVVPGLDGAQIPRDPSQQELPR	2130	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:35,13-UNIMOD:267,22-UNIMOD:267	ms_run[2]:scan=7664	47.339	3	2438.2491	2438.2491	K	L	1159	1181
PSM	NCMTDLLAKLEAK	2131	sp|Q00765-2|REEP5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:4,9-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=11637	72.926	2	1517.7984	1517.7984	K	T	17	30
PSM	NHQNLLDSLEQYVK	2132	sp|Q93008-1|USP9X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	14-UNIMOD:188	ms_run[2]:scan=11143	69.604	3	1705.8731	1705.8731	R	G	1746	1760
PSM	NHQNLLDSLEQYVK	2133	sp|Q93008-1|USP9X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11152	69.662	3	1699.8529	1699.8529	R	G	1746	1760
PSM	NKIEELQQR	2134	sp|Q4V328-3|GRAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2208	15.363	2	1156.62	1156.6200	R	K	148	157
PSM	NRPEDYQGGR	2135	sp|Q15084-3|PDIA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:267,10-UNIMOD:267	ms_run[2]:scan=687	7.0965	2	1210.5594	1210.5594	K	T	106	116
PSM	NRVPSAGDVEK	2136	sp|Q15785|TOM34_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=1533	11.533	2	1170.5993	1170.5993	K	A	182	193
PSM	QLYVLGHEAMK	2137	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:188	ms_run[2]:scan=6023	37.467	2	1293.6847	1293.6847	R	R	18	29
PSM	QQAAQAFIHNSLYGPGTNR	2138	sp|Q9UMY1|NOL7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7238	44.755	3	2072.0188	2072.0188	R	T	187	206
PSM	QQHVIETLIGK	2139	sp|P48643-2|TCPE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:188	ms_run[2]:scan=5937	36.951	2	1270.7341	1270.7341	K	K	410	421
PSM	QTELFAHFIQPAAQK	2140	sp|O60264|SMCA5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	15-UNIMOD:188	ms_run[2]:scan=8586	53.037	2	1733.9196	1733.9196	K	T	98	113
PSM	RAQQQAEAER	2141	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=444	5.7405	2	1185.585	1185.5850	R	A	1581	1591
PSM	REEEEDFIR	2142	sp|Q96A65|EXOC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:267,9-UNIMOD:267	ms_run[2]:scan=3833	24.681	2	1241.5791	1241.5791	K	A	668	677
PSM	REEEEDFIR	2143	sp|Q96A65|EXOC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=3834	24.687	2	1221.5626	1221.5626	K	A	668	677
PSM	REEEEFNTGPLSVLTQSVK	2144	sp|P62316-2|SMD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10567	65.782	3	2162.0855	2162.0855	K	N	9	28
PSM	RLDECEEAFQGTK	2145	sp|P61289|PSME3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	5-UNIMOD:4	ms_run[2]:scan=3860	24.833	3	1581.7093	1581.7093	R	V	88	101
PSM	RQVPVEEAR	2146	sp|P11234|RALB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=1103	9.2548	2	1082.5833	1082.5833	R	S	136	145
PSM	RVTVLEQNGEK	2147	sp|Q8WUX9|CHMP7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2038	14.403	2	1271.6834	1271.6834	K	I	209	220
PSM	SAHATAPVNIAGSR	2148	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2890	19.238	2	1350.7004	1350.7004	R	T	2343	2357
PSM	SFGAEEHEVCR	2149	sp|Q03519-2|TAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:4,11-UNIMOD:267	ms_run[2]:scan=2898	19.286	2	1329.5647	1329.5647	R	Y	344	355
PSM	SHAVACVNQFIISR	2150	sp|Q92973-3|TNPO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	6-UNIMOD:4	ms_run[2]:scan=6998	43.308	3	1600.8144	1600.8144	R	T	150	164
PSM	SHEGETAYIR	2151	sp|Q07955|SRSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=1918	13.716	2	1161.5415	1161.5415	R	V	182	192
PSM	SIVTDLVSQMDPHGR	2152	sp|O60313-13|OPA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11191	69.916	2	1653.8145	1653.8145	R	R	410	425
PSM	SKINVNEIFYDLVR	2153	sp|P61224-2|RAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=12337	77.669	3	1708.9148	1708.9148	K	Q	103	117
PSM	SLADIAREEASNFR	2154	sp|P25788-2|PSA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	7-UNIMOD:267,14-UNIMOD:267	ms_run[2]:scan=9670	59.969	3	1597.7963	1597.7963	R	S	87	101
PSM	SLEICHPQER	2155	sp|Q9Y305-3|ACOT9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	5-UNIMOD:4,10-UNIMOD:267	ms_run[2]:scan=3001	19.887	2	1277.6062	1277.6062	K	N	235	245
PSM	SLGTADVHFER	2156	sp|Q86V81|THOC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:267	ms_run[2]:scan=4957	31.207	2	1240.6076	1240.6076	R	K	145	156
PSM	SLYSEKEVFIR	2157	sp|Q12931-2|TRAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6532	40.468	2	1369.7242	1369.7242	R	E	51	62
PSM	SNMGHPEPASGLAALAK	2158	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6072	37.758	3	1649.8195	1649.8195	K	V	327	344
PSM	SPAVKPAAAPK	2159	sp|Q14978|NOLC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=856	7.9785	2	1035.6077	1035.6077	K	Q	397	408
PSM	SRNTDEMVELR	2160	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	7-UNIMOD:35	ms_run[2]:scan=2205	15.348	2	1364.6354	1364.6354	R	I	36	47
PSM	TGAHLELSLAK	2161	sp|Q00341-2|VIGLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:188	ms_run[2]:scan=5543	34.638	2	1144.6548	1144.6548	R	D	147	158
PSM	TGAHLELSLAK	2162	sp|Q00341-2|VIGLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5555	34.705	2	1138.6346	1138.6346	R	D	147	158
PSM	THEAQIQEMR	2163	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:267	ms_run[2]:scan=2080	14.635	2	1251.5905	1251.5905	K	Q	1182	1192
PSM	THNSSLEYNIFEGMECR	2164	sp|Q16555|DPYL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	16-UNIMOD:4	ms_run[2]:scan=9657	59.893	3	2085.8884	2085.8884	K	G	424	441
PSM	THNSSLEYNIFEGMECR	2165	sp|Q16555|DPYL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	16-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=9661	59.914	3	2095.8967	2095.8967	K	G	424	441
PSM	THSDQFLVAFK	2166	sp|P36542-2|ATPG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7456	46.071	2	1291.6561	1291.6561	R	E	144	155
PSM	TNREGLEYIPLR	2167	sp|Q15392-2|DHC24_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:267,12-UNIMOD:267	ms_run[2]:scan=6769	41.871	2	1479.7949	1479.7949	K	H	273	285
PSM	TPVEPEVAIHR	2168	sp|P60866|RS20_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:267	ms_run[2]:scan=4054	25.948	2	1256.6753	1256.6753	K	I	9	20
PSM	TPVEPEVAIHR	2169	sp|P60866|RS20_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4060	25.983	3	1246.667	1246.6670	K	I	9	20
PSM	TQHGVLSQQFVELINK	2170	sp|Q12846|STX4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	16-UNIMOD:188	ms_run[2]:scan=9457	58.612	3	1846.0044	1846.0044	K	C	125	141
PSM	TTIHEMFLSTLDPK	2171	sp|Q9Y305-3|ACOT9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9605	59.558	2	1631.8229	1631.8229	R	T	199	213
PSM	TVSSHEVFLQR	2172	sp|Q9Y5X3|SNX5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4215	26.876	2	1301.6728	1301.6728	K	L	139	150
PSM	TYSLGSALRPSTSR	2173	sp|P08670|VIME_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:267,14-UNIMOD:267	ms_run[2]:scan=5480	34.267	2	1514.7956	1514.7956	R	S	37	51
PSM	VAFERGEEPGK	2174	sp|Q08211|DHX9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2243	15.56	2	1217.6041	1217.6041	R	S	457	468
PSM	VCDEPHPLLVK	2175	sp|P35250-2|RFC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:4,11-UNIMOD:188	ms_run[2]:scan=4349	27.617	2	1311.6952	1311.6952	K	E	220	231
PSM	VCHLGDQLEGVNTPR	2176	sp|O00471|EXOC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:4	ms_run[2]:scan=5344	33.484	3	1693.8206	1693.8206	K	Q	110	125
PSM	VETGILRPGMVVTFAPVNITTEVK	2177	sp|Q05639|EF1A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:35	ms_run[2]:scan=10776	67.171	3	2586.4091	2586.4091	R	S	267	291
PSM	VFEGNRPTNSIVFTK	2178	sp|P06744-2|G6PI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5894	36.7	2	1707.8944	1707.8944	K	L	478	493
PSM	VKEGMNIVEAMER	2179	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:35	ms_run[2]:scan=4146	26.48	2	1520.7327	1520.7327	K	F	132	145
PSM	VKEGMNIVEAMER	2180	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	5-UNIMOD:35	ms_run[2]:scan=5713	35.647	2	1520.7327	1520.7327	K	F	132	145
PSM	VLIPVKQYPK	2181	sp|Q5VWX1|KHDR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4773	30.08	2	1183.7329	1183.7329	R	F	64	74
PSM	VLPEKLGVDLDAQTWR	2182	sp|P22102|PUR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	5-UNIMOD:188,16-UNIMOD:267	ms_run[2]:scan=9190	56.905	2	1855.0174	1851.0293	R	I	693	709
PSM	VLSMTGVGQTLVWCLHKE	2183	sp|P30047-2|GFRP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	14-UNIMOD:4	ms_run[2]:scan=11433	71.55	2	2057.0438	2057.0438	R	-	56	74
PSM	VNVGAGSHPNK	2184	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:188	ms_run[2]:scan=694	7.1309	2	1084.5721	1084.5721	R	V	761	772
PSM	VSILESLDKWER	2185	sp|P10644-2|KAP0_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10579	65.857	2	1473.7827	1473.7827	K	L	253	265
PSM	VTIAQGGVLPNIQAVLLPK	2186	sp|P04908|H2A1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=12611	79.62	2	1930.1615	1930.1615	R	K	101	120
PSM	VVDLMAHMASKE	2187	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	8-UNIMOD:35,11-UNIMOD:188	ms_run[2]:scan=3753	24.205	2	1351.6571	1351.6571	R	-	282	294
PSM	VVDLMAHMASKE	2188	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6162	38.271	3	1329.6421	1329.6421	R	-	282	294
PSM	VYNYNHLMPTR	2189	sp|P61353|RL27_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:267	ms_run[2]:scan=5554	34.7	2	1416.6848	1416.6848	K	Y	74	85
PSM	VYNYNHLMPTR	2190	sp|P61353|RL27_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5557	34.716	2	1406.6765	1406.6765	K	Y	74	85
PSM	WCDCKLPNSK	2191	sp|Q13148|TADBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:4,4-UNIMOD:4,5-UNIMOD:188,10-UNIMOD:188	ms_run[2]:scan=3232	21.222	2	1318.6201	1318.6201	R	Q	172	182
PSM	YKETDLLILFK	2192	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=11272	70.463	2	1393.826	1393.8260	K	D	175	186
PSM	YLAEFATGNDRK	2193	sp|P62258-2|1433E_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4383	27.799	2	1383.6783	1383.6783	R	E	109	121
PSM	YNLIVVGRYPDPNFK	2194	sp|Q92466-2|DDB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9046	55.924	2	1793.9465	1793.9465	R	S	159	174
PSM	YYVTIIDAPGHR	2195	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6620	40.99	2	1403.7197	1403.7197	K	D	85	97
PSM	MKGNVDISAPK	2196	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:35,2-UNIMOD:188,11-UNIMOD:188	ms_run[1]:scan=2001	14.190695000000002	2	1186.637984	1186.641867	K	I	1081	1092
PSM	MKGNVDISAPK	2197	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:35,2-UNIMOD:188,11-UNIMOD:188	ms_run[1]:scan=2011	14.248436666666667	2	1186.637984	1186.641867	K	I	1081	1092
PSM	ISMPDIDLNLKGPK	2198	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:35,11-UNIMOD:188,14-UNIMOD:188	ms_run[1]:scan=6992	43.273134999999996	2	1567.863212	1567.868238	K	V	2707	2721
PSM	QSVENDIHGLRK	2199	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:28,11-UNIMOD:267	ms_run[1]:scan=4831	30.432213333333337	2	1387.7097	1387.7078	R	V	176	188
PSM	DTGIFLDLMHLK	2200	sp|P12956|XRCC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	12-UNIMOD:188	ms_run[1]:scan=12530	79.02293333333334	2	1407.750583	1407.752752	R	K	195	207
PSM	RVTYVVLDEADR	2201	sp|Q7L014|DDX46_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=5718	35.67428333333333	2	1434.752966	1434.746693	R	M	522	534
PSM	YYVTIIDAPGHR	2202	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	12-UNIMOD:267	ms_run[1]:scan=6606	40.910713333333334	2	1414.730198	1413.728019	K	D	85	97
PSM	MMANGILKVPAINVNDSVTK	2203	sp|P23526|SAHH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=9372	58.06335333333333	2	2114.121743	2114.122782	K	S	167	187
PSM	MMANGILKVPAINVNDSVTK	2204	sp|P23526|SAHH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:35,8-UNIMOD:188,20-UNIMOD:188	ms_run[1]:scan=8695	53.71821333333333	3	2142.159216	2142.157955	K	S	167	187
PSM	RDLEGSDIDTR	2205	sp|P55060|XPO2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:267,11-UNIMOD:267	ms_run[1]:scan=2409	16.50325666666667	2	1295.615529	1295.622046	R	R	372	383
PSM	QLFHPEQLITGKEDAANNYAR	2206	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:28	ms_run[1]:scan=9681	60.04154333333334	3	2397.1726	2397.1708	R	G	85	106
PSM	SFLLKDSETSQR	2207	sp|P34897|GLYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=4364	27.700376666666667	2	1409.713058	1409.715058	K	L	470	482
PSM	QQHVIETLIGKK	2208	sp|P48643|TCPE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:28	ms_run[1]:scan=7866	48.59278833333334	3	1375.7819	1375.7818	K	Q	503	515
PSM	TPCGEGSKTWDR	2209	sp|P60866|RS20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:4,8-UNIMOD:188,12-UNIMOD:267	ms_run[1]:scan=1887	13.536673333333333	2	1408.640877	1408.637611	K	F	68	80
PSM	AALNTVHEANGTEDERAVSK	2210	sp|P0CW19|LIMS3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	16-UNIMOD:267,20-UNIMOD:188	ms_run[1]:scan=2951	19.60217	3	2128.038936	2127.052722	R	L	21	41
PSM	CQHAAEIITDLLR	2211	sp|Q96AE4|FUBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=12824	81.43364666666666	2	1521.7583	1521.7604	R	S	332	345
PSM	YGDFRADDADEFGYSR	2212	sp|Q7KZF4|SND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=6780	41.93761666666667	3	1882.776027	1882.775821	R	-	895	911
PSM	NRPSSGSLIQVVTTEGR	2213	sp|P09417|DHPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	2-UNIMOD:267,17-UNIMOD:267	ms_run[1]:scan=7166	44.314135	3	1819.970198	1819.965513	K	T	220	237
PSM	CRHLQIEIEGLIDQMIDK	2214	sp|O60610|DIAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:385,1-UNIMOD:4,15-UNIMOD:35	ms_run[1]:scan=8738	53.987725	2	2210.0952	2209.0862	K	T	454	472
PSM	MWDLSSNQAIQIAQHDAPVK	2215	sp|P78406|RAE1L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	20-UNIMOD:188	ms_run[1]:scan=9182	56.85318833333333	3	2257.114929	2257.125681	K	T	112	132
PSM	NSTFAEEFAHSIR	2216	sp|Q2M389|WASC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=8295	51.225365000000004	2	1507.704423	1507.705556	K	S	281	294
PSM	TFHTSSAAIGNQLYVFGGGER	2217	sp|Q7Z6M1|RABEK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=8879	54.882690000000004	3	2212.078606	2211.070881	R	G	140	161
PSM	NILFVITKPDVYK	2218	sp|E9PAV3|NACAM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=9654	59.87937666666667	2	1548.892884	1548.891566	K	S	1964	1977
PSM	HLAEQFAVGEIITDMAK	2219	sp|Q99986|VRK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	17-UNIMOD:188	ms_run[1]:scan=11633	72.90212	3	1878.972865	1877.965264	R	K	18	35
PSM	KYAVLYQPLFDK	2220	sp|P55209|NP1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=8578	52.98585500000001	2	1483.798926	1483.807502	R	R	105	117
PSM	QDFVQHFSQIVR	2221	sp|P14324|FPPS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:28,12-UNIMOD:267	ms_run[1]:scan=10517	65.45163666666667	2	1495.7459	1495.7442	K	V	81	93
PSM	VRVTELEDEVR	2222	sp|Q9BV38|WDR18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=5550	34.68040166666667	2	1344.715476	1343.704494	R	N	400	411
PSM	CFSEENHEPLR	2223	sp|Q96QK1|VPS35_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=6339	39.323143333333334	2	1399.5819	1399.5821	K	T	640	651
PSM	QGDTGDWIGTFLGHK	2224	sp|Q9Y3F4|STRAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:28,15-UNIMOD:188	ms_run[1]:scan=12286	77.31197333333333	2	1619.7646	1619.7670	R	G	45	60
PSM	VGAHAGEYGAEALER	2225	sp|P69905|HBA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=4507	28.548405	2	1528.726797	1528.727020	K	M	18	33
PSM	CQNILQGNFKPDFYLK	2226	sp|Q49A26|GLYR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=11765	73.78730166666668	2	1966.9576	1966.9606	K	Y	486	502
PSM	VLVDHFGYTK	2227	sp|P04114|APOB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=5287	33.137725	2	1177.612867	1177.613159	K	D	733	743
PSM	RAYDIAGSTK	2228	sp|P11388|TOP2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:267,10-UNIMOD:188	ms_run[1]:scan=1730	12.651296666666665	2	1096.585199	1096.584771	R	D	242	252
PSM	VDAANRLGDPLEAFPVFK	2229	sp|Q86UY6|NAA40_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=11677	73.200075	3	1959.025806	1958.026162	K	K	29	47
PSM	TLHGQETYTPR	2230	sp|Q9BUK6|MSTO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1749	12.758833333333333	2	1301.642697	1301.636414	R	L	56	67
PSM	NHLLESEDSYTR	2231	sp|Q15643|TRIPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	12-UNIMOD:267	ms_run[1]:scan=3835	24.691721666666666	2	1472.682096	1472.677105	R	E	1586	1598
PSM	DREGFFTNGLTLGAK	2232	sp|P35080|PROF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=9235	57.196775	2	1625.804624	1624.820920	K	K	55	70
PSM	SMVEVLADHPGELVR	2233	sp|Q01196|RUNX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=8356	51.60657333333334	2	1650.837394	1650.839941	R	T	50	65
PSM	VIPELNGKLTGMAFR	2234	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	8-UNIMOD:188,15-UNIMOD:267	ms_run[1]:scan=9494	58.841875	3	1661.918135	1660.930546	K	V	220	235
PSM	MDELQLFRGDTVLLK	2235	sp|P55072|TERA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:35	ms_run[1]:scan=10451	65.02230166666668	2	1792.942616	1792.939321	K	G	46	61
PSM	ALNDKFASLIGK	2236	sp|Q6KB66|K2C80_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	5-UNIMOD:188,12-UNIMOD:188	ms_run[1]:scan=8002	49.43951666666667	2	1287.760235	1287.758945	K	V	89	101
PSM	RVYATILNAGTNTDGFK	2237	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:267,17-UNIMOD:188	ms_run[1]:scan=7199	44.508988333333335	2	1857.949521	1855.976310	R	E	241	258
PSM	TIDLSNNKIESLPPLLIGK	2238	sp|Q8N9N7|LRC57_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=11045	68.95688	2	2064.177460	2064.183057	R	F	42	61
PSM	AAHVFFTDSCPDALFNELVK	2239	sp|P61764|STXB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:4,20-UNIMOD:188	ms_run[2]:scan=12406	78.134	2	2286.1086	2286.1086	R	S	101	121
PSM	AEGFVDALHR	2240	sp|Q96I24|FUBP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=5440	34.04	2	1113.5567	1113.5567	K	V	16	26
PSM	AFTGREFDELNPSAQR	2241	sp|P16615-5|AT2A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	5-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=6917	42.817	3	1856.892	1856.8920	K	D	651	667
PSM	AFVRPSGTEDVVR	2242	sp|O95394|AGM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=4305	27.368	2	1431.747	1431.7470	R	V	493	506
PSM	AGAAERELPLYR	2243	sp|P09104-2|ENOG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	6-UNIMOD:267,12-UNIMOD:267	ms_run[2]:scan=5167	32.44	2	1364.7315	1364.7315	K	H	78	90
PSM	AGAGLSSLCLVLSTRPHS	2244	sp|O95865|DDAH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=9849	61.136	3	1834.9599	1834.9599	K	-	268	286
PSM	AGHCAVAINTR	2245	sp|P51610-2|HCFC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	4-UNIMOD:4	ms_run[2]:scan=1646	12.165	2	1168.5771	1168.5771	R	L	323	334
PSM	AIYHDLEQSIR	2246	sp|Q9UNF0-2|PACN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=5973	37.163	2	1343.6834	1343.6834	K	A	265	276
PSM	ALPFWNEEIVPQIKEGK	2247	sp|Q8N0Y7|PGAM4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11130	69.515	2	1997.0622	1997.0622	R	R	163	180
PSM	ALWEEEEERLR	2248	sp|Q6ZMZ3-3|SYNE3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:267,11-UNIMOD:267	ms_run[2]:scan=7232	44.717	2	1478.7268	1478.7268	R	G	314	325
PSM	ALYEHLTAK	2249	sp|P42704|LPPRC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:188	ms_run[2]:scan=3665	23.701	2	1050.5805	1050.5805	K	N	1339	1348
PSM	ANIVHLMLSSPEQIQK	2250	sp|P55060-4|XPO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	16-UNIMOD:188	ms_run[2]:scan=8916	55.119	3	1812.9863	1812.9863	K	Q	94	110
PSM	ARQEELYSELQAR	2251	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=5649	35.264	3	1591.7954	1591.7954	R	E	3187	3200
PSM	ASKPLPPAPAPDEYLVSPITGEK	2252	sp|Q15459-2|SF3A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	3-UNIMOD:188,23-UNIMOD:188	ms_run[2]:scan=8571	52.941	3	2388.2979	2388.2979	K	I	332	355
PSM	ASVITQVFHVPLEER	2253	sp|Q00341-2|VIGLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	15-UNIMOD:267	ms_run[2]:scan=10208	63.462	3	1733.934	1733.9340	K	K	109	124
PSM	AVGPEITKTDLVPAFQNLMK	2254	sp|P30153|2AAA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	8-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=11497	71.984	3	2183.2063	2183.2063	K	D	273	293
PSM	AVLALHQDLFSLAQQCIDK	2255	sp|P42345|MTOR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	16-UNIMOD:4	ms_run[2]:scan=11321	70.795	3	2169.1252	2169.1252	R	A	1548	1567
PSM	AVLHPTGPLYCPEEK	2256	sp|Q8IXI2-6|MIRO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:4	ms_run[2]:scan=5691	35.51	3	1709.8447	1709.8447	K	E	165	180
PSM	CASLQKFGER	2257	sp|P02768|ALBU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:4	ms_run[2]:scan=2855	19.037	2	1194.5815	1194.5815	K	A	224	234
PSM	CGESGHLAR	2258	sp|P62633-7|CNBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:4,9-UNIMOD:267	ms_run[2]:scan=657	6.923	2	995.44823	995.4482	R	E	144	153
PSM	CPYKDTLGPMQK	2259	sp|O75821|EIF3G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:4,4-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=3826	24.638	2	1448.7195	1448.7195	R	E	169	181
PSM	CPYKDTLGPMQK	2260	sp|O75821|EIF3G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:4	ms_run[2]:scan=3830	24.66	2	1436.6792	1436.6792	R	E	169	181
PSM	CQHAAEIITDLLR	2261	sp|Q96AE4|FUBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=10224	63.566	3	1548.7958	1548.7958	R	S	332	345
PSM	CSSILLHGK	2262	sp|P05023-2|AT1A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:4,9-UNIMOD:188	ms_run[2]:scan=2772	18.56	2	1019.5529	1019.5529	R	E	518	527
PSM	DLKEILTLK	2263	sp|Q9UKG1|DP13A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	3-UNIMOD:188,9-UNIMOD:188	ms_run[2]:scan=9017	55.738	2	1083.6942	1083.6942	R	E	122	131
PSM	DPPDPYVSLLLLPDKNR	2264	sp|Q9BSJ8|ESYT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11402	71.346	2	1951.0415	1951.0415	R	G	1004	1021
PSM	EAILEYILHQK	2265	sp|Q9Y314|NOSIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:188	ms_run[2]:scan=11075	69.151	2	1361.765	1361.7650	R	K	68	79
PSM	ECREPELGLEELLR	2266	sp|Q9NZL4-2|HPBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	2-UNIMOD:4	ms_run[2]:scan=10559	65.729	3	1741.8669	1741.8669	R	H	206	220
PSM	EHGAVAVER	2267	sp|Q9UNZ2-6|NSF1C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:267	ms_run[2]:scan=879	8.1017	2	976.49656	976.4966	K	V	17	26
PSM	EIRPALELLEPIEQK	2268	sp|P50395-2|GDIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	3-UNIMOD:267,15-UNIMOD:188	ms_run[2]:scan=10215	63.508	3	1793.0269	1789.0388	K	F	320	335
PSM	ELLNPVVEFVSHPSTTCR	2269	sp|P78527-2|PRKDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	17-UNIMOD:4	ms_run[2]:scan=10640	66.256	2	2084.0361	2084.0361	R	E	2453	2471
PSM	EPPGLIFNKVEVSEDEPASK	2270	sp|O75683|SURF6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=7986	49.336	3	2196.1353	2196.1353	R	A	194	214
PSM	EQQAQVEKEDFSDMVAEHAAK	2271	sp|Q13435|SF3B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6330	39.269	3	2389.0856	2389.0856	R	Q	850	871
PSM	FDQKQELGR	2272	sp|P43243|MATR3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=1763	12.836	2	1119.5673	1119.5673	K	V	488	497
PSM	FGMNDKIVIEK	2273	sp|Q96CW1-2|AP2M1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	6-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=6154	38.226	2	1304.7201	1304.7201	K	Q	212	223
PSM	FHMVDGNVSGEFTDLVPEK	2274	sp|O95433|AHSA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	19-UNIMOD:188	ms_run[2]:scan=9780	60.689	3	2126.0086	2126.0086	K	H	250	269
PSM	FKAADLNGDLTATR	2275	sp|Q15293-2|RCN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	2-UNIMOD:188,14-UNIMOD:267	ms_run[2]:scan=5901	36.744	2	1507.7966	1503.8084	R	E	124	138
PSM	FKGTESISK	2276	sp|Q00688|FKBP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	2-UNIMOD:188,9-UNIMOD:188	ms_run[2]:scan=1318	10.357	2	1007.569	1007.5690	R	V	72	81
PSM	FLGPEDSHVVVASNSPCLK	2277	sp|Q12788|TBL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	17-UNIMOD:4,19-UNIMOD:188	ms_run[2]:scan=6919	42.829	3	2061.0297	2061.0297	R	V	342	361
PSM	FLGTEPEPDAVGLDSGHIR	2278	sp|Q16762|THTR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	19-UNIMOD:267	ms_run[2]:scan=7576	46.779	3	2018.9937	2018.9937	R	G	188	207
PSM	FLSDPQVHTVLVER	2279	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=7094	43.869	3	1638.873	1638.8730	K	S	68	82
PSM	FLVPLEQSPVLEQSTLQHNNQTR	2280	sp|Q9UBZ4|APEX2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9853	61.164	3	2677.3824	2677.3824	R	V	342	365
PSM	FQKSELEFK	2281	sp|Q9NR45|SIAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=4679	29.558	2	1154.5972	1154.5972	K	F	53	62
PSM	FQLKGEYDASK	2282	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=4045	25.897	2	1284.635	1284.6350	K	K	218	229
PSM	GAGGQGKLDVTILSPSR	2283	sp|O75369-6|FLNB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	7-UNIMOD:188,17-UNIMOD:267	ms_run[2]:scan=6528	40.441	2	1670.9286	1666.9405	R	K	970	987
PSM	GAPPSSNIEDFHGLLPK	2284	sp|P43243|MATR3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8474	52.328	2	1777.8999	1777.8999	R	G	271	288
PSM	GHLDNISNNLLIGAINIENGK	2285	sp|Q99798|ACON_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11179	69.839	3	2218.1706	2218.1706	R	A	608	629
PSM	GIPAPEEERTR	2286	sp|O95433|AHSA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=2312	15.939	2	1253.6364	1253.6364	R	Q	306	317
PSM	GISASSPLQTSLVRPAGLADFGPSSASSPLSSPLSK	2287	sp|Q9ULG1|INO80_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11309	70.716	3	3468.81	3468.8100	K	G	1485	1521
PSM	GIVFEDVKVPK	2288	sp|P11310|ACADM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=7211	44.588	2	1229.702	1229.7020	R	E	249	260
PSM	GIYAYGFEKPSAIQQR	2289	sp|P38919|IF4A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6923	42.857	3	1826.9315	1826.9315	R	A	52	68
PSM	GLEPLKNNNYR	2290	sp|P48506|GSH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=3439	22.401	2	1316.6837	1316.6837	R	I	313	324
PSM	GLGTDEDSLIEIICSR	2291	sp|P07355-2|ANXA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	14-UNIMOD:4	ms_run[2]:scan=12078	75.911	2	1776.8564	1776.8564	K	T	138	154
PSM	GLVYETSVLDPDEGIRFR	2292	sp|O75390|CISY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	16-UNIMOD:267,18-UNIMOD:267	ms_run[2]:scan=9884	61.36	2	2085.0646	2085.0646	K	G	77	95
PSM	GMDKLIVDGR	2293	sp|Q99832|TCPH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=4767	30.052	2	1102.5805	1102.5805	R	G	44	54
PSM	GNHECASINR	2294	sp|P62136|PP1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	5-UNIMOD:4	ms_run[2]:scan=736	7.3542	2	1156.5044	1156.5044	R	I	123	133
PSM	GQTHTLEDFQR	2295	sp|Q99714-2|HCD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:267	ms_run[2]:scan=3741	24.129	2	1340.6348	1340.6348	K	V	106	117
PSM	GQVCVMIHSGSR	2296	sp|Q9Y3I0|RTCB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	4-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=3415	22.26	2	1339.6364	1339.6364	K	G	252	264
PSM	GTITDAPGFDPLRDAEVLR	2297	sp|P50995-2|ANX11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=10350	64.374	2	2042.0433	2042.0433	R	K	159	178
PSM	GWIPGNEENKQK	2298	sp|Q9NZM1-2|MYOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=3647	23.602	2	1398.6892	1398.6892	K	T	1777	1789
PSM	GYFEYIEENKYSR	2299	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=7475	46.178	3	1696.7733	1696.7733	R	A	237	250
PSM	HEQISDLER	2300	sp|P29144|TPP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:267	ms_run[2]:scan=2917	19.399	2	1135.5497	1135.5497	R	L	894	903
PSM	HGLEVIYMIEPIDEYCVQQLK	2301	sp|P07900-2|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	16-UNIMOD:4,21-UNIMOD:188	ms_run[2]:scan=12237	76.981	3	2582.2856	2582.2856	K	E	636	657
PSM	HGVESTLER	2302	sp|Q04637-6|IF4G1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:267	ms_run[2]:scan=1528	11.51	2	1036.5177	1036.5177	R	S	1085	1094
PSM	HGYAPSDLPVK	2303	sp|Q9Y5Q8-2|TF3C5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=4244	27.042	2	1182.6033	1182.6033	K	A	319	330
PSM	HLEVISGQK	2304	sp|Q8TCG1|CIP2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:188	ms_run[2]:scan=2211	15.378	2	1015.5758	1015.5758	R	L	32	41
PSM	HLSDSINQK	2305	sp|Q9Y4W6|AFG32_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:188	ms_run[2]:scan=1200	9.7564	2	1046.5452	1046.5452	R	H	535	544
PSM	HMSEFMECNLNELVK	2306	sp|P25786|PSA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	8-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=9326	57.772	3	1885.8468	1885.8468	R	H	175	190
PSM	HNDMADLER	2307	sp|O15269|SPTC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:267	ms_run[2]:scan=2830	18.896	2	1109.4799	1109.4799	K	L	211	220
PSM	HSEGLREVPDDE	2308	sp|Q6P9B6|MEAK7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	6-UNIMOD:267	ms_run[2]:scan=2863	19.084	2	1391.6193	1391.6193	R	-	445	457
PSM	HSEIQQLER	2309	sp|Q12846|STX4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:267	ms_run[2]:scan=2809	18.777	2	1148.5814	1148.5814	R	S	207	216
PSM	HSVPLPTELSSEAK	2310	sp|Q6UXV4|MIC27_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	14-UNIMOD:188	ms_run[2]:scan=5625	35.119	2	1499.7927	1499.7927	K	T	219	233
PSM	IAAQEVPIEIKPVNPSPLSQLQR	2311	sp|O14734|ACOT8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9532	59.078	3	2526.417	2526.4170	R	M	178	201
PSM	IANDNSLNHEYLPILGLAEFR	2312	sp|P17174-2|AATC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=12849	81.618	3	2398.2281	2398.2281	K	S	40	61
PSM	IFHELTQTDK	2313	sp|P11586|C1TC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:188	ms_run[2]:scan=3511	22.822	2	1236.6446	1236.6446	R	A	464	474
PSM	IGITNHDEYSLVR	2314	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	13-UNIMOD:267	ms_run[2]:scan=6155	38.231	3	1525.7764	1525.7764	R	E	119	132
PSM	IGNSYFKEEK	2315	sp|P31948-2|STIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=3353	21.907	2	1213.5979	1213.5979	R	Y	353	363
PSM	IGYLNDRVDELLEK	2316	sp|Q9H0P0-3|5NT3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9340	57.863	3	1675.8781	1675.8781	K	Y	246	260
PSM	IIVDELKQEVISTSSK	2317	sp|P63244|RACK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8343	51.531	3	1787.988	1787.9880	K	A	265	281
PSM	IKSVEELLEAELLK	2318	sp|Q86UP2-2|KTN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=12260	77.137	2	1612.9287	1612.9287	K	V	810	824
PSM	ILAAALTECHR	2319	sp|P46060|RAGP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:4	ms_run[2]:scan=4747	29.934	2	1253.655	1253.6550	K	K	161	172
PSM	ILKPTDENLLK	2320	sp|Q9P015|RM15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=5650	35.269	2	1282.7497	1282.7497	K	Y	282	293
PSM	ILQDIASGSHPFSQVLK	2321	sp|P28331-3|NDUS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8433	52.069	3	1838.989	1838.9890	K	E	340	357
PSM	ILQEKLDQPVSAPPSPR	2322	sp|Q16204|CCDC6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=5398	33.803	3	1874.0262	1874.0262	R	D	230	247
PSM	INHEGEVNR	2323	sp|Q16576|RBBP7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=606	6.6537	2	1066.5156	1066.5156	K	A	120	129
PSM	IPGEETDTIQHMR	2324	sp|P50416-2|CPT1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	13-UNIMOD:267	ms_run[2]:scan=4514	28.593	3	1535.7278	1535.7278	R	D	317	330
PSM	IQVQHPAAK	2325	sp|P49368-2|TCPG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=1013	8.7903	2	990.56106	990.5611	K	S	32	41
PSM	KAEAGAGSATEFQFR	2326	sp|P46783|RS10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=5232	32.817	3	1568.7583	1568.7583	K	G	139	154
PSM	KCEAEEAEPPAATQPQTSETQTSHLPESER	2327	sp|Q9UKV3-5|ACINU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	2-UNIMOD:4	ms_run[2]:scan=4121	26.331	4	3337.5005	3337.5005	K	I	732	762
PSM	KDPELWGSVLLESNPYR	2328	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11044	68.951	3	2002.016	2002.0160	R	R	951	968
PSM	KFGYVDFESAEDLEK	2329	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8652	53.448	3	1775.8254	1775.8254	R	A	348	363
PSM	KFLDGNEMTLADCNLLPK	2330	sp|Q9Y696|CLIC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	13-UNIMOD:4	ms_run[2]:scan=10018	62.229	3	2078.0176	2078.0176	R	L	177	195
PSM	KIPCDVTEAEIISLGLPFGK	2331	sp|O95758-1|PTBP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	4-UNIMOD:4	ms_run[2]:scan=12262	77.149	2	2186.1657	2186.1657	R	V	34	54
PSM	KLAYVAAGDLAPINAFIGGLAAQEVMK	2332	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	26-UNIMOD:35	ms_run[2]:scan=13265	85.609	3	2746.4728	2746.4728	R	A	345	372
PSM	KLETAVNLAWTAGNSNTR	2333	sp|P21796|VDAC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=7413	45.815	3	1945.0017	1945.0017	K	F	201	219
PSM	KLLEGEESR	2334	sp|P05787|K2C8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=1418	10.875	2	1059.556	1059.5560	R	L	393	402
PSM	KLLMMAGIDDCYTSAR	2335	sp|P15880|RS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:188,11-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=8223	50.781	2	1859.8915	1855.9033	K	G	212	228
PSM	KLQEVDSLWK	2336	sp|Q9Y2X3|NOP58_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:188,10-UNIMOD:188	ms_run[2]:scan=6704	41.481	2	1256.7167	1256.7167	K	E	21	31
PSM	KPLLESGTLGTK	2337	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=4295	27.316	3	1254.7586	1254.7586	R	G	553	565
PSM	KSGVGNVFIK	2338	sp|Q13310-2|PABP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=4114	26.291	2	1047.6077	1047.6077	R	N	95	105
PSM	KSLESINSR	2339	sp|P62888|RL30_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=1351	10.522	2	1032.5564	1032.5564	K	L	9	18
PSM	KVPGVTAIELGEETCTFR	2340	sp|P51116|FXR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	15-UNIMOD:4	ms_run[2]:scan=8606	53.165	3	2006.0143	2006.0143	R	I	256	274
PSM	KYLLGVQPAWGSAEAVDIDR	2341	sp|Q10713|MPPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:188,20-UNIMOD:267	ms_run[2]:scan=9797	60.801	2	2203.1608	2199.1727	R	S	269	289
PSM	LCSDLMNCLHER	2342	sp|Q9UNF0-2|PACN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	2-UNIMOD:4,8-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=6666	41.258	2	1556.6773	1556.6773	R	A	37	49
PSM	LGNDFHTNK	2343	sp|P08708|RS17_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:188	ms_run[2]:scan=1324	10.387	2	1050.519	1050.5190	R	R	24	33
PSM	LHDNLIISDLENTVK	2344	sp|Q69YQ0-2|CYTSA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	15-UNIMOD:188	ms_run[2]:scan=10374	64.528	3	1728.9353	1728.9353	K	K	705	720
PSM	LIDHLENTK	2345	sp|Q9H0S4-2|DDX47_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:188	ms_run[2]:scan=2790	18.664	2	1087.5969	1087.5969	R	G	153	162
PSM	LIDHLENTK	2346	sp|Q9H0S4-2|DDX47_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=2789	18.659	2	1081.5768	1081.5768	R	G	153	162
PSM	LIGNSLGKPLEK	2347	sp|Q15042|RB3GP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=4825	30.395	2	1267.75	1267.7500	K	G	39	51
PSM	LKQEQGVESEPLFPILK	2348	sp|Q8WUQ7|CATIN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9921	61.601	2	1954.0775	1954.0775	K	Q	468	485
PSM	LLEDFGDGGAFPEIHVAQYPLDMGR	2349	sp|Q13573|SNW1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	23-UNIMOD:35	ms_run[2]:scan=11481	71.874	3	2762.301	2762.3010	R	K	54	79
PSM	LLGQFTLIGIPPAPR	2350	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	15-UNIMOD:267	ms_run[2]:scan=12018	75.51	2	1601.9533	1601.9533	K	G	499	514
PSM	LLQEHNNALK	2351	sp|Q96CV9-3|OPTN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=2192	15.268	2	1178.6408	1178.6408	K	T	339	349
PSM	LSAEAEKVLALPEPSPAAPTLR	2352	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	7-UNIMOD:188,22-UNIMOD:267	ms_run[2]:scan=8986	55.536	2	2275.2758	2271.2877	R	S	1011	1033
PSM	LSAEERDQLLPNLR	2353	sp|P61457|PHS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=7215	44.611	2	1652.8846	1652.8846	R	A	8	22
PSM	LSFQHDPETSVLVLR	2354	sp|Q14697|GANAB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	15-UNIMOD:267	ms_run[2]:scan=8693	53.706	2	1749.9289	1749.9289	R	K	915	930
PSM	LTEPQHGLGSQR	2355	sp|Q13586-2|STIM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=2119	14.859	2	1321.6739	1321.6739	R	G	503	515
PSM	LTFCHQGLSNVLDDPK	2356	sp|Q86TI2-4|DPP9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	4-UNIMOD:4	ms_run[2]:scan=7888	48.724	3	1842.8934	1842.8934	R	S	222	238
PSM	LVARPEPATGYTLEFR	2357	sp|Q16658|FSCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	4-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=7466	46.13	3	1838.9794	1838.9794	R	S	202	218
PSM	LVDQSGPPHEPK	2358	sp|P55265-5|DSRAD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=1587	11.834	2	1302.6568	1302.6568	K	F	451	463
PSM	LYDLNHNEIGELIR	2359	sp|O75643|U520_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	14-UNIMOD:267	ms_run[2]:scan=9286	57.518	3	1707.882	1707.8820	R	M	1153	1167
PSM	LYGAQFHPEVGLTENGK	2360	sp|P49915-2|GUAA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	17-UNIMOD:188	ms_run[2]:scan=7051	43.613	3	1864.9415	1864.9415	K	V	85	102
PSM	LYNKDAVIEFLLDK	2361	sp|Q9BY42|RTF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11776	73.867	3	1679.9134	1679.9134	R	S	56	70
PSM	MFVGGLSWDTSKK	2362	sp|Q99729-3|ROAA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:35	ms_run[2]:scan=6898	42.697	2	1470.7177	1470.7177	K	D	72	85
PSM	MIAPEGSLVFHEK	2363	sp|P48739|PIPNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:35	ms_run[2]:scan=6087	37.841	2	1472.7334	1472.7334	R	A	74	87
PSM	MQAQMQMQMQGGDGDGGALGHHV	2364	sp|Q15019|SEPT2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:35	ms_run[2]:scan=5699	35.558	3	2398.9875	2398.9875	R	-	339	362
PSM	MVRPNQDGTLIASCSNDQTVR	2365	sp|P43034|LIS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	14-UNIMOD:4	ms_run[2]:scan=5031	31.636	3	2361.1165	2361.1165	R	V	239	260
PSM	NADSGVHLNR	2366	sp|Q6PJT7-10|ZC3HE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:267	ms_run[2]:scan=1342	10.479	2	1091.5347	1091.5347	R	L	185	195
PSM	NKLAELEEALQK	2367	sp|P13647|K2C5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	2-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=8199	50.65	3	1396.7965	1396.7965	R	A	430	442
PSM	NLDLDSIIAEVK	2368	sp|P13647|K2C5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	12-UNIMOD:188	ms_run[2]:scan=12041	75.666	2	1334.7389	1334.7389	R	A	332	344
PSM	NLHVIDLDDATFLSAK	2369	sp|Q8N8R7|AL14E_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=10478	65.201	3	1770.9152	1770.9152	K	F	89	105
PSM	NNICSQPDLHAIGLSIIPAR	2370	sp|Q01831-2|XPC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	4-UNIMOD:4,20-UNIMOD:267	ms_run[2]:scan=10095	62.732	3	2198.1505	2198.1505	R	F	184	204
PSM	NNTVGLIQLNRPK	2371	sp|P30084|ECHM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=5861	36.499	2	1465.8365	1465.8365	K	A	44	57
PSM	NQALKEAGVFVPR	2372	sp|P53396|ACLY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	5-UNIMOD:188,13-UNIMOD:267	ms_run[2]:scan=6169	38.306	2	1443.8169	1439.8288	K	S	776	789
PSM	NRAEQWNVNYVETSAK	2373	sp|P11233|RALA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	2-UNIMOD:267,16-UNIMOD:188	ms_run[2]:scan=6001	37.331	2	1923.941	1919.9528	K	T	144	160
PSM	NRPEDYQGGR	2374	sp|Q15084-3|PDIA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=690	7.1112	2	1190.5428	1190.5428	K	T	106	116
PSM	NTWDCGLQILKK	2375	sp|P53007|TXTP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	5-UNIMOD:4	ms_run[2]:scan=8204	50.673	2	1474.7602	1474.7602	R	E	258	270
PSM	QFNYTHICAGASAFGK	2376	sp|P13804-2|ETFA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	8-UNIMOD:4	ms_run[2]:scan=7169	44.331	3	1770.8148	1770.8148	K	N	53	69
PSM	QGCPFQPWDGLEEHSQALSGR	2377	sp|Q9UH17-3|ABC3B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	3-UNIMOD:4,21-UNIMOD:267	ms_run[2]:scan=9414	58.334	3	2408.0843	2408.0843	R	L	327	348
PSM	QLKLDPSIFESLQK	2378	sp|Q9Y265-2|RUVB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	3-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=10399	64.687	2	1656.9489	1656.9489	K	E	169	183
PSM	QQHVIETLIGK	2379	sp|P48643-2|TCPE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=5922	36.864	2	1264.7139	1264.7139	K	K	410	421
PSM	RAGDLLEDSPK	2380	sp|P51858-2|HDGF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=3628	23.492	2	1199.6146	1199.6146	R	R	150	161
PSM	REEQIVQLLNSVQAK	2381	sp|Q9H2U1|DHX36_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9407	58.289	3	1753.9686	1753.9686	R	N	91	106
PSM	RGDTVATLSER	2382	sp|P22102|PUR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=2601	17.593	2	1203.6208	1203.6208	K	V	965	976
PSM	RQQEQQVPILEK	2383	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=4136	26.419	2	1494.8154	1494.8154	R	F	1105	1117
PSM	RTDEAAFQK	2384	sp|P26447|S10A4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=1129	9.3851	2	1064.5251	1064.5251	K	L	49	58
PSM	RTDIFGVEETAIGK	2385	sp|Q15459-2|SF3A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=7958	49.167	3	1534.7991	1534.7991	R	K	408	422
PSM	RTQGVSTTDLVGR	2386	sp|Q99447-2|PCY2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=3632	23.512	2	1388.7372	1388.7372	K	M	62	75
PSM	RTTDFSDFLSIVGCTK	2387	sp|Q9UHD1|CHRD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:267,14-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=11563	72.436	2	1861.9215	1857.9334	R	G	46	62
PSM	RVDGLAFVNEDIVASK	2388	sp|Q9UFC0|LRWD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8554	52.835	3	1731.9155	1731.9155	R	G	499	515
PSM	RYELPAPSSGQK	2389	sp|O75934|SPF27_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=3406	22.208	2	1331.6834	1331.6834	K	N	86	98
PSM	SCLLHQFTEK	2390	sp|P61106|RAB14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	2-UNIMOD:4	ms_run[2]:scan=5503	34.402	2	1261.6125	1261.6125	K	K	25	35
PSM	SDLLLSGRDWNTLIVGK	2391	sp|O14744-2|ANM5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11067	69.098	2	1886.0262	1886.0262	R	L	52	69
PSM	SELKELLTR	2392	sp|P26447|S10A4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=5955	37.058	2	1087.6237	1087.6237	K	E	32	41
PSM	SESTGTPGHLR	2393	sp|Q8N573-3|OXR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:267	ms_run[2]:scan=991	8.6711	2	1150.5606	1150.5606	K	S	318	329
PSM	SHAELETALR	2394	sp|P35052|GPC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:267	ms_run[2]:scan=3456	22.504	2	1135.5861	1135.5861	R	D	81	91
PSM	SHIGVVPQDTVLFNDTIADNIR	2395	sp|Q9NP58-4|ABCB6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	22-UNIMOD:267	ms_run[2]:scan=10762	67.076	3	2433.2528	2433.2528	R	Y	618	640
PSM	SIVDKEGVPR	2396	sp|Q99613-2|EIF3C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=2769	18.54	2	1098.6033	1098.6033	K	F	95	105
PSM	SKESVPEFPLSPPK	2397	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	2-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=7084	43.81	2	1552.854	1552.8540	R	K	28	42
PSM	SKFYGNSLSAILEGEAR	2398	sp|Q9BZF1-3|OSBL8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	2-UNIMOD:188,17-UNIMOD:267	ms_run[2]:scan=9639	59.784	2	1856.9603	1852.9722	K	L	498	515
PSM	SKGIAYIEFK	2399	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6423	39.81	2	1154.6336	1154.6336	K	T	428	438
PSM	SKLTFSCLGGSDNFK	2400	sp|Q15185-3|TEBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	2-UNIMOD:188,7-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=7219	44.64	3	1671.8329	1671.8329	K	H	34	49
PSM	SLVEIIEHGLVDEQQK	2401	sp|O75533|SF3B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11830	74.234	3	1835.9629	1835.9629	R	V	685	701
PSM	SNMGHPEPASGLAALAK	2402	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	17-UNIMOD:188	ms_run[2]:scan=6067	37.729	3	1655.8397	1655.8397	K	V	327	344
PSM	SQLDIIIHSLK	2403	sp|P13010|XRCC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9730	60.357	2	1265.7343	1265.7343	K	K	145	156
PSM	SRDLLVQQASQCLSK	2404	sp|Q1KMD3|HNRL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	12-UNIMOD:4	ms_run[2]:scan=6270	38.926	3	1731.8938	1731.8938	K	L	507	522
PSM	SRPELLEYYIK	2405	sp|Q14258|TRI25_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8373	51.71	2	1409.7555	1409.7555	K	V	448	459
PSM	SVLLLAYKPMEGNFEEIAR	2406	sp|Q16531|DDB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11190	69.91	3	2179.1347	2179.1347	R	D	929	948
PSM	SVNIKEICWNLQNIR	2407	sp|Q9BXP5-5|SRRT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	8-UNIMOD:4	ms_run[2]:scan=10082	62.642	3	1885.9833	1885.9833	R	L	435	450
PSM	TAADELEAFLGGGAPGGRHPGGGDYEEL	2408	sp|Q3YEC7|RABL6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=12147	76.392	3	2742.2522	2742.2522	R	-	702	730
PSM	TFHTSSAAIGNQLYVFGGGER	2409	sp|Q7Z6M1-2|RABEK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	21-UNIMOD:267	ms_run[2]:scan=8877	54.87	3	2221.0791	2221.0791	R	G	89	110
PSM	THEAQIQEMR	2410	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=2079	14.63	2	1241.5823	1241.5823	K	Q	1182	1192
PSM	TINKAWVESR	2411	sp|Q9HB71-3|CYBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=3692	23.854	2	1202.6408	1202.6408	R	E	166	176
PSM	TKDSGLFCVPLTALLEQDQR	2412	sp|Q8N392-2|RHG18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	8-UNIMOD:4	ms_run[2]:scan=12593	79.489	2	2290.1627	2290.1627	K	K	271	291
PSM	TKFETEQALR	2413	sp|P08727|K1C19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=3132	20.634	2	1221.6354	1221.6354	R	M	167	177
PSM	TKTEISEMNR	2414	sp|P05787|K2C8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=1770	12.871	2	1207.5867	1207.5867	R	N	303	313
PSM	TNTAVRPYCFIEFDNFIQR	2415	sp|Q96IW7|SC22A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	6-UNIMOD:267,9-UNIMOD:4,19-UNIMOD:267	ms_run[2]:scan=11737	73.599	3	2410.1643	2410.1643	K	T	103	122
PSM	TPVEPEVAIHR	2416	sp|P60866|RS20_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:267	ms_run[2]:scan=4058	25.974	3	1256.6753	1256.6753	K	I	9	20
PSM	TQGFLALFSGDTGEIKSEVR	2417	sp|Q9Y230-2|RUVB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11656	73.053	2	2154.0957	2154.0957	R	E	209	229
PSM	TRPTTLGSSQFSGSGIDER	2418	sp|Q99081|HTF4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=5195	32.605	2	1994.9657	1994.9657	K	G	36	55
PSM	TRTPASINATPANINLADLTR	2419	sp|Q7KZ85|SPT6H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8812	54.458	3	2209.1815	2209.1815	R	A	1530	1551
PSM	TTAAHGLELR	2420	sp|P08243-3|ASNS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:267	ms_run[2]:scan=3006	19.918	2	1077.5806	1077.5806	R	V	325	335
PSM	TTEPGVTGLLLAVEGPAAKR	2421	sp|Q14690|RRP5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11077	69.163	2	1979.1051	1979.1051	K	T	982	1002
PSM	TTIHEMFLSTLDPK	2422	sp|Q9Y305-3|ACOT9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	14-UNIMOD:188	ms_run[2]:scan=9603	59.546	2	1637.843	1637.8430	R	T	199	213
PSM	TVATPLNQVANPNSAIFGGARPR	2423	sp|Q15056-2|IF4H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	21-UNIMOD:267,23-UNIMOD:267	ms_run[2]:scan=8568	52.923	2	2370.2671	2370.2671	R	E	197	220
PSM	TVSGVNGPLVILDHVK	2424	sp|P21281|VATB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	16-UNIMOD:188	ms_run[2]:scan=9831	61.019	2	1652.9557	1652.9557	K	F	49	65
PSM	VAHALAEGLGVIACIGEK	2425	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	14-UNIMOD:4	ms_run[2]:scan=10370	64.501	3	1806.9662	1806.9662	K	L	151	169
PSM	VDHLTLACTPGSSPTLLR	2426	sp|Q96IR7|HPDL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	8-UNIMOD:4,18-UNIMOD:267	ms_run[2]:scan=7796	48.154	3	1947.0123	1947.0123	R	W	161	179
PSM	VFDGIPPPYDKK	2427	sp|Q6NVV1|R13P3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=5652	35.28	2	1374.7184	1374.7184	K	K	18	30
PSM	VGDQVTHIR	2428	sp|P29350|PTN6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=1941	13.845	2	1023.5461	1023.5461	R	I	45	54
PSM	VGRPSNIGQAQPIIDQLAEEAR	2429	sp|Q9UHX1-4|PUF60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9743	60.443	3	2361.2401	2361.2401	K	A	142	164
PSM	VKAEGPGLSK	2430	sp|O75369-6|FLNB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	2-UNIMOD:188,10-UNIMOD:188	ms_run[2]:scan=1092	9.1969	2	996.60065	996.6007	K	A	848	858
PSM	VKIPEGTILTMDMLTVK	2431	sp|Q9NR45|SIAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11528	72.191	3	1888.0413	1888.0413	K	V	299	316
PSM	VKLAAVDATVNQVLASR	2432	sp|Q15084-3|PDIA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9767	60.602	3	1754.005	1754.0050	K	Y	212	229
PSM	VLPIKPADVEEPAVPQTPR	2433	sp|Q96EV2|RBM33_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=7139	44.146	3	2055.1364	2055.1364	K	V	930	949
PSM	VPDLKDLDPIGK	2434	sp|Q8WUM4|PDC6I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8338	51.499	2	1308.7289	1308.7289	R	A	323	335
PSM	VQELGLSAPLTVLPTITCGHTIEILR	2435	sp|P0DN79|CBSL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	18-UNIMOD:4,26-UNIMOD:267	ms_run[2]:scan=12916	82.16	3	2840.5709	2840.5709	R	E	414	440
PSM	YKMGGDIANR	2436	sp|Q9UQ80|PA2G4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=2744	18.399	2	1123.5444	1123.5444	K	V	21	31
PSM	YMPQNPHIIATK	2437	sp|Q16576|RBBP7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	2-UNIMOD:35,12-UNIMOD:188	ms_run[2]:scan=3569	23.151	2	1433.7432	1433.7432	R	T	131	143
PSM	YMPQNPHIIATK	2438	sp|Q16576|RBBP7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	12-UNIMOD:188	ms_run[2]:scan=4545	28.784	2	1417.7483	1417.7483	R	T	131	143
PSM	YNQLLRIEEELGSK	2439	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9660	59.909	3	1690.889	1690.8890	K	A	407	421
PSM	YTQVGPDHNR	2440	sp|Q08211|DHX9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:267	ms_run[2]:scan=888	8.1453	2	1195.561	1195.5610	K	S	200	210
PSM	QAEEIGEKLHR	2441	sp|Q15149|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28,8-UNIMOD:188,11-UNIMOD:267	ms_run[1]:scan=4819	30.355995	2	1307.6788	1307.6799	K	T	2546	2557
PSM	LEGDLKGPK	2442	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:188,9-UNIMOD:188	ms_run[1]:scan=1557	11.666385	2	967.574185	967.574104	K	V	971	980
PSM	RAEFTVETR	2443	sp|P21333|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:267,9-UNIMOD:267	ms_run[1]:scan=3016	19.972825	2	1127.586972	1127.583810	K	S	301	310
PSM	AHVVPCFDASK	2444	sp|P21333|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:4,11-UNIMOD:188	ms_run[1]:scan=4076	26.074733333333334	2	1235.609941	1235.606422	K	V	1152	1163
PSM	VKYETELAMR	2445	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	2-UNIMOD:188,10-UNIMOD:267	ms_run[1]:scan=4610	29.15871	2	1254.662411	1254.661307	R	Q	166	176
PSM	VKYETELAMR	2446	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=4621	29.217440000000003	2	1238.633473	1238.632909	R	Q	166	176
PSM	QSVENDIHGLRK	2447	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28	ms_run[1]:scan=4908	30.908496666666668	2	1377.6992	1377.6996	R	V	176	188
PSM	QSVENDIHGLRK	2448	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28,11-UNIMOD:267,12-UNIMOD:188	ms_run[1]:scan=5528	34.54592666666667	2	1394.7122	1393.7282	R	V	176	188
PSM	RTVQSLEIDLDSMR	2449	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:267,14-UNIMOD:267	ms_run[1]:scan=8468	52.292773333333336	3	1684.847761	1681.857208	R	N	301	315
PSM	KLLEGEECR	2450	sp|P35908|K22E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:188,8-UNIMOD:4,9-UNIMOD:267	ms_run[1]:scan=1773	12.88997	2	1148.582930	1148.583056	R	M	482	491
PSM	KLLEGEECR	2451	sp|P35908|K22E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:188,8-UNIMOD:4	ms_run[1]:scan=1801	13.044593333333333	2	1138.576212	1138.574787	R	M	482	491
PSM	KLLEGEECR	2452	sp|P35908|K22E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:188,8-UNIMOD:4,9-UNIMOD:267	ms_run[1]:scan=1990	14.126495000000002	2	1148.582930	1148.583056	R	M	482	491
PSM	SVFALTNGIYPHK	2453	sp|Q02878|RL6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=8819	54.498215	2	1446.753531	1445.766700	R	L	273	286
PSM	KLAYVAAGDLAPINAFIGGLAAQEVMK	2454	sp|P22314|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:188,26-UNIMOD:35,27-UNIMOD:188	ms_run[1]:scan=13272	85.66091833333334	3	2758.507107	2758.513032	R	A	385	412
PSM	MFNGEKINYTEGR	2455	sp|P06744|G6PI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:35	ms_run[1]:scan=3970	25.44775333333333	2	1573.717487	1573.719492	R	A	84	97
PSM	SGPASTFNDRVFASELNAGIIK	2456	sp|Q9P2J5|SYLC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	10-UNIMOD:267,22-UNIMOD:188	ms_run[1]:scan=10318	64.17295666666666	3	2309.226229	2309.198658	R	T	786	808
PSM	HPDASVNFSEFSK	2457	sp|P09429|HMGB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	13-UNIMOD:188	ms_run[1]:scan=6135	38.1164	2	1469.687448	1469.688237	K	K	31	44
PSM	NHTLALTETGSVFAFGENK	2458	sp|Q9P258|RCC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	19-UNIMOD:188	ms_run[1]:scan=9448	58.556105	3	2041.018356	2041.021199	R	M	212	231
PSM	SMKGAGTNEDALIEILTTR	2459	sp|P12429|ANXA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=11396	71.304175	3	2020.028430	2019.030655	K	T	102	121
PSM	SHEGETAYIR	2460	sp|Q07955|SRSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1934	13.810988333333333	2	1161.541787	1161.541451	R	V	182	192
PSM	SKGVFVQSVLPYFVATK	2461	sp|Q53GQ0|DHB12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=11126	69.49055333333334	3	1869.035914	1869.040021	R	L	222	239
PSM	GHNGWVTQIATTPQFPDMILSASR	2462	sp|P63244|RACK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	24-UNIMOD:267	ms_run[1]:scan=12279	77.26350500000001	3	2637.284040	2636.304475	K	D	13	37
PSM	NGRVEIIANDQGNR	2463	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:267,14-UNIMOD:267	ms_run[1]:scan=2908	19.34595	3	1575.805195	1574.802804	K	I	47	61
PSM	QQELTHQEHR	2464	sp|P18206|VINC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28	ms_run[1]:scan=1264	10.075498333333334	2	1288.5992	1287.5952	R	V	179	189
PSM	QQELTHQEHR	2465	sp|P18206|VINC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28,10-UNIMOD:267	ms_run[1]:scan=1278	10.141153333333333	2	1297.6055	1297.6034	R	V	179	189
PSM	SCILRPGGSEDASAMLR	2466	sp|P52888|THOP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	2-UNIMOD:4,5-UNIMOD:267,17-UNIMOD:267	ms_run[1]:scan=6535	40.484334999999994	3	1838.896908	1838.888190	R	R	643	660
PSM	AASDIAMTELPPTHPIR	2467	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=6941	42.972375	3	1820.939072	1818.929819	K	L	154	171
PSM	FLGPEDSHVVVASNSPCLK	2468	sp|Q12788|TBL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	17-UNIMOD:4	ms_run[1]:scan=6911	42.77735333333333	3	2055.002527	2055.009526	R	V	342	361
PSM	QQELDNLLHEKR	2469	sp|Q12788|TBL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28,11-UNIMOD:188,12-UNIMOD:267	ms_run[1]:scan=7848	48.48003833333333	3	1520.7918	1520.7913	R	Y	654	666
PSM	QTIERLEQEHTNR	2470	sp|Q9H2G2|SLK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28,5-UNIMOD:267,13-UNIMOD:267	ms_run[1]:scan=4684	29.586166666666667	2	1655.8115	1655.8125	K	L	887	900
PSM	LLEDFGDGGAFPEIHVAQYPLDMGR	2471	sp|Q13573|SNW1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	23-UNIMOD:35,25-UNIMOD:267	ms_run[1]:scan=11482	71.88061166666667	3	2773.305408	2772.309286	R	K	54	79
PSM	QTVFLLEKPFSVK	2472	sp|O60678|ANM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28,8-UNIMOD:188,13-UNIMOD:188	ms_run[1]:scan=11872	74.521895	2	1529.8860	1529.8891	K	A	482	495
PSM	NPPGFAFVEFEDPRDAEDAVR	2473	sp|Q16629|SRSF7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=10802	67.34502166666667	3	2377.105388	2377.097489	R	G	45	66
PSM	YLYRYPGGESYQDLVQR	2474	sp|O60825|F262_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:267,17-UNIMOD:267	ms_run[1]:scan=7762	47.93383	3	2127.050320	2126.033592	K	L	356	373
PSM	NPDGGPLESSSDLAALSPLTSSGHQEQDTELGSTHTAGATSSLTPSR	2475	sp|Q7Z434|MAVS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=9632	59.73722166666667	4	4663.172772	4663.175760	R	G	172	219
PSM	ILNAHMDSLQWIDQNSALLQR	2476	sp|P37198|NUP62_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=11084	69.20859333333334	3	2465.225331	2465.248528	K	K	477	498
PSM	IADLGNACWVHK	2477	sp|Q96SB4|SRPK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	8-UNIMOD:4,12-UNIMOD:188	ms_run[1]:scan=6132	38.096455	2	1389.693906	1388.696634	K	H	495	507
PSM	QGDTGDWIGTFLGHK	2478	sp|Q9Y3F4|STRAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28	ms_run[1]:scan=12285	77.30624833333333	2	1613.7447	1613.7469	R	G	45	60
PSM	VGAHAGEYGAEALER	2479	sp|P69905|HBA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=4334	27.536031666666666	3	1528.727009	1528.727020	K	M	18	33
PSM	HNDMADLER	2480	sp|O15269|SPTC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	9-UNIMOD:267	ms_run[1]:scan=2843	18.967955	2	1109.478691	1109.479926	K	L	211	220
PSM	NGGLGHMNIALLSDLTK	2481	sp|P30048|PRDX3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=11759	73.751745	2	1753.899293	1752.919254	K	Q	150	167
PSM	QMVIDVLHPGK	2482	sp|P62847|RS24_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28	ms_run[1]:scan=9706	60.200491666666665	2	1218.6411	1218.6426	K	A	22	33
PSM	REELFIVSK	2483	sp|P15121|ALDR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=5808	36.201355	2	1120.633295	1119.628809	K	L	70	79
PSM	LAAAFAVSRLEQDEYALR	2484	sp|P55084|ECHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	9-UNIMOD:267,18-UNIMOD:267	ms_run[1]:scan=10164	63.17747666666667	3	2042.059489	2042.069978	R	S	230	248
PSM	KAPQLTSSELMAITR	2485	sp|P02771|FETA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	15-UNIMOD:267	ms_run[1]:scan=8213	50.721911666666664	2	1654.907181	1654.895161	K	K	438	453
PSM	MPTMPMLDIRPGLIPQAPGPR	2486	sp|Q9UPN6|SCAF8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:35,6-UNIMOD:35,10-UNIMOD:267	ms_run[1]:scan=8545	52.77862833333333	2	2329.188830	2329.198419	R	F	918	939
PSM	KYVLPNFEVK	2487	sp|P0C0L4|CO4A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=7459	46.087975	2	1235.693168	1235.691410	K	I	235	245
PSM	GDTAPPQAPAGGLGGASGAGLLGGGSVTPR	2488	sp|Q8IZL2|MAML2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	30-UNIMOD:267	ms_run[1]:scan=12225	76.90411166666667	3	2557.2802	2555.2962	M	V	2	32
PSM	QHIPKLVADYMAEK	2489	sp|P28332|ADH6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28	ms_run[1]:scan=8051	49.74071666666667	2	1626.8132	1624.8282	R	L	327	341
PSM	VRELEDMYLK	2490	sp|Q9UH65|SWP70_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	2-UNIMOD:267,10-UNIMOD:188	ms_run[1]:scan=6150	38.20056833333334	2	1312.688374	1310.687521	R	L	419	429
PSM	LGSAVVTRGDECGLALGR	2491	sp|P54886|P5CS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	8-UNIMOD:267,12-UNIMOD:4,18-UNIMOD:267	ms_run[1]:scan=6126	38.06718	3	1852.961991	1849.958319	K	L	77	95
PSM	HVLEYNEERDDFDLEA	2492	sp|Q9NV31|IMP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=7764	47.94630166666666	2	1992.866402	1992.870115	R	-	169	185
PSM	RSGEGQEDAGELDFSGLLK	2493	sp|Q00872|MYPC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=9729	60.35129333333334	2	2006.921741	2006.954513	K	R	177	196
PSM	LSSLNQDNSLAEDNLKLK	2494	sp|Q15643|TRIPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	16-UNIMOD:188,18-UNIMOD:188	ms_run[1]:scan=6569	40.69408833333333	2	2013.084108	2013.078107	R	M	404	422
PSM	LKPEDITQIQPQQLVLR	2495	sp|P05556|ITB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=9611	59.597030000000004	2	2018.152718	2018.152425	K	L	106	123
PSM	TVATPLNQVANPNSAIFGGARPR	2496	sp|Q15056|IF4H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=8595	53.094456666666666	2	2350.237924	2350.250576	R	E	217	240