MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000208 -- new
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220618\20220618002634800212^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\111222_HL12.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220618\20220618002634800212^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\111222_HL12.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Acetyl (Protein N-term),Label:13C(6) (K),Label:13C(6)15N(4) (R),Oxidation (M)
MTD	software[1]-setting	maxMissedCleavages=1
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=40
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Label:13C(6) (K),Label:13C(6)15N(4) (R),Acetyl (Protein N-term)
MTD	software[2]-setting	TOL(-)=20
MTD	software[2]-setting	TOL(+)=20
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=1000
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=1
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Acetyl (Protein N-term),Label:13C(6) (K),Label:13C(6)15N(4) (R),Oxidation (M)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=1
MTD	software[3]-setting	peptide_mass_tolerance=20
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:1, Acetyl,]
MTD	variable_mod[1]-site	N-term
MTD	variable_mod[1]-position	Protein N-term
MTD	variable_mod[2]	[UNIMOD, UNIMOD:188, Label:13C(6),]
MTD	variable_mod[2]-site	K
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:267, Label:13C(6)15N(4),]
MTD	variable_mod[3]-site	R
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[4]-site	M
MTD	variable_mod[4]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|Q16555|DPYL2_HUMAN	Dihydropyrimidinase-related protein 2 OS=Homo sapiens OX=9606 GN=DPYSL2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	null	552-UNIMOD:267,439-UNIMOD:4	0.07	50.0	5	2	1
PRT	sp|Q15029-2|U5S1_HUMAN	Isoform 2 of 116 kDa U5 small nuclear ribonucleoprotein component OS=Homo sapiens OX=9606 GN=EFTUD2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	null	433-UNIMOD:4,441-UNIMOD:4,446-UNIMOD:35,460-UNIMOD:267	0.05	49.0	3	2	1
PRT	sp|P12268|IMDH2_HUMAN	Inosine-5'-monophosphate dehydrogenase 2 OS=Homo sapiens OX=9606 GN=IMPDH2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null	468-UNIMOD:4,474-UNIMOD:188,375-UNIMOD:188	0.11	48.0	5	3	1
PRT	sp|P52209-2|6PGD_HUMAN	Isoform 2 of 6-phosphogluconate dehydrogenase, decarboxylating OS=Homo sapiens OX=9606 GN=PGD	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	106-UNIMOD:188,123-UNIMOD:267	0.04	47.0	3	1	0
PRT	sp|Q6P2E9|EDC4_HUMAN	Enhancer of mRNA-decapping protein 4 OS=Homo sapiens OX=9606 GN=EDC4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	299-UNIMOD:4	0.05	47.0	3	2	1
PRT	sp|P62937|PPIA_HUMAN	Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	47.0	null	100-UNIMOD:35,115-UNIMOD:4,118-UNIMOD:188,82-UNIMOD:188,91-UNIMOD:188,28-UNIMOD:188,31-UNIMOD:188	0.34	47.0	15	3	0
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	173-UNIMOD:267,165-UNIMOD:35,339-UNIMOD:4	0.13	46.0	13	3	2
PRT	sp|Q15942-2|ZYX_HUMAN	Isoform 2 of Zyxin OS=Homo sapiens OX=9606 GN=ZYX	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	163-UNIMOD:267	0.06	46.0	3	1	0
PRT	sp|P49588|SYAC_HUMAN	Alanine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=AARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	880-UNIMOD:35	0.02	46.0	2	1	0
PRT	sp|Q13283|G3BP1_HUMAN	Ras GTPase-activating protein-binding protein 1 OS=Homo sapiens OX=9606 GN=G3BP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	46.0	null	50-UNIMOD:188,59-UNIMOD:188	0.05	46.0	5	1	0
PRT	sp|O43447|PPIH_HUMAN	Peptidyl-prolyl cis-trans isomerase H OS=Homo sapiens OX=9606 GN=PPIH PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46.0	null	122-UNIMOD:4,128-UNIMOD:4,112-UNIMOD:35,130-UNIMOD:188	0.16	46.0	3	1	0
PRT	sp|P05023-3|AT1A1_HUMAN	Isoform 3 of Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens OX=9606 GN=ATP1A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	632-UNIMOD:4,640-UNIMOD:188,652-UNIMOD:188,661-UNIMOD:267	0.05	45.0	6	3	2
PRT	sp|Q14657|LAGE3_HUMAN	EKC/KEOPS complex subunit LAGE3 OS=Homo sapiens OX=9606 GN=LAGE3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	45.0	null	47-UNIMOD:267	0.17	45.0	5	1	0
PRT	sp|O75367-2|H2AY_HUMAN	Isoform 1 of Core histone macro-H2A.1 OS=Homo sapiens OX=9606 GN=MACROH2A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	96-UNIMOD:188,116-UNIMOD:188,123-UNIMOD:188,134-UNIMOD:188	0.14	45.0	8	3	0
PRT	sp|P46821|MAP1B_HUMAN	Microtubule-associated protein 1B OS=Homo sapiens OX=9606 GN=MAP1B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	213-UNIMOD:188	0.01	45.0	2	2	2
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	1185-UNIMOD:188	0.03	45.0	3	2	1
PRT	sp|Q9BWD1|THIC_HUMAN	Acetyl-CoA acetyltransferase, cytosolic OS=Homo sapiens OX=9606 GN=ACAT2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	360-UNIMOD:4,361-UNIMOD:267	0.05	45.0	2	1	0
PRT	sp|Q15365|PCBP1_HUMAN	Poly(rC)-binding protein 1 OS=Homo sapiens OX=9606 GN=PCBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	45.0	null	244-UNIMOD:28,268-UNIMOD:188	0.07	45.0	3	1	0
PRT	sp|Q8N163-2|CCAR2_HUMAN	Isoform 2 of Cell cycle and apoptosis regulator protein 2 OS=Homo sapiens OX=9606 GN=CCAR2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	818-UNIMOD:267	0.02	44.0	2	1	0
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	44.0	null	785-UNIMOD:188	0.04	44.0	4	2	1
PRT	sp|Q14839|CHD4_HUMAN	Chromodomain-helicase-DNA-binding protein 4 OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	1468-UNIMOD:4,1484-UNIMOD:267	0.01	44.0	5	1	0
PRT	sp|P40939|ECHA_HUMAN	Trifunctional enzyme subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=HADHA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	44.0	null	215-UNIMOD:35,230-UNIMOD:188,235-UNIMOD:267	0.06	44.0	6	2	1
PRT	sp|Q71U36|TBA1A_HUMAN	Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	44.0	null	85-UNIMOD:28,96-UNIMOD:188,105-UNIMOD:267,79-UNIMOD:267	0.08	44.0	4	2	1
PRT	sp|Q8N163|CCAR2_HUMAN	Cell cycle and apoptosis regulator protein 2 OS=Homo sapiens OX=9606 GN=CCAR2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	null	818-UNIMOD:267	0.02	44.0	1	1	0
PRT	sp|P12004|PCNA_HUMAN	Proliferating cell nuclear antigen OS=Homo sapiens OX=9606 GN=PCNA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	162-UNIMOD:4,164-UNIMOD:188,168-UNIMOD:188	0.08	43.0	3	1	0
PRT	sp|Q6PKG0-3|LARP1_HUMAN	Isoform 2 of La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	108-UNIMOD:188,520-UNIMOD:188	0.04	43.0	5	2	0
PRT	sp|Q14974-2|IMB1_HUMAN	Isoform 2 of Importin subunit beta-1 OS=Homo sapiens OX=9606 GN=KPNB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	74-UNIMOD:35,78-UNIMOD:4,83-UNIMOD:4,87-UNIMOD:267	0.02	43.0	7	1	0
PRT	sp|Q13501|SQSTM_HUMAN	Sequestosome-1 OS=Homo sapiens OX=9606 GN=SQSTM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	128-UNIMOD:4,131-UNIMOD:4,121-UNIMOD:35,139-UNIMOD:267	0.05	43.0	4	1	0
PRT	sp|P17655|CAN2_HUMAN	Calpain-2 catalytic subunit OS=Homo sapiens OX=9606 GN=CAPN2 PE=1 SV=6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	77-UNIMOD:267,82-UNIMOD:4,94-UNIMOD:267	0.03	43.0	3	1	0
PRT	sp|P11586|C1TC_HUMAN	C-1-tetrahydrofolate synthase, cytoplasmic OS=Homo sapiens OX=9606 GN=MTHFD1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	848-UNIMOD:188,854-UNIMOD:188,152-UNIMOD:4,473-UNIMOD:188	0.08	43.0	8	4	2
PRT	sp|Q9UDY2-5|ZO2_HUMAN	Isoform A3 of Tight junction protein ZO-2 OS=Homo sapiens OX=9606 GN=TJP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.02	43.0	1	1	1
PRT	sp|O94992|HEXI1_HUMAN	Protein HEXIM1 OS=Homo sapiens OX=9606 GN=HEXIM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	79-UNIMOD:4,84-UNIMOD:4,58-UNIMOD:267,86-UNIMOD:267	0.10	42.0	2	1	0
PRT	sp|Q9H0D6-2|XRN2_HUMAN	Isoform 2 of 5'-3' exoribonuclease 2 OS=Homo sapiens OX=9606 GN=XRN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	370-UNIMOD:267	0.02	42.0	2	1	0
PRT	sp|Q01082-3|SPTB2_HUMAN	Isoform 2 of Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	1221-UNIMOD:267,1232-UNIMOD:267,1008-UNIMOD:188,1023-UNIMOD:267	0.02	42.0	4	2	1
PRT	sp|P78371-2|TCPB_HUMAN	Isoform 2 of T-complex protein 1 subunit beta OS=Homo sapiens OX=9606 GN=CCT2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	113-UNIMOD:35,348-UNIMOD:4,355-UNIMOD:188,109-UNIMOD:267,123-UNIMOD:188	0.07	42.0	5	2	0
PRT	sp|Q9BSH4|TACO1_HUMAN	Translational activator of cytochrome c oxidase 1 OS=Homo sapiens OX=9606 GN=TACO1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	159-UNIMOD:188	0.06	42.0	4	1	0
PRT	sp|Q13263-2|TIF1B_HUMAN	Isoform 2 of Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	139-UNIMOD:4,142-UNIMOD:4,147-UNIMOD:4,148-UNIMOD:267,390-UNIMOD:267,401-UNIMOD:267,361-UNIMOD:35	0.09	42.0	7	3	0
PRT	sp|Q9NR50-3|EI2BG_HUMAN	Isoform 3 of Translation initiation factor eIF-2B subunit gamma OS=Homo sapiens OX=9606 GN=EIF2B3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	367-UNIMOD:188	0.05	42.0	2	1	0
PRT	sp|P38117|ETFB_HUMAN	Electron transfer flavoprotein subunit beta OS=Homo sapiens OX=9606 GN=ETFB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	42-UNIMOD:4,51-UNIMOD:267,38-UNIMOD:35	0.07	42.0	5	1	0
PRT	sp|P55795|HNRH2_HUMAN	Heterogeneous nuclear ribonucleoprotein H2 OS=Homo sapiens OX=9606 GN=HNRNPH2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	114-UNIMOD:267,34-UNIMOD:4	0.07	42.0	7	2	1
PRT	sp|P08195-2|4F2_HUMAN	Isoform 2 of 4F2 cell-surface antigen heavy chain OS=Homo sapiens OX=9606 GN=SLC3A2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	144-UNIMOD:188,65-UNIMOD:188,70-UNIMOD:188	0.06	42.0	5	2	0
PRT	sp|Q00610-2|CLH1_HUMAN	Isoform 2 of Clathrin heavy chain 1 OS=Homo sapiens OX=9606 GN=CLTC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	367-UNIMOD:188,382-UNIMOD:188,151-UNIMOD:4,157-UNIMOD:267,574-UNIMOD:267,583-UNIMOD:267	0.04	42.0	7	4	1
PRT	sp|P21291|CSRP1_HUMAN	Cysteine and glycine-rich protein 1 OS=Homo sapiens OX=9606 GN=CSRP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	42-UNIMOD:188,58-UNIMOD:4,59-UNIMOD:188	0.10	42.0	2	1	0
PRT	sp|Q99567|NUP88_HUMAN	Nuclear pore complex protein Nup88 OS=Homo sapiens OX=9606 GN=NUP88 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	84-UNIMOD:267,100-UNIMOD:267	0.03	42.0	4	1	0
PRT	sp|Q14203-5|DCTN1_HUMAN	Isoform 5 of Dynactin subunit 1 OS=Homo sapiens OX=9606 GN=DCTN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	1011-UNIMOD:267	0.02	42.0	2	1	0
PRT	sp|Q15149-7|PLEC_HUMAN	Isoform 7 of Plectin OS=Homo sapiens OX=9606 GN=PLEC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	3834-UNIMOD:267,3849-UNIMOD:267,3167-UNIMOD:4,1181-UNIMOD:267,1195-UNIMOD:267,3492-UNIMOD:267,1510-UNIMOD:267,1518-UNIMOD:267,1436-UNIMOD:267,1447-UNIMOD:267,2838-UNIMOD:267,482-UNIMOD:267,491-UNIMOD:267,1836-UNIMOD:267,1845-UNIMOD:267,358-UNIMOD:267,361-UNIMOD:4,364-UNIMOD:267,2262-UNIMOD:267,2273-UNIMOD:267,3969-UNIMOD:188,3971-UNIMOD:188,1920-UNIMOD:267,1928-UNIMOD:267,2417-UNIMOD:267,2425-UNIMOD:267	0.05	42.0	27	17	9
PRT	sp|P51570|GALK1_HUMAN	Galactokinase OS=Homo sapiens OX=9606 GN=GALK1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.05	41.0	1	1	1
PRT	sp|P33316-2|DUT_HUMAN	Isoform 2 of Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=DUT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	106-UNIMOD:267,17-UNIMOD:267,27-UNIMOD:267	0.18	41.0	4	2	0
PRT	sp|P49005|DPOD2_HUMAN	DNA polymerase delta subunit 2 OS=Homo sapiens OX=9606 GN=POLD2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	384-UNIMOD:4,389-UNIMOD:188	0.04	41.0	2	1	0
PRT	sp|O75694-2|NU155_HUMAN	Isoform 2 of Nuclear pore complex protein Nup155 OS=Homo sapiens OX=9606 GN=NUP155	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	478-UNIMOD:267	0.01	41.0	2	1	0
PRT	sp|Q6IBS0|TWF2_HUMAN	Twinfilin-2 OS=Homo sapiens OX=9606 GN=TWF2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	141-UNIMOD:4,152-UNIMOD:267	0.05	41.0	2	1	0
PRT	sp|P07237|PDIA1_HUMAN	Protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	247-UNIMOD:188,300-UNIMOD:267	0.07	41.0	8	2	0
PRT	sp|Q96C23|GALM_HUMAN	Aldose 1-epimerase OS=Homo sapiens OX=9606 GN=GALM PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	305-UNIMOD:4,319-UNIMOD:267	0.06	41.0	2	1	0
PRT	sp|P49755|TMEDA_HUMAN	Transmembrane emp24 domain-containing protein 10 OS=Homo sapiens OX=9606 GN=TMED10 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	87-UNIMOD:188,92-UNIMOD:188	0.08	41.0	3	1	0
PRT	sp|Q14202-3|ZMYM3_HUMAN	Isoform 3 of Zinc finger MYM-type protein 3 OS=Homo sapiens OX=9606 GN=ZMYM3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	335-UNIMOD:4,339-UNIMOD:4	0.04	41.0	1	1	1
PRT	sp|Q16531|DDB1_HUMAN	DNA damage-binding protein 1 OS=Homo sapiens OX=9606 GN=DDB1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	725-UNIMOD:4,732-UNIMOD:4	0.03	41.0	2	2	2
PRT	sp|P09211|GSTP1_HUMAN	Glutathione S-transferase P OS=Homo sapiens OX=9606 GN=GSTP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	191-UNIMOD:188,209-UNIMOD:188,128-UNIMOD:188,141-UNIMOD:188	0.20	41.0	5	2	0
PRT	sp|Q9Y490|TLN1_HUMAN	Talin-1 OS=Homo sapiens OX=9606 GN=TLN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	57-UNIMOD:188,58-UNIMOD:188,1901-UNIMOD:188,1917-UNIMOD:188	0.03	41.0	4	3	2
PRT	sp|P23526-2|SAHH_HUMAN	Isoform 2 of Adenosylhomocysteinase OS=Homo sapiens OX=9606 GN=AHCY	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	139-UNIMOD:35,146-UNIMOD:188,158-UNIMOD:188,167-UNIMOD:4	0.08	41.0	5	2	1
PRT	sp|Q14966-2|ZN638_HUMAN	Isoform 2 of Zinc finger protein 638 OS=Homo sapiens OX=9606 GN=ZNF638	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.03	41.0	2	1	0
PRT	sp|P11908|PRPS2_HUMAN	Ribose-phosphate pyrophosphokinase 2 OS=Homo sapiens OX=9606 GN=PRPS2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	41.0	null	18-UNIMOD:267,22-UNIMOD:267,29-UNIMOD:188	0.14	41.0	7	3	1
PRT	sp|P14618-3|KPYM_HUMAN	Isoform 3 of Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	192-UNIMOD:188,209-UNIMOD:188,264-UNIMOD:267,279-UNIMOD:267,276-UNIMOD:35,459-UNIMOD:4	0.11	41.0	13	3	1
PRT	sp|Q1KMD3|HNRL2_HUMAN	Heterogeneous nuclear ribonucleoprotein U-like protein 2 OS=Homo sapiens OX=9606 GN=HNRNPUL2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	538-UNIMOD:4	0.02	41.0	2	1	0
PRT	sp|Q00839-2|HNRPU_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	556-UNIMOD:267,571-UNIMOD:267	0.02	41.0	4	1	0
PRT	sp|Q15555-4|MARE2_HUMAN	Isoform 4 of Microtubule-associated protein RP/EB family member 2 OS=Homo sapiens OX=9606 GN=MAPRE2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.08	41.0	1	1	1
PRT	sp|Q13347|EIF3I_HUMAN	Eukaryotic translation initiation factor 3 subunit I OS=Homo sapiens OX=9606 GN=EIF3I PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	230-UNIMOD:267,261-UNIMOD:267	0.11	41.0	2	1	0
PRT	sp|P54920|SNAA_HUMAN	Alpha-soluble NSF attachment protein OS=Homo sapiens OX=9606 GN=NAPA PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	41.0	null	22-UNIMOD:188,37-UNIMOD:188	0.14	41.0	3	2	1
PRT	sp|P06576|ATPB_HUMAN	ATP synthase subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	239-UNIMOD:267,133-UNIMOD:188,143-UNIMOD:267	0.07	41.0	4	2	1
PRT	sp|Q6UXN9|WDR82_HUMAN	WD repeat-containing protein 82 OS=Homo sapiens OX=9606 GN=WDR82 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	287-UNIMOD:4	0.11	41.0	3	2	1
PRT	sp|Q96ER9|MITOK_HUMAN	Mitochondrial potassium channel OS=Homo sapiens OX=9606 GN=CCDC51 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null	292-UNIMOD:267	0.06	41.0	4	1	0
PRT	sp|P35222|CTNB1_HUMAN	Catenin beta-1 OS=Homo sapiens OX=9606 GN=CTNNB1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	49-UNIMOD:188	0.04	40.0	1	1	1
PRT	sp|Q08211|DHX9_HUMAN	ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	837-UNIMOD:267,806-UNIMOD:188,697-UNIMOD:188,708-UNIMOD:188	0.03	40.0	4	3	2
PRT	sp|Q9UL26|RB22A_HUMAN	Ras-related protein Rab-22A OS=Homo sapiens OX=9606 GN=RAB22A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	134-UNIMOD:188,150-UNIMOD:188	0.10	40.0	3	1	0
PRT	sp|Q15005|SPCS2_HUMAN	Signal peptidase complex subunit 2 OS=Homo sapiens OX=9606 GN=SPCS2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	214-UNIMOD:267	0.09	40.0	2	1	0
PRT	sp|P31153|METK2_HUMAN	S-adenosylmethionine synthase isoform type-2 OS=Homo sapiens OX=9606 GN=MAT2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.04	40.0	1	1	1
PRT	sp|P82673-2|RT35_HUMAN	Isoform 2 of 28S ribosomal protein S35, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS35	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	164-UNIMOD:267	0.10	40.0	2	1	0
PRT	sp|P52597|HNRPF_HUMAN	Heterogeneous nuclear ribonucleoprotein F OS=Homo sapiens OX=9606 GN=HNRNPF PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	114-UNIMOD:267	0.04	40.0	4	1	0
PRT	sp|P62136|PP1A_HUMAN	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Homo sapiens OX=9606 GN=PPP1CA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	171-UNIMOD:4,172-UNIMOD:4,187-UNIMOD:267	0.10	40.0	5	2	1
PRT	sp|P49748-2|ACADV_HUMAN	Isoform 2 of Very long-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ACADVL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	593-UNIMOD:267,610-UNIMOD:267	0.03	40.0	4	1	0
PRT	sp|P0DMV8-2|HS71A_HUMAN	Isoform 2 of Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	548-UNIMOD:4	0.06	40.0	1	1	1
PRT	sp|P51858-2|HDGF_HUMAN	Isoform 2 of Hepatoma-derived growth factor OS=Homo sapiens OX=9606 GN=HDGF	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	73-UNIMOD:188,89-UNIMOD:188	0.13	40.0	3	2	1
PRT	sp|P15880|RS2_HUMAN	40S ribosomal protein S2 OS=Homo sapiens OX=9606 GN=RPS2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	222-UNIMOD:4	0.06	40.0	2	1	0
PRT	sp|Q68CZ2-2|TENS3_HUMAN	Isoform 2 of Tensin-3 OS=Homo sapiens OX=9606 GN=TNS3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.03	40.0	2	2	2
PRT	sp|P13489|RINI_HUMAN	Ribonuclease inhibitor OS=Homo sapiens OX=9606 GN=RNH1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null	248-UNIMOD:4,257-UNIMOD:267,244-UNIMOD:35	0.04	40.0	6	1	0
PRT	sp|Q8N6R0-1|EFNMT_HUMAN	Isoform 4 of eEF1A lysine and N-terminal methyltransferase OS=Homo sapiens OX=9606 GN=EEF1AKNMT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	235-UNIMOD:4	0.05	40.0	1	1	1
PRT	sp|P30740|ILEU_HUMAN	Leukocyte elastase inhibitor OS=Homo sapiens OX=9606 GN=SERPINB1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.06	40.0	1	1	1
PRT	sp|P15374|UCHL3_HUMAN	Ubiquitin carboxyl-terminal hydrolase isozyme L3 OS=Homo sapiens OX=9606 GN=UCHL3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	165-UNIMOD:188	0.09	40.0	2	1	0
PRT	sp|Q8IX12-2|CCAR1_HUMAN	Isoform 2 of Cell division cycle and apoptosis regulator protein 1 OS=Homo sapiens OX=9606 GN=CCAR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	723-UNIMOD:188	0.02	40.0	2	1	0
PRT	sp|Q9BQA1-2|MEP50_HUMAN	Isoform 2 of Methylosome protein 50 OS=Homo sapiens OX=9606 GN=WDR77	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	37-UNIMOD:267,52-UNIMOD:267	0.06	40.0	2	1	0
PRT	sp|P11940|PABP1_HUMAN	Polyadenylate-binding protein 1 OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	132-UNIMOD:4,138-UNIMOD:188,153-UNIMOD:267	0.04	40.0	4	1	0
PRT	sp|P07814|SYEP_HUMAN	Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens OX=9606 GN=EPRS1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	680-UNIMOD:4,692-UNIMOD:4,1106-UNIMOD:267,542-UNIMOD:188,549-UNIMOD:188,675-UNIMOD:267,693-UNIMOD:188	0.05	39.0	9	4	1
PRT	sp|Q9NZU5|LMCD1_HUMAN	LIM and cysteine-rich domains protein 1 OS=Homo sapiens OX=9606 GN=LMCD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	52-UNIMOD:4,58-UNIMOD:4,335-UNIMOD:4,338-UNIMOD:4	0.09	39.0	3	2	1
PRT	sp|P78347-2|GTF2I_HUMAN	Isoform 2 of General transcription factor II-I OS=Homo sapiens OX=9606 GN=GTF2I	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	80-UNIMOD:4,473-UNIMOD:267,215-UNIMOD:4,219-UNIMOD:188,221-UNIMOD:188,828-UNIMOD:267,837-UNIMOD:267	0.07	39.0	6	4	2
PRT	sp|Q92598-2|HS105_HUMAN	Isoform Beta of Heat shock protein 105 kDa OS=Homo sapiens OX=9606 GN=HSPH1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	360-UNIMOD:188,374-UNIMOD:267,614-UNIMOD:4,623-UNIMOD:267,437-UNIMOD:267,458-UNIMOD:188	0.07	39.0	6	3	0
PRT	sp|P68400|CSK21_HUMAN	Casein kinase II subunit alpha OS=Homo sapiens OX=9606 GN=CSNK2A1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	39.0	null	102-UNIMOD:188,107-UNIMOD:267	0.05	39.0	5	2	0
PRT	sp|P30050-2|RL12_HUMAN	Isoform 2 of 60S ribosomal protein L12 OS=Homo sapiens OX=9606 GN=RPL12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	81-UNIMOD:267	0.12	39.0	4	1	0
PRT	sp|Q9HCK5|AGO4_HUMAN	Protein argonaute-4 OS=Homo sapiens OX=9606 GN=AGO4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	334-UNIMOD:4,341-UNIMOD:267	0.02	39.0	6	1	0
PRT	sp|Q9NR30-2|DDX21_HUMAN	Isoform 2 of Nucleolar RNA helicase 2 OS=Homo sapiens OX=9606 GN=DDX21	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	223-UNIMOD:4,559-UNIMOD:267,218-UNIMOD:188,236-UNIMOD:267	0.08	39.0	6	3	1
PRT	sp|O76071|CIAO1_HUMAN	Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Homo sapiens OX=9606 GN=CIAO1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	39.0	null	97-UNIMOD:4,90-UNIMOD:188,109-UNIMOD:188	0.06	39.0	3	1	0
PRT	sp|Q06830|PRDX1_HUMAN	Peroxiredoxin-1 OS=Homo sapiens OX=9606 GN=PRDX1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	39.0	null	93-UNIMOD:188,109-UNIMOD:188,94-UNIMOD:28	0.16	39.0	5	3	2
PRT	sp|P60174|TPIS_HUMAN	Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	56-UNIMOD:188,70-UNIMOD:188,150-UNIMOD:188	0.10	39.0	5	2	0
PRT	sp|Q9H4M9|EHD1_HUMAN	EH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=EHD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	492-UNIMOD:188,509-UNIMOD:188	0.04	39.0	2	1	0
PRT	sp|Q8IY22-3|CMIP_HUMAN	Isoform 3 of C-Maf-inducing protein OS=Homo sapiens OX=9606 GN=CMIP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.03	39.0	2	1	0
PRT	sp|P30048-2|PRDX3_HUMAN	Isoform 2 of Thioredoxin-dependent peroxide reductase, mitochondrial OS=Homo sapiens OX=9606 GN=PRDX3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	138-UNIMOD:35,148-UNIMOD:188	0.15	39.0	7	2	0
PRT	sp|P34932|HSP74_HUMAN	Heat shock 70 kDa protein 4 OS=Homo sapiens OX=9606 GN=HSPA4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	719-UNIMOD:188,733-UNIMOD:188,731-UNIMOD:35	0.04	39.0	5	2	0
PRT	sp|Q96HS1-2|PGAM5_HUMAN	Isoform 2 of Serine/threonine-protein phosphatase PGAM5, mitochondrial OS=Homo sapiens OX=9606 GN=PGAM5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	88-UNIMOD:188,93-UNIMOD:188	0.07	39.0	2	1	0
PRT	sp|Q15042-4|RB3GP_HUMAN	Isoform 3 of Rab3 GTPase-activating protein catalytic subunit OS=Homo sapiens OX=9606 GN=RAB3GAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.02	39.0	2	1	0
PRT	sp|Q15717|ELAV1_HUMAN	ELAV-like protein 1 OS=Homo sapiens OX=9606 GN=ELAVL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	171-UNIMOD:188,182-UNIMOD:188,205-UNIMOD:267	0.13	39.0	8	2	0
PRT	sp|P07355-2|ANXA2_HUMAN	Isoform 2 of Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	67-UNIMOD:188,81-UNIMOD:267,151-UNIMOD:4,153-UNIMOD:267	0.10	39.0	8	3	0
PRT	sp|P49419|AL7A1_HUMAN	Alpha-aminoadipic semialdehyde dehydrogenase OS=Homo sapiens OX=9606 GN=ALDH7A1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	375-UNIMOD:188	0.07	39.0	3	2	1
PRT	sp|Q14103|HNRPD_HUMAN	Heterogeneous nuclear ribonucleoprotein D0 OS=Homo sapiens OX=9606 GN=HNRNPD PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null		0.05	39.0	1	1	1
PRT	sp|Q00796|DHSO_HUMAN	Sorbitol dehydrogenase OS=Homo sapiens OX=9606 GN=SORD PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	2-UNIMOD:1	0.06	38.0	2	1	0
PRT	sp|P55263-3|ADK_HUMAN	Isoform 3 of Adenosine kinase OS=Homo sapiens OX=9606 GN=ADK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	140-UNIMOD:4,143-UNIMOD:4	0.10	38.0	2	1	0
PRT	sp|Q9Y5S9-2|RBM8A_HUMAN	Isoform 2 of RNA-binding protein 8A OS=Homo sapiens OX=9606 GN=RBM8A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	2-UNIMOD:1,17-UNIMOD:35,49-UNIMOD:35	0.28	38.0	3	2	1
PRT	sp|Q9Y295|DRG1_HUMAN	Developmentally-regulated GTP-binding protein 1 OS=Homo sapiens OX=9606 GN=DRG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	366-UNIMOD:188,367-UNIMOD:188,222-UNIMOD:267	0.11	38.0	5	3	2
PRT	sp|P62195-2|PRS8_HUMAN	Isoform 2 of 26S proteasome regulatory subunit 8 OS=Homo sapiens OX=9606 GN=PSMC5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	250-UNIMOD:267,240-UNIMOD:35	0.05	38.0	4	1	0
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	1118-UNIMOD:4,1127-UNIMOD:4,1131-UNIMOD:267,634-UNIMOD:4,642-UNIMOD:4,646-UNIMOD:188,1159-UNIMOD:35,1171-UNIMOD:267,1180-UNIMOD:267	0.05	38.0	10	7	5
PRT	sp|P26640|SYVC_HUMAN	Valine--tRNA ligase OS=Homo sapiens OX=9606 GN=VARS1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	985-UNIMOD:267,633-UNIMOD:267	0.04	38.0	4	3	2
PRT	sp|Q9C0C2|TB182_HUMAN	182 kDa tankyrase-1-binding protein OS=Homo sapiens OX=9606 GN=TNKS1BP1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	1043-UNIMOD:267	0.01	38.0	2	1	0
PRT	sp|Q99623-2|PHB2_HUMAN	Isoform 2 of Prohibitin-2 OS=Homo sapiens OX=9606 GN=PHB2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	71-UNIMOD:267,111-UNIMOD:267,123-UNIMOD:267,120-UNIMOD:35	0.13	38.0	8	2	0
PRT	sp|Q04637-6|IF4G1_HUMAN	Isoform E of Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.01	38.0	2	1	0
PRT	sp|Q93050-1|VPP1_HUMAN	Isoform 2 of V-type proton ATPase 116 kDa subunit a isoform 1 OS=Homo sapiens OX=9606 GN=ATP6V0A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.02	38.0	1	1	1
PRT	sp|Q9C075|K1C23_HUMAN	Keratin, type I cytoskeletal 23 OS=Homo sapiens OX=9606 GN=KRT23 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	117-UNIMOD:188,137-UNIMOD:188,42-UNIMOD:267	0.08	38.0	3	2	1
PRT	sp|Q15424-2|SAFB1_HUMAN	Isoform 2 of Scaffold attachment factor B1 OS=Homo sapiens OX=9606 GN=SAFB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	287-UNIMOD:188,293-UNIMOD:4,301-UNIMOD:188	0.02	38.0	2	1	0
PRT	sp|P19338|NUCL_HUMAN	Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.02	38.0	1	1	1
PRT	sp|O00299|CLIC1_HUMAN	Chloride intracellular channel protein 1 OS=Homo sapiens OX=9606 GN=CLIC1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	178-UNIMOD:4,166-UNIMOD:188,183-UNIMOD:188	0.08	38.0	3	1	0
PRT	sp|O75475-3|PSIP1_HUMAN	Isoform 3 of PC4 and SFRS1-interacting protein OS=Homo sapiens OX=9606 GN=PSIP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	75-UNIMOD:188,89-UNIMOD:188	0.05	38.0	3	1	0
PRT	sp|Q9UEW8-2|STK39_HUMAN	Isoform 2 of STE20/SPS1-related proline-alanine-rich protein kinase OS=Homo sapiens OX=9606 GN=STK39	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	218-UNIMOD:4	0.04	38.0	1	1	1
PRT	sp|Q15477|SKIV2_HUMAN	Helicase SKI2W OS=Homo sapiens OX=9606 GN=SKIV2L PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	991-UNIMOD:188	0.02	38.0	4	1	0
PRT	sp|O14745|NHRF1_HUMAN	Na(+)/H(+) exchange regulatory cofactor NHE-RF1 OS=Homo sapiens OX=9606 GN=SLC9A3R1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.06	38.0	3	1	0
PRT	sp|Q9H7B2|RPF2_HUMAN	Ribosome production factor 2 homolog OS=Homo sapiens OX=9606 GN=RPF2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.06	38.0	2	1	0
PRT	sp|Q9UQE7|SMC3_HUMAN	Structural maintenance of chromosomes protein 3 OS=Homo sapiens OX=9606 GN=SMC3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	796-UNIMOD:267,805-UNIMOD:267	0.02	38.0	3	2	1
PRT	sp|O96019-2|ACL6A_HUMAN	Isoform 2 of Actin-like protein 6A OS=Homo sapiens OX=9606 GN=ACTL6A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	88-UNIMOD:267,152-UNIMOD:188	0.13	38.0	7	2	0
PRT	sp|Q08AM6-2|VAC14_HUMAN	Isoform 2 of Protein VAC14 homolog OS=Homo sapiens OX=9606 GN=VAC14	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.10	38.0	2	1	0
PRT	sp|Q9NSE4|SYIM_HUMAN	Isoleucine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=IARS2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.02	38.0	1	1	1
PRT	sp|Q6P2Q9|PRP8_HUMAN	Pre-mRNA-processing-splicing factor 8 OS=Homo sapiens OX=9606 GN=PRPF8 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null	2098-UNIMOD:188,2108-UNIMOD:188,2049-UNIMOD:188,2070-UNIMOD:188	0.03	38.0	9	3	1
PRT	sp|Q5T4S7-3|UBR4_HUMAN	Isoform 3 of E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	2890-UNIMOD:267	0.01	38.0	2	1	0
PRT	sp|P30876|RPB2_HUMAN	DNA-directed RNA polymerase II subunit RPB2 OS=Homo sapiens OX=9606 GN=POLR2B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	134-UNIMOD:188,146-UNIMOD:188	0.03	38.0	5	2	1
PRT	sp|Q02790|FKBP4_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Homo sapiens OX=9606 GN=FKBP4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	103-UNIMOD:4,107-UNIMOD:4,108-UNIMOD:188,121-UNIMOD:188	0.05	38.0	2	1	0
PRT	sp|O00567|NOP56_HUMAN	Nucleolar protein 56 OS=Homo sapiens OX=9606 GN=NOP56 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	38.0	null	320-UNIMOD:188,154-UNIMOD:267,87-UNIMOD:188	0.09	38.0	6	4	2
PRT	sp|Q14320|FA50A_HUMAN	Protein FAM50A OS=Homo sapiens OX=9606 GN=FAM50A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	38.0	null	298-UNIMOD:188,305-UNIMOD:188,289-UNIMOD:267	0.09	38.0	4	2	0
PRT	sp|P00734|THRB_HUMAN	Prothrombin OS=Homo sapiens OX=9606 GN=F2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	564-UNIMOD:4	0.03	38.0	1	1	1
PRT	sp|Q9UPN3-3|MACF1_HUMAN	Isoform 3 of Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	3392-UNIMOD:188	0.00	37.0	1	1	1
PRT	sp|P23381-2|SYWC_HUMAN	Isoform 2 of Tryptophan--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=WARS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	407-UNIMOD:267	0.04	37.0	4	1	0
PRT	sp|Q13547|HDAC1_HUMAN	Histone deacetylase 1 OS=Homo sapiens OX=9606 GN=HDAC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.04	37.0	1	1	1
PRT	sp|P23246-2|SFPQ_HUMAN	Isoform Short of Splicing factor, proline- and glutamine-rich OS=Homo sapiens OX=9606 GN=SFPQ	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	493-UNIMOD:267	0.02	37.0	3	1	0
PRT	sp|Q9UQ80|PA2G4_HUMAN	Proliferation-associated protein 2G4 OS=Homo sapiens OX=9606 GN=PA2G4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	85-UNIMOD:4,87-UNIMOD:4,311-UNIMOD:188	0.09	37.0	3	2	1
PRT	sp|P62826|RAN_HUMAN	GTP-binding nuclear protein Ran OS=Homo sapiens OX=9606 GN=RAN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	60-UNIMOD:188,71-UNIMOD:188	0.07	37.0	2	1	0
PRT	sp|P62857|RS28_HUMAN	40S ribosomal protein S28 OS=Homo sapiens OX=9606 GN=RPS28 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	51-UNIMOD:267,63-UNIMOD:267	0.25	37.0	4	1	0
PRT	sp|P98175-4|RBM10_HUMAN	Isoform 4 of RNA-binding protein 10 OS=Homo sapiens OX=9606 GN=RBM10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	837-UNIMOD:188,842-UNIMOD:188	0.02	37.0	2	1	0
PRT	sp|P11940-2|PABP1_HUMAN	Isoform 2 of Polyadenylate-binding protein 1 OS=Homo sapiens OX=9606 GN=PABPC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	153-UNIMOD:267,312-UNIMOD:188,324-UNIMOD:188	0.05	37.0	6	2	0
PRT	sp|O43242-2|PSMD3_HUMAN	Isoform 2 of 26S proteasome non-ATPase regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PSMD3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	118-UNIMOD:267	0.04	37.0	1	1	0
PRT	sp|Q14204|DYHC1_HUMAN	Cytoplasmic dynein 1 heavy chain 1 OS=Homo sapiens OX=9606 GN=DYNC1H1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null	3940-UNIMOD:4,3945-UNIMOD:188,3950-UNIMOD:188,1912-UNIMOD:188,1917-UNIMOD:188	0.01	37.0	4	3	2
PRT	sp|P12814-2|ACTN1_HUMAN	Isoform 2 of Alpha-actinin-1 OS=Homo sapiens OX=9606 GN=ACTN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	633-UNIMOD:188,649-UNIMOD:188,577-UNIMOD:188,174-UNIMOD:188	0.05	37.0	8	3	0
PRT	sp|Q9Y2Z4|SYYM_HUMAN	Tyrosine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=YARS2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null	163-UNIMOD:267	0.07	37.0	5	2	1
PRT	sp|P05387|RLA2_HUMAN	60S acidic ribosomal protein P2 OS=Homo sapiens OX=9606 GN=RPLP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	1-UNIMOD:35,2-UNIMOD:267,21-UNIMOD:188	0.19	37.0	4	1	0
PRT	sp|Q96AE4|FUBP1_HUMAN	Far upstream element-binding protein 1 OS=Homo sapiens OX=9606 GN=FUBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	37.0	null	219-UNIMOD:35,332-UNIMOD:4,344-UNIMOD:267,332-UNIMOD:385	0.05	37.0	5	2	1
PRT	sp|P08621-2|RU17_HUMAN	Isoform 2 of U1 small nuclear ribonucleoprotein 70 kDa OS=Homo sapiens OX=9606 GN=SNRNP70	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	88-UNIMOD:35,103-UNIMOD:188	0.04	37.0	2	1	0
PRT	sp|P16989-2|YBOX3_HUMAN	Isoform 2 of Y-box-binding protein 3 OS=Homo sapiens OX=9606 GN=YBX3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	113-UNIMOD:188,124-UNIMOD:188	0.05	37.0	2	1	0
PRT	sp|Q13573|SNW1_HUMAN	SNW domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SNW1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.04	37.0	1	1	1
PRT	sp|P36871-2|PGM1_HUMAN	Isoform 2 of Phosphoglucomutase-1 OS=Homo sapiens OX=9606 GN=PGM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	445-UNIMOD:267,458-UNIMOD:188	0.03	37.0	2	1	0
PRT	sp|Q9NQ55-2|SSF1_HUMAN	Isoform 2 of Suppressor of SWI4 1 homolog OS=Homo sapiens OX=9606 GN=PPAN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.04	37.0	1	1	1
PRT	sp|Q9Y3I0|RTCB_HUMAN	RNA-splicing ligase RtcB homolog OS=Homo sapiens OX=9606 GN=RTCB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	485-UNIMOD:4,199-UNIMOD:35	0.06	37.0	2	2	2
PRT	sp|Q8NHQ9|DDX55_HUMAN	ATP-dependent RNA helicase DDX55 OS=Homo sapiens OX=9606 GN=DDX55 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.03	37.0	1	1	1
PRT	sp|P07737|PROF1_HUMAN	Profilin-1 OS=Homo sapiens OX=9606 GN=PFN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.14	37.0	3	1	0
PRT	sp|P42765|THIM_HUMAN	3-ketoacyl-CoA thiolase, mitochondrial OS=Homo sapiens OX=9606 GN=ACAA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.05	37.0	1	1	1
PRT	sp|P62495-2|ERF1_HUMAN	Isoform 2 of Eukaryotic peptide chain release factor subunit 1 OS=Homo sapiens OX=9606 GN=ETF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	35-UNIMOD:267,48-UNIMOD:267	0.04	37.0	3	1	0
PRT	sp|Q9P2J5|SYLC_HUMAN	Leucine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=LARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	37.0	null	573-UNIMOD:4,575-UNIMOD:267	0.03	37.0	3	2	1
PRT	sp|Q13416|ORC2_HUMAN	Origin recognition complex subunit 2 OS=Homo sapiens OX=9606 GN=ORC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	37.0	null	235-UNIMOD:188,251-UNIMOD:188	0.03	37.0	3	1	0
PRT	sp|O43242|PSMD3_HUMAN	26S proteasome non-ATPase regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PSMD3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null		0.03	37.0	1	1	0
PRT	sp|Q14690|RRP5_HUMAN	Protein RRP5 homolog OS=Homo sapiens OX=9606 GN=PDCD11 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	764-UNIMOD:188,782-UNIMOD:188	0.01	36.0	1	1	1
PRT	sp|P62081|RS7_HUMAN	40S ribosomal protein S7 OS=Homo sapiens OX=9606 GN=RPS7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	169-UNIMOD:188,178-UNIMOD:188	0.10	36.0	4	1	0
PRT	sp|Q14258|TRI25_HUMAN	E3 ubiquitin/ISG15 ligase TRIM25 OS=Homo sapiens OX=9606 GN=TRIM25 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	107-UNIMOD:4,110-UNIMOD:4,112-UNIMOD:188,117-UNIMOD:188	0.04	36.0	2	1	0
PRT	sp|Q92616|GCN1_HUMAN	eIF-2-alpha kinase activator GCN1 OS=Homo sapiens OX=9606 GN=GCN1 PE=1 SV=6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.01	36.0	3	2	1
PRT	sp|Q8IU81|I2BP1_HUMAN	Interferon regulatory factor 2-binding protein 1 OS=Homo sapiens OX=9606 GN=IRF2BP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.04	36.0	2	1	0
PRT	sp|P31946-2|1433B_HUMAN	Isoform Short of 14-3-3 protein beta/alpha OS=Homo sapiens OX=9606 GN=YWHAB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	41-UNIMOD:267,49-UNIMOD:188	0.09	36.0	3	1	0
PRT	sp|O15143|ARC1B_HUMAN	Actin-related protein 2/3 complex subunit 1B OS=Homo sapiens OX=9606 GN=ARPC1B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	2-UNIMOD:1,13-UNIMOD:4,18-UNIMOD:188	0.13	36.0	5	2	1
PRT	sp|Q9NQ50|RM40_HUMAN	39S ribosomal protein L40, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL40 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	191-UNIMOD:267	0.09	36.0	2	1	0
PRT	sp|Q8WUM0|NU133_HUMAN	Nuclear pore complex protein Nup133 OS=Homo sapiens OX=9606 GN=NUP133 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	1016-UNIMOD:188	0.01	36.0	3	1	0
PRT	sp|P21333-2|FLNA_HUMAN	Isoform 2 of Filamin-A OS=Homo sapiens OX=9606 GN=FLNA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	2325-UNIMOD:267,1943-UNIMOD:267,936-UNIMOD:188,301-UNIMOD:267,309-UNIMOD:267,2006-UNIMOD:188	0.03	36.0	10	6	3
PRT	sp|O00515|LAD1_HUMAN	Ladinin-1 OS=Homo sapiens OX=9606 GN=LAD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	428-UNIMOD:4	0.07	36.0	2	2	2
PRT	sp|Q8WUX1|S38A5_HUMAN	Sodium-coupled neutral amino acid transporter 5 OS=Homo sapiens OX=9606 GN=SLC38A5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	37-UNIMOD:188,47-UNIMOD:188	0.04	36.0	2	1	0
PRT	sp|Q13895|BYST_HUMAN	Bystin OS=Homo sapiens OX=9606 GN=BYSL PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	30-UNIMOD:267	0.04	36.0	2	1	0
PRT	sp|Q96TA1-2|NIBA2_HUMAN	Isoform 2 of Protein Niban 2 OS=Homo sapiens OX=9606 GN=NIBAN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	48-UNIMOD:267,692-UNIMOD:188,303-UNIMOD:188,309-UNIMOD:188	0.08	36.0	4	3	2
PRT	sp|Q9NXC5-2|MIO_HUMAN	Isoform 2 of GATOR complex protein MIOS OS=Homo sapiens OX=9606 GN=MIOS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	377-UNIMOD:4	0.04	36.0	1	1	1
PRT	sp|O43143|DHX15_HUMAN	Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 OS=Homo sapiens OX=9606 GN=DHX15 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	166-UNIMOD:188	0.03	36.0	3	2	1
PRT	sp|P05455|LA_HUMAN	Lupus La protein OS=Homo sapiens OX=9606 GN=SSB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	18-UNIMOD:4,32-UNIMOD:267	0.04	36.0	4	1	0
PRT	sp|Q9NQG5|RPR1B_HUMAN	Regulation of nuclear pre-mRNA domain-containing protein 1B OS=Homo sapiens OX=9606 GN=RPRD1B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	56-UNIMOD:188,71-UNIMOD:188	0.05	36.0	4	1	0
PRT	sp|P09874|PARP1_HUMAN	Poly [ADP-ribose] polymerase 1 OS=Homo sapiens OX=9606 GN=PARP1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	748-UNIMOD:188,761-UNIMOD:188,548-UNIMOD:188	0.04	36.0	4	2	0
PRT	sp|Q9NVI7|ATD3A_HUMAN	ATPase family AAA domain-containing protein 3A OS=Homo sapiens OX=9606 GN=ATAD3A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	358-UNIMOD:267,375-UNIMOD:267	0.03	36.0	2	1	0
PRT	sp|O43148|MCES_HUMAN	mRNA cap guanine-N7 methyltransferase OS=Homo sapiens OX=9606 GN=RNMT PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	433-UNIMOD:188,442-UNIMOD:188	0.03	36.0	2	1	0
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	313-UNIMOD:35,315-UNIMOD:188,326-UNIMOD:188,113-UNIMOD:188,47-UNIMOD:35,44-UNIMOD:35,50-UNIMOD:188	0.12	36.0	8	3	1
PRT	sp|Q9H9J2|RM44_HUMAN	39S ribosomal protein L44, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL44 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	167-UNIMOD:4,171-UNIMOD:267	0.05	36.0	2	1	0
PRT	sp|P46060|RAGP1_HUMAN	Ran GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RANGAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	191-UNIMOD:267,205-UNIMOD:267	0.09	36.0	4	2	1
PRT	sp|P47756-2|CAPZB_HUMAN	Isoform 2 of F-actin-capping protein subunit beta OS=Homo sapiens OX=9606 GN=CAPZB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	88-UNIMOD:35	0.08	36.0	4	1	0
PRT	sp|Q14166|TTL12_HUMAN	Tubulin--tyrosine ligase-like protein 12 OS=Homo sapiens OX=9606 GN=TTLL12 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	40-UNIMOD:267,563-UNIMOD:4,572-UNIMOD:4	0.11	36.0	4	3	2
PRT	sp|Q8N3E9|PLCD3_HUMAN	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3 OS=Homo sapiens OX=9606 GN=PLCD3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	553-UNIMOD:4,561-UNIMOD:267	0.03	36.0	1	1	1
PRT	sp|Q9UBV2-2|SE1L1_HUMAN	Isoform 2 of Protein sel-1 homolog 1 OS=Homo sapiens OX=9606 GN=SEL1L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.06	36.0	1	1	1
PRT	sp|O00571-2|DDX3X_HUMAN	Isoform 2 of ATP-dependent RNA helicase DDX3X OS=Homo sapiens OX=9606 GN=DDX3X	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	280-UNIMOD:267,282-UNIMOD:4,295-UNIMOD:267	0.05	36.0	5	2	1
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	36.0	null	387-UNIMOD:188,389-UNIMOD:188,301-UNIMOD:188,309-UNIMOD:267	0.09	36.0	5	3	2
PRT	sp|Q86V81|THOC4_HUMAN	THO complex subunit 4 OS=Homo sapiens OX=9606 GN=ALYREF PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	36.0	null	82-UNIMOD:28,155-UNIMOD:267	0.15	36.0	3	2	1
PRT	sp|P37837|TALDO_HUMAN	Transaldolase OS=Homo sapiens OX=9606 GN=TALDO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	286-UNIMOD:188,292-UNIMOD:188	0.05	35.0	2	1	0
PRT	sp|P17987|TCPA_HUMAN	T-complex protein 1 subunit alpha OS=Homo sapiens OX=9606 GN=TCP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	35.0	null	541-UNIMOD:188,110-UNIMOD:28,111-UNIMOD:188,122-UNIMOD:267	0.08	35.0	5	4	3
PRT	sp|P63096-2|GNAI1_HUMAN	Isoform 2 of Guanine nucleotide-binding protein G(i) subunit alpha-1 OS=Homo sapiens OX=9606 GN=GNAI1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	273-UNIMOD:4,265-UNIMOD:188,278-UNIMOD:188	0.06	35.0	2	1	0
PRT	sp|Q9NTJ5-2|SAC1_HUMAN	Isoform 2 of Phosphatidylinositide phosphatase SAC1 OS=Homo sapiens OX=9606 GN=SACM1L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	189-UNIMOD:188	0.05	35.0	1	1	1
PRT	sp|P98172|EFNB1_HUMAN	Ephrin-B1 OS=Homo sapiens OX=9606 GN=EFNB1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	208-UNIMOD:188,217-UNIMOD:188	0.05	35.0	1	1	1
PRT	sp|Q96EK5|KBP_HUMAN	KIF-binding protein OS=Homo sapiens OX=9606 GN=KIFBP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	272-UNIMOD:4,285-UNIMOD:188	0.03	35.0	2	1	0
PRT	sp|Q58FF8|H90B2_HUMAN	Putative heat shock protein HSP 90-beta 2 OS=Homo sapiens OX=9606 GN=HSP90AB2P PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null	141-UNIMOD:188	0.04	35.0	3	1	0
PRT	sp|P30101|PDIA3_HUMAN	Protein disulfide-isomerase A3 OS=Homo sapiens OX=9606 GN=PDIA3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	107-UNIMOD:267,119-UNIMOD:267,62-UNIMOD:267,73-UNIMOD:267	0.08	35.0	5	3	1
PRT	sp|P02545-5|LMNA_HUMAN	Isoform 5 of Prelamin-A/C OS=Homo sapiens OX=9606 GN=LMNA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	199-UNIMOD:267,212-UNIMOD:188,67-UNIMOD:267,36-UNIMOD:188,45-UNIMOD:188,222-UNIMOD:267,230-UNIMOD:267	0.12	35.0	8	5	2
PRT	sp|P27708|PYR1_HUMAN	CAD protein OS=Homo sapiens OX=9606 GN=CAD PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	1889-UNIMOD:4,2036-UNIMOD:188	0.02	35.0	2	2	2
PRT	sp|O60832-2|DKC1_HUMAN	Isoform 3 of H/ACA ribonucleoprotein complex subunit DKC1 OS=Homo sapiens OX=9606 GN=DKC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	171-UNIMOD:267	0.03	35.0	3	1	0
PRT	sp|Q92841-1|DDX17_HUMAN	Isoform 2 of Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens OX=9606 GN=DDX17	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	338-UNIMOD:188,341-UNIMOD:188	0.02	35.0	3	1	0
PRT	sp|Q9Y266|NUDC_HUMAN	Nuclear migration protein nudC OS=Homo sapiens OX=9606 GN=NUDC PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.05	35.0	2	1	0
PRT	sp|P62829|RL23_HUMAN	60S ribosomal protein L23 OS=Homo sapiens OX=9606 GN=RPL23 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	51-UNIMOD:267,66-UNIMOD:188	0.14	35.0	3	1	0
PRT	sp|Q14240|IF4A2_HUMAN	Eukaryotic initiation factor 4A-II OS=Homo sapiens OX=9606 GN=EIF4A2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	162-UNIMOD:267	0.04	35.0	2	1	0
PRT	sp|Q9NYF8-4|BCLF1_HUMAN	Isoform 4 of Bcl-2-associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	378-UNIMOD:35	0.02	35.0	1	1	1
PRT	sp|P53004|BIEA_HUMAN	Biliverdin reductase A OS=Homo sapiens OX=9606 GN=BLVRA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	253-UNIMOD:188,261-UNIMOD:188,281-UNIMOD:4,290-UNIMOD:188	0.09	35.0	5	2	0
PRT	sp|P22314-2|UBA1_HUMAN	Isoform 2 of Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	430-UNIMOD:188,441-UNIMOD:4,445-UNIMOD:188,29-UNIMOD:267,41-UNIMOD:267	0.07	35.0	5	4	3
PRT	sp|Q92900-2|RENT1_HUMAN	Isoform 2 of Regulator of nonsense transcripts 1 OS=Homo sapiens OX=9606 GN=UPF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	664-UNIMOD:4,672-UNIMOD:4,673-UNIMOD:188,857-UNIMOD:267	0.05	35.0	5	3	2
PRT	sp|Q9BQ67|GRWD1_HUMAN	Glutamate-rich WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=GRWD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.04	35.0	1	1	1
PRT	sp|P20340-3|RAB6A_HUMAN	Isoform 3 of Ras-related protein Rab-6A OS=Homo sapiens OX=9606 GN=RAB6A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.15	35.0	1	1	1
PRT	sp|P78527-2|PRKDC_HUMAN	Isoform 2 of DNA-dependent protein kinase catalytic subunit OS=Homo sapiens OX=9606 GN=PRKDC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	25-UNIMOD:4,36-UNIMOD:267,478-UNIMOD:4,489-UNIMOD:267,2786-UNIMOD:188	0.01	35.0	6	4	2
PRT	sp|Q92973-3|TNPO1_HUMAN	Isoform 3 of Transportin-1 OS=Homo sapiens OX=9606 GN=TNPO1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	155-UNIMOD:4,163-UNIMOD:267	0.02	35.0	2	1	0
PRT	sp|Q9BRR6-6|ADPGK_HUMAN	Isoform 6 of ADP-dependent glucokinase OS=Homo sapiens OX=9606 GN=ADPGK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	40-UNIMOD:4,56-UNIMOD:267	0.31	35.0	2	1	0
PRT	sp|Q96JM3|CHAP1_HUMAN	Chromosome alignment-maintaining phosphoprotein 1 OS=Homo sapiens OX=9606 GN=CHAMP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	2	1	0
PRT	sp|P18669|PGAM1_HUMAN	Phosphoglycerate mutase 1 OS=Homo sapiens OX=9606 GN=PGAM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	138-UNIMOD:188,191-UNIMOD:267,21-UNIMOD:267	0.18	35.0	6	3	0
PRT	sp|Q9BUJ2-3|HNRL1_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 OS=Homo sapiens OX=9606 GN=HNRNPUL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	1	1	1
PRT	sp|Q9BRT6|LLPH_HUMAN	Protein LLP homolog OS=Homo sapiens OX=9606 GN=LLPH PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.13	35.0	1	1	1
PRT	sp|P01130-2|LDLR_HUMAN	Isoform 2 of Low-density lipoprotein receptor OS=Homo sapiens OX=9606 GN=LDLR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	661-UNIMOD:4,672-UNIMOD:267	0.03	35.0	3	1	0
PRT	sp|P49903-3|SPS1_HUMAN	Isoform 3 of Selenide, water dikinase 1 OS=Homo sapiens OX=9606 GN=SEPHS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	292-UNIMOD:188,231-UNIMOD:188	0.10	35.0	3	2	1
PRT	sp|Q15149|PLEC_HUMAN	Plectin OS=Homo sapiens OX=9606 GN=PLEC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	null	3336-UNIMOD:385,3336-UNIMOD:4,3337-UNIMOD:267,3352-UNIMOD:188	0.00	35.0	2	1	0
PRT	sp|Q09666|AHNK_HUMAN	Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	35.0	null	2780-UNIMOD:188,2792-UNIMOD:188,887-UNIMOD:35,891-UNIMOD:188,903-UNIMOD:188,371-UNIMOD:188,387-UNIMOD:188,763-UNIMOD:188,775-UNIMOD:188,3164-UNIMOD:188,3176-UNIMOD:188,1136-UNIMOD:35,1140-UNIMOD:188,1152-UNIMOD:188,1067-UNIMOD:35,1077-UNIMOD:188,1080-UNIMOD:188,2253-UNIMOD:35,2269-UNIMOD:188,5103-UNIMOD:188,5112-UNIMOD:188,4395-UNIMOD:188,4398-UNIMOD:188,2396-UNIMOD:188,2194-UNIMOD:188,2197-UNIMOD:188	0.06	35.0	17	12	9
PRT	sp|O94832|MYO1D_HUMAN	Unconventional myosin-Id OS=Homo sapiens OX=9606 GN=MYO1D PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	35.0	null	620-UNIMOD:267	0.01	35.0	2	1	0
PRT	sp|P05198|IF2A_HUMAN	Eukaryotic translation initiation factor 2 subunit 1 OS=Homo sapiens OX=9606 GN=EIF2S1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	218-UNIMOD:4	0.07	34.0	2	1	0
PRT	sp|Q9H583|HEAT1_HUMAN	HEAT repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=HEATR1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.01	34.0	1	1	1
PRT	sp|Q969G3-6|SMCE1_HUMAN	Isoform 6 of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 OS=Homo sapiens OX=9606 GN=SMARCE1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.05	34.0	1	1	1
PRT	sp|O75369-7|FLNB_HUMAN	Isoform 7 of Filamin-B OS=Homo sapiens OX=9606 GN=FLNB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	1908-UNIMOD:188,2109-UNIMOD:267,2121-UNIMOD:188	0.02	34.0	4	3	2
PRT	sp|B2RPK0|HGB1A_HUMAN	Putative high mobility group protein B1-like 1 OS=Homo sapiens OX=9606 GN=HMGB1P1 PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	23-UNIMOD:4	0.07	34.0	1	1	1
PRT	sp|Q6UW68|TM205_HUMAN	Transmembrane protein 205 OS=Homo sapiens OX=9606 GN=TMEM205 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	141-UNIMOD:267	0.10	34.0	2	1	0
PRT	sp|Q86W92-4|LIPB1_HUMAN	Isoform 4 of Liprin-beta-1 OS=Homo sapiens OX=9606 GN=PPFIBP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	1	1	1
PRT	sp|Q9Y5M8|SRPRB_HUMAN	Signal recognition particle receptor subunit beta OS=Homo sapiens OX=9606 GN=SRPRB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	125-UNIMOD:267	0.06	34.0	2	1	0
PRT	sp|P17858|PFKAL_HUMAN	ATP-dependent 6-phosphofructokinase, liver type OS=Homo sapiens OX=9606 GN=PFKL PE=1 SV=6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	461-UNIMOD:267	0.02	34.0	2	1	0
PRT	sp|Q14653|IRF3_HUMAN	Interferon regulatory factor 3 OS=Homo sapiens OX=9606 GN=IRF3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	213-UNIMOD:267,222-UNIMOD:4,227-UNIMOD:267	0.04	34.0	2	1	0
PRT	sp|P11166|GTR1_HUMAN	Solute carrier family 2, facilitated glucose transporter member 1 OS=Homo sapiens OX=9606 GN=SLC2A1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null	244-UNIMOD:35,245-UNIMOD:188,249-UNIMOD:267	0.04	34.0	4	1	0
PRT	sp|P0DPI2-2|GAL3A_HUMAN	Isoform 2 of Glutamine amidotransferase-like class 1 domain-containing protein 3A, mitochondrial OS=Homo sapiens OX=9606 GN=GATD3A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	172-UNIMOD:188,183-UNIMOD:188	0.11	34.0	3	1	0
PRT	sp|P50454|SERPH_HUMAN	Serpin H1 OS=Homo sapiens OX=9606 GN=SERPINH1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	332-UNIMOD:188	0.03	34.0	1	1	1
PRT	sp|P04181-2|OAT_HUMAN	Isoform 2 of Ornithine aminotransferase, mitochondrial OS=Homo sapiens OX=9606 GN=OAT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	133-UNIMOD:267	0.06	34.0	1	1	1
PRT	sp|Q9Y285-2|SYFA_HUMAN	Isoform 2 of Phenylalanine--tRNA ligase alpha subunit OS=Homo sapiens OX=9606 GN=FARSA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	72-UNIMOD:267	0.03	34.0	1	1	1
PRT	sp|Q14684-2|RRP1B_HUMAN	Isoform 2 of Ribosomal RNA processing protein 1 homolog B OS=Homo sapiens OX=9606 GN=RRP1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	556-UNIMOD:188,565-UNIMOD:4,571-UNIMOD:188,610-UNIMOD:4	0.09	34.0	3	3	3
PRT	sp|Q9NR19|ACSA_HUMAN	Acetyl-coenzyme A synthetase, cytoplasmic OS=Homo sapiens OX=9606 GN=ACSS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	554-UNIMOD:4	0.02	34.0	1	1	1
PRT	sp|P48723|HSP13_HUMAN	Heat shock 70 kDa protein 13 OS=Homo sapiens OX=9606 GN=HSPA13 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null	368-UNIMOD:188,380-UNIMOD:188	0.03	34.0	2	1	0
PRT	sp|Q9BX66-4|SRBS1_HUMAN	Isoform 4 of Sorbin and SH3 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SORBS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	510-UNIMOD:188,525-UNIMOD:188	0.02	34.0	1	1	1
PRT	sp|Q9BZF1-3|OSBL8_HUMAN	Isoform 3 of Oxysterol-binding protein-related protein 8 OS=Homo sapiens OX=9606 GN=OSBPL8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	702-UNIMOD:188	0.02	34.0	2	1	0
PRT	sp|Q6DKJ4|NXN_HUMAN	Nucleoredoxin OS=Homo sapiens OX=9606 GN=NXN PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	61-UNIMOD:267,83-UNIMOD:267	0.06	34.0	2	1	0
PRT	sp|P33993|MCM7_HUMAN	DNA replication licensing factor MCM7 OS=Homo sapiens OX=9606 GN=MCM7 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	237-UNIMOD:35,251-UNIMOD:267	0.06	34.0	3	3	3
PRT	sp|P06748|NPM_HUMAN	Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	278-UNIMOD:35	0.05	34.0	1	1	1
PRT	sp|P31930|QCR1_HUMAN	Cytochrome b-c1 complex subunit 1, mitochondrial OS=Homo sapiens OX=9606 GN=UQCRC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	229-UNIMOD:35,248-UNIMOD:188	0.04	34.0	2	1	0
PRT	sp|Q9H0S4|DDX47_HUMAN	Probable ATP-dependent RNA helicase DDX47 OS=Homo sapiens OX=9606 GN=DDX47 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	301-UNIMOD:188	0.08	34.0	2	2	2
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	154-UNIMOD:35,503-UNIMOD:267	0.03	34.0	4	2	0
PRT	sp|P84103-2|SRSF3_HUMAN	Isoform 2 of Serine/arginine-rich splicing factor 3 OS=Homo sapiens OX=9606 GN=SRSF3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	57-UNIMOD:267,64-UNIMOD:267	0.18	34.0	1	1	1
PRT	sp|P23368-2|MAOM_HUMAN	Isoform 2 of NAD-dependent malic enzyme, mitochondrial OS=Homo sapiens OX=9606 GN=ME2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	264-UNIMOD:267	0.04	34.0	2	1	0
PRT	sp|Q9BTU6|P4K2A_HUMAN	Phosphatidylinositol 4-kinase type 2-alpha OS=Homo sapiens OX=9606 GN=PI4K2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null	276-UNIMOD:267,288-UNIMOD:267	0.03	34.0	3	1	0
PRT	sp|Q15046|SYK_HUMAN	Lysine--tRNA ligase OS=Homo sapiens OX=9606 GN=KARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.04	34.0	3	2	1
PRT	sp|Q13451|FKBP5_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Homo sapiens OX=9606 GN=FKBP5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.04	34.0	1	1	1
PRT	sp|Q15393|SF3B3_HUMAN	Splicing factor 3B subunit 3 OS=Homo sapiens OX=9606 GN=SF3B3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.01	34.0	1	1	1
PRT	sp|P07384|CAN1_HUMAN	Calpain-1 catalytic subunit OS=Homo sapiens OX=9606 GN=CAPN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	2	1	0
PRT	sp|P26368-2|U2AF2_HUMAN	Isoform 2 of Splicing factor U2AF 65 kDa subunit OS=Homo sapiens OX=9606 GN=U2AF2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	425-UNIMOD:4	0.04	34.0	1	1	1
PRT	sp|P30405-2|PPIF_HUMAN	Isoform 2 of Peptidyl-prolyl cis-trans isomerase F, mitochondrial OS=Homo sapiens OX=9606 GN=PPIF	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.10	34.0	1	1	1
PRT	sp|Q53GQ0|DHB12_HUMAN	Very-long-chain 3-oxoacyl-CoA reductase OS=Homo sapiens OX=9606 GN=HSD17B12 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	223-UNIMOD:188,238-UNIMOD:188	0.06	34.0	3	1	0
PRT	sp|Q02952-3|AKA12_HUMAN	Isoform 3 of A-kinase anchor protein 12 OS=Homo sapiens OX=9606 GN=AKAP12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	1355-UNIMOD:188,1374-UNIMOD:4,1377-UNIMOD:188	0.02	34.0	2	1	0
PRT	sp|P55265-5|DSRAD_HUMAN	Isoform 5 of Double-stranded RNA-specific adenosine deaminase OS=Homo sapiens OX=9606 GN=ADAR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	783-UNIMOD:267	0.03	34.0	3	2	1
PRT	sp|P55735-2|SEC13_HUMAN	Isoform 2 of Protein SEC13 homolog OS=Homo sapiens OX=9606 GN=SEC13	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.05	34.0	1	1	1
PRT	sp|P23284|PPIB_HUMAN	Peptidyl-prolyl cis-trans isomerase B OS=Homo sapiens OX=9606 GN=PPIB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.07	34.0	1	1	1
PRT	sp|P35579|MYH9_HUMAN	Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	34.0	null	387-UNIMOD:267,1352-UNIMOD:188,1357-UNIMOD:188,355-UNIMOD:188,356-UNIMOD:188,719-UNIMOD:28	0.05	34.0	10	6	2
PRT	sp|P46108-2|CRK_HUMAN	Isoform Crk-I of Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	191-UNIMOD:267,204-UNIMOD:267	0.15	34.0	3	2	1
PRT	sp|Q9P0M6|H2AW_HUMAN	Core histone macro-H2A.2 OS=Homo sapiens OX=9606 GN=H2AFY2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null		0.06	34.0	1	1	1
PRT	sp|P08579|RU2B_HUMAN	U2 small nuclear ribonucleoprotein B'' OS=Homo sapiens OX=9606 GN=SNRPB2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	34.0	null	57-UNIMOD:188,67-UNIMOD:267	0.08	34.0	3	1	0
PRT	sp|P14866-2|HNRPL_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein L OS=Homo sapiens OX=9606 GN=HNRNPL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	315-UNIMOD:188	0.03	33.0	2	1	0
PRT	sp|P62888|RL30_HUMAN	60S ribosomal protein L30 OS=Homo sapiens OX=9606 GN=RPL30 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	52-UNIMOD:4	0.13	33.0	1	1	1
PRT	sp|Q9NUQ9|FA49B_HUMAN	Protein FAM49B OS=Homo sapiens OX=9606 GN=FAM49B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.05	33.0	1	1	1
PRT	sp|Q9H078-5|CLPB_HUMAN	Isoform 5 of Caseinolytic peptidase B protein homolog OS=Homo sapiens OX=9606 GN=CLPB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	240-UNIMOD:188	0.04	33.0	2	1	0
PRT	sp|Q13151|ROA0_HUMAN	Heterogeneous nuclear ribonucleoprotein A0 OS=Homo sapiens OX=9606 GN=HNRNPA0 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.05	33.0	1	1	1
PRT	sp|O15066|KIF3B_HUMAN	Kinesin-like protein KIF3B OS=Homo sapiens OX=9606 GN=KIF3B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	596-UNIMOD:188	0.02	33.0	1	1	1
PRT	sp|Q8WX92|NELFB_HUMAN	Negative elongation factor B OS=Homo sapiens OX=9606 GN=NELFB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	1	1	1
PRT	sp|P25786|PSA1_HUMAN	Proteasome subunit alpha type-1 OS=Homo sapiens OX=9606 GN=PSMA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	182-UNIMOD:4,189-UNIMOD:188	0.06	33.0	1	1	1
PRT	sp|Q8N5K1|CISD2_HUMAN	CDGSH iron-sulfur domain-containing protein 2 OS=Homo sapiens OX=9606 GN=CISD2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	131-UNIMOD:188	0.12	33.0	2	1	0
PRT	sp|P30837|AL1B1_HUMAN	Aldehyde dehydrogenase X, mitochondrial OS=Homo sapiens OX=9606 GN=ALDH1B1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	414-UNIMOD:188,426-UNIMOD:188	0.03	33.0	2	1	0
PRT	sp|P19174-2|PLCG1_HUMAN	Isoform 2 of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 OS=Homo sapiens OX=9606 GN=PLCG1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	1	1	1
PRT	sp|Q9NYL9|TMOD3_HUMAN	Tropomodulin-3 OS=Homo sapiens OX=9606 GN=TMOD3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.06	33.0	1	1	1
PRT	sp|P26885|FKBP2_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP2 OS=Homo sapiens OX=9606 GN=FKBP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.10	33.0	1	1	1
PRT	sp|P51116|FXR2_HUMAN	Fragile X mental retardation syndrome-related protein 2 OS=Homo sapiens OX=9606 GN=FXR2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null	270-UNIMOD:4,256-UNIMOD:188,273-UNIMOD:267	0.03	33.0	2	1	0
PRT	sp|Q9Y2X3|NOP58_HUMAN	Nucleolar protein 58 OS=Homo sapiens OX=9606 GN=NOP58 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	106-UNIMOD:4	0.03	33.0	1	1	1
PRT	sp|Q9H0U4|RAB1B_HUMAN	Ras-related protein Rab-1B OS=Homo sapiens OX=9606 GN=RAB1B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	173-UNIMOD:35	0.08	33.0	2	1	0
PRT	sp|P51571|SSRD_HUMAN	Translocon-associated protein subunit delta OS=Homo sapiens OX=9606 GN=SSR4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.09	33.0	1	1	1
PRT	sp|Q8NC51-4|PAIRB_HUMAN	Isoform 4 of Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	11-UNIMOD:4	0.07	33.0	3	2	1
PRT	sp|Q00577|PURA_HUMAN	Transcriptional activator protein Pur-alpha OS=Homo sapiens OX=9606 GN=PURA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.09	33.0	1	1	1
PRT	sp|Q96C19|EFHD2_HUMAN	EF-hand domain-containing protein D2 OS=Homo sapiens OX=9606 GN=EFHD2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.07	33.0	1	1	1
PRT	sp|Q8IXI1-2|MIRO2_HUMAN	Isoform 2 of Mitochondrial Rho GTPase 2 OS=Homo sapiens OX=9606 GN=RHOT2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	89-UNIMOD:4,103-UNIMOD:188	0.08	33.0	3	1	0
PRT	sp|Q8N573-3|OXR1_HUMAN	Isoform 3 of Oxidation resistance protein 1 OS=Homo sapiens OX=9606 GN=OXR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	342-UNIMOD:4,344-UNIMOD:188	0.03	33.0	3	1	0
PRT	sp|Q9Y6D5|BIG2_HUMAN	Brefeldin A-inhibited guanine nucleotide-exchange protein 2 OS=Homo sapiens OX=9606 GN=ARFGEF2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null	560-UNIMOD:267	0.01	33.0	2	1	0
PRT	sp|Q9P258|RCC2_HUMAN	Protein RCC2 OS=Homo sapiens OX=9606 GN=RCC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null	337-UNIMOD:4	0.06	33.0	4	2	1
PRT	sp|P08670|VIME_HUMAN	Vimentin OS=Homo sapiens OX=9606 GN=VIM PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	145-UNIMOD:267,155-UNIMOD:267,450-UNIMOD:267	0.10	33.0	4	3	2
PRT	sp|Q7L2E3-3|DHX30_HUMAN	Isoform 3 of ATP-dependent RNA helicase DHX30 OS=Homo sapiens OX=9606 GN=DHX30	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.01	33.0	1	1	1
PRT	sp|P21796|VDAC1_HUMAN	Voltage-dependent anion-selective channel protein 1 OS=Homo sapiens OX=9606 GN=VDAC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.05	33.0	1	1	1
PRT	sp|Q99523-2|SORT_HUMAN	Isoform 2 of Sortilin OS=Homo sapiens OX=9606 GN=SORT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	681-UNIMOD:188	0.04	33.0	1	1	1
PRT	sp|P22314|UBA1_HUMAN	Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	null	469-UNIMOD:28,470-UNIMOD:188,481-UNIMOD:4,485-UNIMOD:188,58-UNIMOD:28,68-UNIMOD:188,69-UNIMOD:267	0.03	33.0	2	2	1
PRT	sp|P41091|IF2G_HUMAN	Eukaryotic translation initiation factor 2 subunit 3 OS=Homo sapiens OX=9606 GN=EIF2S3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	null	39-UNIMOD:28,54-UNIMOD:188	0.04	33.0	2	1	0
PRT	sp|P30566|PUR8_HUMAN	Adenylosuccinate lyase OS=Homo sapiens OX=9606 GN=ADSL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	170-UNIMOD:188	0.05	33.0	1	1	0
PRT	sp|P29803|ODPAT_HUMAN	Pyruvate dehydrogenase E1 component subunit alpha, testis-specific form, mitochondrial OS=Homo sapiens OX=9606 GN=PDHA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	39-UNIMOD:4	0.05	33.0	2	1	0
PRT	sp|P61247|RS3A_HUMAN	40S ribosomal protein S3a OS=Homo sapiens OX=9606 GN=RPS3A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	201-UNIMOD:4,213-UNIMOD:267,96-UNIMOD:4,107-UNIMOD:267,103-UNIMOD:35	0.11	32.0	6	2	0
PRT	sp|Q8IZP2|ST134_HUMAN	Putative protein FAM10A4 OS=Homo sapiens OX=9606 GN=ST13P4 PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.06	32.0	2	1	0
PRT	sp|P24752|THIL_HUMAN	Acetyl-CoA acetyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=ACAT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	196-UNIMOD:4,190-UNIMOD:188,202-UNIMOD:188	0.05	32.0	3	1	0
PRT	sp|Q9UNZ2-4|NSF1C_HUMAN	Isoform 2 of NSFL1 cofactor p47 OS=Homo sapiens OX=9606 GN=NSFL1C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	93-UNIMOD:267,101-UNIMOD:267	0.08	32.0	3	1	0
PRT	sp|Q9Y547|IFT25_HUMAN	Intraflagellar transport protein 25 homolog OS=Homo sapiens OX=9606 GN=HSPB11 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.18	32.0	1	1	1
PRT	sp|P11182|ODB2_HUMAN	Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial OS=Homo sapiens OX=9606 GN=DBT PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	243-UNIMOD:188,250-UNIMOD:188	0.04	32.0	2	1	0
PRT	sp|P13010|XRCC5_HUMAN	X-ray repair cross-complementing protein 5 OS=Homo sapiens OX=9606 GN=XRCC5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|Q9NX01|TXN4B_HUMAN	Thioredoxin-like protein 4B OS=Homo sapiens OX=9606 GN=TXNL4B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	38-UNIMOD:4	0.13	32.0	2	1	0
PRT	sp|Q14692|BMS1_HUMAN	Ribosome biogenesis protein BMS1 homolog OS=Homo sapiens OX=9606 GN=BMS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.01	32.0	1	1	1
PRT	sp|O43395|PRPF3_HUMAN	U4/U6 small nuclear ribonucleoprotein Prp3 OS=Homo sapiens OX=9606 GN=PRPF3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	65-UNIMOD:188,74-UNIMOD:267	0.02	32.0	3	1	0
PRT	sp|Q13813-3|SPTN1_HUMAN	Isoform 3 of Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	627-UNIMOD:267,2295-UNIMOD:267,862-UNIMOD:188,864-UNIMOD:188,336-UNIMOD:267,347-UNIMOD:267	0.03	32.0	6	5	4
PRT	sp|Q9H8S9-2|MOB1A_HUMAN	Isoform 2 of MOB kinase activator 1A OS=Homo sapiens OX=9606 GN=MOB1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	42-UNIMOD:267	0.09	32.0	2	1	0
PRT	sp|Q8NDD1-7|CA131_HUMAN	Isoform 4 of Uncharacterized protein C1orf131 OS=Homo sapiens OX=9606 GN=C1orf131	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	100-UNIMOD:4	0.15	32.0	1	1	1
PRT	sp|P00367-2|DHE3_HUMAN	Isoform 2 of Glutamate dehydrogenase 1, mitochondrial OS=Homo sapiens OX=9606 GN=GLUD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	329-UNIMOD:267	0.04	32.0	2	1	0
PRT	sp|O75955|FLOT1_HUMAN	Flotillin-1 OS=Homo sapiens OX=9606 GN=FLOT1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	72-UNIMOD:188	0.04	32.0	2	1	0
PRT	sp|P11387|TOP1_HUMAN	DNA topoisomerase 1 OS=Homo sapiens OX=9606 GN=TOP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	587-UNIMOD:188,386-UNIMOD:4	0.04	32.0	3	2	1
PRT	sp|Q9BT22|ALG1_HUMAN	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Homo sapiens OX=9606 GN=ALG1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	45-UNIMOD:267	0.03	32.0	2	1	0
PRT	sp|O43707|ACTN4_HUMAN	Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	499-UNIMOD:4,512-UNIMOD:267,193-UNIMOD:188	0.05	32.0	5	3	1
PRT	sp|P34931|HS71L_HUMAN	Heat shock 70 kDa protein 1-like OS=Homo sapiens OX=9606 GN=HSPA1L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	344-UNIMOD:267	0.02	32.0	2	1	0
PRT	sp|P53992-2|SC24C_HUMAN	Isoform 2 of Protein transport protein Sec24C OS=Homo sapiens OX=9606 GN=SEC24C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	79-UNIMOD:4,80-UNIMOD:4	0.05	32.0	1	1	1
PRT	sp|P05783|K1C18_HUMAN	Keratin, type I cytoskeletal 18 OS=Homo sapiens OX=9606 GN=KRT18 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	176-UNIMOD:28,186-UNIMOD:267,187-UNIMOD:188	0.07	32.0	4	2	0
PRT	sp|Q9BWH2|FUND2_HUMAN	FUN14 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=FUNDC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	68-UNIMOD:188,80-UNIMOD:188	0.07	32.0	2	1	0
PRT	sp|P26583|HMGB2_HUMAN	High mobility group protein B2 OS=Homo sapiens OX=9606 GN=HMGB2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	128-UNIMOD:188,139-UNIMOD:188,132-UNIMOD:35	0.06	32.0	3	1	0
PRT	sp|Q9Y4U1|MMAC_HUMAN	Methylmalonic aciduria and homocystinuria type C protein OS=Homo sapiens OX=9606 GN=MMACHC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.10	32.0	1	1	1
PRT	sp|P06733-2|ENOA_HUMAN	Isoform MBP-1 of Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	279-UNIMOD:267	0.09	32.0	4	2	0
PRT	sp|Q16891-3|MIC60_HUMAN	Isoform 3 of MICOS complex subunit MIC60 OS=Homo sapiens OX=9606 GN=IMMT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	311-UNIMOD:188	0.02	32.0	3	1	0
PRT	sp|P53618|COPB_HUMAN	Coatomer subunit beta OS=Homo sapiens OX=9606 GN=COPB1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	128-UNIMOD:188,141-UNIMOD:267	0.02	32.0	3	1	0
PRT	sp|P53621|COPA_HUMAN	Coatomer subunit alpha OS=Homo sapiens OX=9606 GN=COPA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.01	32.0	2	1	0
PRT	sp|Q96GD0|PLPP_HUMAN	Pyridoxal phosphate phosphatase OS=Homo sapiens OX=9606 GN=PDXP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.07	32.0	1	1	1
PRT	sp|Q9UJA5-3|TRM6_HUMAN	Isoform 3 of tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6 OS=Homo sapiens OX=9606 GN=TRMT6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	1-UNIMOD:1	0.05	32.0	2	1	0
PRT	sp|Q09161|NCBP1_HUMAN	Nuclear cap-binding protein subunit 1 OS=Homo sapiens OX=9606 GN=NCBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	291-UNIMOD:35,311-UNIMOD:267	0.03	32.0	3	1	0
PRT	sp|P05787|K2C8_HUMAN	Keratin, type II cytoskeletal 8 OS=Homo sapiens OX=9606 GN=KRT8 PE=1 SV=7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	122-UNIMOD:188,130-UNIMOD:188,225-UNIMOD:267,264-UNIMOD:188,370-UNIMOD:28,372-UNIMOD:267,381-UNIMOD:188	0.19	32.0	9	7	5
PRT	sp|Q9BZK3|NACP4_HUMAN	Putative nascent polypeptide-associated complex subunit alpha-like protein OS=Homo sapiens OX=9606 GN=NACA4P PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.07	32.0	2	1	0
PRT	sp|Q96C86|DCPS_HUMAN	m7GpppX diphosphatase OS=Homo sapiens OX=9606 GN=DCPS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	255-UNIMOD:267	0.04	32.0	2	1	0
PRT	sp|P15927|RFA2_HUMAN	Replication protein A 32 kDa subunit OS=Homo sapiens OX=9606 GN=RPA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	265-UNIMOD:188	0.09	32.0	2	1	0
PRT	sp|P62269|RS18_HUMAN	40S ribosomal protein S18 OS=Homo sapiens OX=9606 GN=RPS18 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.09	32.0	1	1	1
PRT	sp|O15027-2|SC16A_HUMAN	Isoform 2 of Protein transport protein Sec16A OS=Homo sapiens OX=9606 GN=SEC16A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	46-UNIMOD:4,34-UNIMOD:267,59-UNIMOD:267	0.01	32.0	2	1	0
PRT	sp|P36578|RL4_HUMAN	60S ribosomal protein L4 OS=Homo sapiens OX=9606 GN=RPL4 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	208-UNIMOD:4,205-UNIMOD:267,219-UNIMOD:188	0.06	32.0	5	2	1
PRT	sp|Q8NBJ7-2|SUMF2_HUMAN	Isoform 2 of Inactive C-alpha-formylglycine-generating enzyme 2 OS=Homo sapiens OX=9606 GN=SUMF2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	74-UNIMOD:267,86-UNIMOD:267	0.07	32.0	2	1	0
PRT	sp|P09327|VILI_HUMAN	Villin-1 OS=Homo sapiens OX=9606 GN=VIL1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	609-UNIMOD:267,620-UNIMOD:267	0.02	32.0	1	1	1
PRT	sp|O75533|SF3B1_HUMAN	Splicing factor 3B subunit 1 OS=Homo sapiens OX=9606 GN=SF3B1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	948-UNIMOD:267,957-UNIMOD:267	0.02	32.0	2	2	2
PRT	sp|P32320|CDD_HUMAN	Cytidine deaminase OS=Homo sapiens OX=9606 GN=CDA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	31-UNIMOD:4,48-UNIMOD:267	0.15	32.0	1	1	1
PRT	sp|P11171-6|41_HUMAN	Isoform 6 of Protein 4.1 OS=Homo sapiens OX=9606 GN=EPB41	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.06	32.0	2	2	2
PRT	sp|Q9NR31|SAR1A_HUMAN	GTP-binding protein SAR1a OS=Homo sapiens OX=9606 GN=SAR1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.08	32.0	1	1	1
PRT	sp|Q14683|SMC1A_HUMAN	Structural maintenance of chromosomes protein 1A OS=Homo sapiens OX=9606 GN=SMC1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.01	32.0	1	1	1
PRT	sp|P57740-2|NU107_HUMAN	Isoform 2 of Nuclear pore complex protein Nup107 OS=Homo sapiens OX=9606 GN=NUP107	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	49-UNIMOD:4	0.02	32.0	1	1	0
PRT	sp|Q3ZCQ8-2|TIM50_HUMAN	Isoform 2 of Mitochondrial import inner membrane translocase subunit TIM50 OS=Homo sapiens OX=9606 GN=TIMM50	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	135-UNIMOD:267,146-UNIMOD:267	0.06	32.0	3	2	1
PRT	sp|Q7L5N1|CSN6_HUMAN	COP9 signalosome complex subunit 6 OS=Homo sapiens OX=9606 GN=COPS6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.05	32.0	1	1	1
PRT	sp|Q8WY22|BRI3B_HUMAN	BRI3-binding protein OS=Homo sapiens OX=9606 GN=BRI3BP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.10	32.0	1	1	1
PRT	sp|O00178|GTPB1_HUMAN	GTP-binding protein 1 OS=Homo sapiens OX=9606 GN=GTPBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|P30044-2|PRDX5_HUMAN	Isoform Cytoplasmic+peroxisomal of Peroxiredoxin-5, mitochondrial OS=Homo sapiens OX=9606 GN=PRDX5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	64-UNIMOD:188	0.09	32.0	2	1	0
PRT	sp|Q9Y3Y2-4|CHTOP_HUMAN	Isoform 3 of Chromatin target of PRMT1 protein OS=Homo sapiens OX=9606 GN=CHTOP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.11	32.0	1	1	1
PRT	sp|Q14697|GANAB_HUMAN	Neutral alpha-glucosidase AB OS=Homo sapiens OX=9606 GN=GANAB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	502-UNIMOD:4,929-UNIMOD:267	0.05	32.0	3	2	1
PRT	sp|P11310|ACADM_HUMAN	Medium-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ACADM PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	281-UNIMOD:267,294-UNIMOD:267	0.04	32.0	2	1	0
PRT	sp|Q92667-2|AKAP1_HUMAN	Isoform 2 of A-kinase anchor protein 1, mitochondrial OS=Homo sapiens OX=9606 GN=AKAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	376-UNIMOD:4,389-UNIMOD:4,385-UNIMOD:188,395-UNIMOD:188	0.04	32.0	2	1	0
PRT	sp|Q7Z2W4-2|ZCCHV_HUMAN	Isoform 2 of Zinc finger CCCH-type antiviral protein 1 OS=Homo sapiens OX=9606 GN=ZC3HAV1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	513-UNIMOD:4,518-UNIMOD:4,519-UNIMOD:188	0.02	32.0	2	1	0
PRT	sp|P04406|G3P_HUMAN	Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	227-UNIMOD:188,234-UNIMOD:267,231-UNIMOD:35,247-UNIMOD:4,248-UNIMOD:267	0.15	32.0	6	3	1
PRT	sp|Q9BT73|PSMG3_HUMAN	Proteasome assembly chaperone 3 OS=Homo sapiens OX=9606 GN=PSMG3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	80-UNIMOD:188	0.13	32.0	3	1	0
PRT	sp|P07686|HEXB_HUMAN	Beta-hexosaminidase subunit beta OS=Homo sapiens OX=9606 GN=HEXB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null	300-UNIMOD:188	0.03	32.0	3	1	0
PRT	sp|Q9UDT6-2|CLIP2_HUMAN	Isoform 2 of CAP-Gly domain-containing linker protein 2 OS=Homo sapiens OX=9606 GN=CLIP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	132-UNIMOD:4,623-UNIMOD:35	0.03	32.0	2	2	2
PRT	sp|P12956|XRCC6_HUMAN	X-ray repair cross-complementing protein 6 OS=Homo sapiens OX=9606 GN=XRCC6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	565-UNIMOD:188,570-UNIMOD:188	0.05	32.0	3	2	1
PRT	sp|P14618|KPYM_HUMAN	Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	279-UNIMOD:267,294-UNIMOD:267	0.03	32.0	2	1	0
PRT	sp|P08559|ODPA_HUMAN	Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial OS=Homo sapiens OX=9606 GN=PDHA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	null	41-UNIMOD:385,41-UNIMOD:4,45-UNIMOD:267,58-UNIMOD:267	0.05	32.0	3	1	0
PRT	sp|Q9BSJ8|ESYT1_HUMAN	Extended synaptotagmin-1 OS=Homo sapiens OX=9606 GN=ESYT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	32.0	null		0.01	32.0	2	1	0
PRT	sp|P39687|AN32A_HUMAN	Acidic leucine-rich nuclear phosphoprotein 32 family member A OS=Homo sapiens OX=9606 GN=ANP32A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	32.0	null	87-UNIMOD:385,87-UNIMOD:4,99-UNIMOD:188	0.06	32.0	3	1	0
PRT	sp|Q9H089|LSG1_HUMAN	Large subunit GTPase 1 homolog OS=Homo sapiens OX=9606 GN=LSG1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	null	587-UNIMOD:28,594-UNIMOD:188,603-UNIMOD:267	0.03	32.0	3	1	0
PRT	sp|Q16763|UBE2S_HUMAN	Ubiquitin-conjugating enzyme E2 S OS=Homo sapiens OX=9606 GN=UBE2S PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null		0.07	32.0	1	1	1
PRT	sp|O95782-2|AP2A1_HUMAN	Isoform B of AP-2 complex subunit alpha-1 OS=Homo sapiens OX=9606 GN=AP2A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	331-UNIMOD:4,341-UNIMOD:267	0.01	31.0	2	1	0
PRT	sp|P09455-2|RET1_HUMAN	Isoform 2 of Retinol-binding protein 1 OS=Homo sapiens OX=9606 GN=RBP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	30-UNIMOD:267	0.14	31.0	1	1	1
PRT	sp|O15355|PPM1G_HUMAN	Protein phosphatase 1G OS=Homo sapiens OX=9606 GN=PPM1G PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	2	1	0
PRT	sp|Q8IVT2|MISP_HUMAN	Mitotic interactor and substrate of PLK1 OS=Homo sapiens OX=9606 GN=MISP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null	390-UNIMOD:267,391-UNIMOD:267	0.06	31.0	2	2	2
PRT	sp|P0CW19-2|LIMS3_HUMAN	Isoform 2 of LIM and senescent cell antigen-like-containing domain protein 3 OS=Homo sapiens OX=9606 GN=LIMS3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	8-UNIMOD:267,10-UNIMOD:4,20-UNIMOD:267,200-UNIMOD:4,212-UNIMOD:188	0.12	31.0	2	2	1
PRT	sp|Q9UBU9-2|NXF1_HUMAN	Isoform 2 of Nuclear RNA export factor 1 OS=Homo sapiens OX=9606 GN=NXF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	143-UNIMOD:4,158-UNIMOD:267	0.05	31.0	4	1	0
PRT	sp|Q13045-2|FLII_HUMAN	Isoform 2 of Protein flightless-1 homolog OS=Homo sapiens OX=9606 GN=FLII	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.01	31.0	2	1	0
PRT	sp|Q8NI27|THOC2_HUMAN	THO complex subunit 2 OS=Homo sapiens OX=9606 GN=THOC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.01	31.0	1	1	1
PRT	sp|Q99615-2|DNJC7_HUMAN	Isoform 2 of DnaJ homolog subfamily C member 7 OS=Homo sapiens OX=9606 GN=DNAJC7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	1	1	1
PRT	sp|P00338-5|LDHA_HUMAN	Isoform 5 of L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	73-UNIMOD:267,163-UNIMOD:4,157-UNIMOD:267,169-UNIMOD:267	0.12	31.0	5	2	0
PRT	sp|Q9Y5K6|CD2AP_HUMAN	CD2-associated protein OS=Homo sapiens OX=9606 GN=CD2AP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	221-UNIMOD:188,226-UNIMOD:188	0.02	31.0	2	1	0
PRT	sp|P53396-3|ACLY_HUMAN	Isoform 3 of ATP-citrate synthase OS=Homo sapiens OX=9606 GN=ACLY	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	362-UNIMOD:4,359-UNIMOD:188,364-UNIMOD:188,574-UNIMOD:4	0.04	31.0	3	2	1
PRT	sp|P50750|CDK9_HUMAN	Cyclin-dependent kinase 9 OS=Homo sapiens OX=9606 GN=CDK9 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	85-UNIMOD:4,86-UNIMOD:267	0.03	31.0	1	1	1
PRT	sp|P61158|ARP3_HUMAN	Actin-related protein 3 OS=Homo sapiens OX=9606 GN=ACTR3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	91-UNIMOD:267	0.06	31.0	3	2	1
PRT	sp|P22234|PUR6_HUMAN	Multifunctional protein ADE2 OS=Homo sapiens OX=9606 GN=PAICS PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	288-UNIMOD:4,295-UNIMOD:4	0.03	31.0	1	1	1
PRT	sp|P16403|H12_HUMAN	Histone H1.2 OS=Homo sapiens OX=9606 GN=H1-2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	34-UNIMOD:188,46-UNIMOD:188	0.07	31.0	2	1	0
PRT	sp|P35998-2|PRS7_HUMAN	Isoform 2 of 26S proteasome regulatory subunit 7 OS=Homo sapiens OX=9606 GN=PSMC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.04	31.0	1	1	1
PRT	sp|Q9BX40-2|LS14B_HUMAN	Isoform 2 of Protein LSM14 homolog B OS=Homo sapiens OX=9606 GN=LSM14B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	1	1	1
PRT	sp|Q9NRF8|PYRG2_HUMAN	CTP synthase 2 OS=Homo sapiens OX=9606 GN=CTPS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|P08574|CY1_HUMAN	Cytochrome c1, heme protein, mitochondrial OS=Homo sapiens OX=9606 GN=CYC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	219-UNIMOD:4,228-UNIMOD:267	0.13	31.0	3	2	1
PRT	sp|Q9NYU2-2|UGGG1_HUMAN	Isoform 2 of UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	415-UNIMOD:188	0.01	31.0	2	1	0
PRT	sp|P36776-3|LONM_HUMAN	Isoform 3 of Lon protease homolog, mitochondrial OS=Homo sapiens OX=9606 GN=LONP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	263-UNIMOD:267	0.02	31.0	4	1	0
PRT	sp|Q9BQ04|RBM4B_HUMAN	RNA-binding protein 4B OS=Homo sapiens OX=9606 GN=RBM4B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	89-UNIMOD:4,95-UNIMOD:267	0.05	31.0	2	1	0
PRT	sp|Q16658|FSCN1_HUMAN	Fascin OS=Homo sapiens OX=9606 GN=FSCN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	205-UNIMOD:267,217-UNIMOD:267	0.06	31.0	4	2	1
PRT	sp|P17931|LEG3_HUMAN	Galectin-3 OS=Homo sapiens OX=9606 GN=LGALS3 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	130-UNIMOD:35,187-UNIMOD:28,196-UNIMOD:188,199-UNIMOD:188	0.17	31.0	7	3	1
PRT	sp|O00410-2|IPO5_HUMAN	Isoform 2 of Importin-5 OS=Homo sapiens OX=9606 GN=IPO5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	116-UNIMOD:35,120-UNIMOD:4,130-UNIMOD:267	0.02	31.0	2	1	0
PRT	sp|P50990|TCPQ_HUMAN	T-complex protein 1 subunit theta OS=Homo sapiens OX=9606 GN=CCT8 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null	155-UNIMOD:267,165-UNIMOD:267	0.05	31.0	6	2	1
PRT	sp|P62314|SMD1_HUMAN	Small nuclear ribonucleoprotein Sm D1 OS=Homo sapiens OX=9606 GN=SNRPD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	50-UNIMOD:267,61-UNIMOD:267	0.12	31.0	2	1	0
PRT	sp|Q8WWI1-3|LMO7_HUMAN	Isoform 3 of LIM domain only protein 7 OS=Homo sapiens OX=9606 GN=LMO7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.01	31.0	2	1	0
PRT	sp|Q9UI10-3|EI2BD_HUMAN	Isoform 3 of Translation initiation factor eIF-2B subunit delta OS=Homo sapiens OX=9606 GN=EIF2B4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	142-UNIMOD:267,155-UNIMOD:267	0.03	31.0	4	1	0
PRT	sp|Q9UHD1|CHRD1_HUMAN	Cysteine and histidine-rich domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CHORDC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	59-UNIMOD:4	0.05	31.0	1	1	1
PRT	sp|Q9Y6N5|SQOR_HUMAN	Sulfide:quinone oxidoreductase, mitochondrial OS=Homo sapiens OX=9606 GN=SQOR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	337-UNIMOD:4	0.04	31.0	1	1	1
PRT	sp|P08559-3|ODPA_HUMAN	Isoform 3 of Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial OS=Homo sapiens OX=9606 GN=PDHA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.04	31.0	1	1	1
PRT	sp|P14174|MIF_HUMAN	Macrophage migration inhibitory factor OS=Homo sapiens OX=9606 GN=MIF PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	81-UNIMOD:4,78-UNIMOD:188,87-UNIMOD:267	0.12	31.0	2	1	0
PRT	sp|Q8TCS8|PNPT1_HUMAN	Polyribonucleotide nucleotidyltransferase 1, mitochondrial OS=Homo sapiens OX=9606 GN=PNPT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|P51149|RAB7A_HUMAN	Ras-related protein Rab-7a OS=Homo sapiens OX=9606 GN=RAB7A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	103-UNIMOD:267,113-UNIMOD:267	0.17	31.0	3	2	1
PRT	sp|P30533|AMRP_HUMAN	Alpha-2-macroglobulin receptor-associated protein OS=Homo sapiens OX=9606 GN=LRPAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.04	31.0	1	1	1
PRT	sp|Q9BXW7-2|HDHD5_HUMAN	Isoform 1 of Haloacid dehalogenase-like hydrolase domain-containing 5 OS=Homo sapiens OX=9606 GN=HDHD5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.05	31.0	1	1	1
PRT	sp|P55072|TERA_HUMAN	Transitional endoplasmic reticulum ATPase OS=Homo sapiens OX=9606 GN=VCP PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	105-UNIMOD:4	0.04	31.0	2	2	2
PRT	sp|P49711-2|CTCF_HUMAN	Isoform 2 of Transcriptional repressor CTCF OS=Homo sapiens OX=9606 GN=CTCF	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	229-UNIMOD:4	0.04	31.0	1	1	1
PRT	sp|P60709|ACTB_HUMAN	Actin, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=ACTB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	null	360-UNIMOD:28,372-UNIMOD:267,373-UNIMOD:188	0.04	31.0	2	1	0
PRT	sp|P48059-3|LIMS1_HUMAN	Isoform 3 of LIM and senescent cell antigen-like-containing domain protein 1 OS=Homo sapiens OX=9606 GN=LIMS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	null	200-UNIMOD:385,200-UNIMOD:4,212-UNIMOD:188	0.04	31.0	2	1	0
PRT	sp|Q9Y4P3|TBL2_HUMAN	Transducin beta-like protein 2 OS=Homo sapiens OX=9606 GN=TBL2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	325-UNIMOD:267,335-UNIMOD:4,336-UNIMOD:267	0.03	31.0	2	1	0
PRT	sp|P57081|WDR4_HUMAN	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit WDR4 OS=Homo sapiens OX=9606 GN=WDR4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	null	223-UNIMOD:28,226-UNIMOD:4,227-UNIMOD:4	0.05	31.0	1	1	1
PRT	sp|Q9BYD3|RM04_HUMAN	39S ribosomal protein L4, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.05	31.0	1	1	0
PRT	sp|Q9Y450|HBS1L_HUMAN	HBS1-like protein OS=Homo sapiens OX=9606 GN=HBS1L PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	469-UNIMOD:4	0.02	31.0	1	1	1
PRT	sp|Q9BWF3|RBM4_HUMAN	RNA-binding protein 4 OS=Homo sapiens OX=9606 GN=RBM4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	89-UNIMOD:4,95-UNIMOD:267	0.05	31.0	1	1	1
PRT	sp|A0FGR8-5|ESYT2_HUMAN	Isoform 5 of Extended synaptotagmin-2 OS=Homo sapiens OX=9606 GN=ESYT2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	142-UNIMOD:267	0.05	30.0	2	1	0
PRT	sp|P62917|RL8_HUMAN	60S ribosomal protein L8 OS=Homo sapiens OX=9606 GN=RPL8 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	144-UNIMOD:188,145-UNIMOD:188	0.07	30.0	2	1	0
PRT	sp|P30566-2|PUR8_HUMAN	Isoform 2 of Adenylosuccinate lyase OS=Homo sapiens OX=9606 GN=ADSL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	218-UNIMOD:188,224-UNIMOD:188	0.11	30.0	3	2	0
PRT	sp|P60903|S10AA_HUMAN	Protein S100-A10 OS=Homo sapiens OX=9606 GN=S100A10 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	47-UNIMOD:188,54-UNIMOD:188,23-UNIMOD:188,28-UNIMOD:188	0.30	30.0	2	2	2
PRT	sp|Q9Y5J7|TIM9_HUMAN	Mitochondrial import inner membrane translocase subunit Tim9 OS=Homo sapiens OX=9606 GN=TIMM9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	48-UNIMOD:4,52-UNIMOD:4,42-UNIMOD:188,55-UNIMOD:188	0.19	30.0	2	1	0
PRT	sp|Q9Y3B3-2|TMED7_HUMAN	Isoform 2 of Transmembrane emp24 domain-containing protein 7 OS=Homo sapiens OX=9606 GN=TMED7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	109-UNIMOD:4	0.07	30.0	1	1	1
PRT	sp|Q9GZQ8|MLP3B_HUMAN	Microtubule-associated proteins 1A/1B light chain 3B OS=Homo sapiens OX=9606 GN=MAP1LC3B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	65-UNIMOD:188	0.12	30.0	2	1	0
PRT	sp|A1L0T0|ILVBL_HUMAN	Acetolactate synthase-like protein OS=Homo sapiens OX=9606 GN=ILVBL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	173-UNIMOD:4	0.03	30.0	1	1	1
PRT	sp|P53597|SUCA_HUMAN	Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=SUCLG1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	105-UNIMOD:188,297-UNIMOD:35,308-UNIMOD:188	0.08	30.0	3	2	1
PRT	sp|P18206-2|VINC_HUMAN	Isoform 1 of Vinculin OS=Homo sapiens OX=9606 GN=VCL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	2	2	2
PRT	sp|P07900-2|HS90A_HUMAN	Isoform 2 of Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	346-UNIMOD:188,621-UNIMOD:188,578-UNIMOD:267	0.04	30.0	8	3	0
PRT	sp|P27816-4|MAP4_HUMAN	Isoform 4 of Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	748-UNIMOD:188	0.02	30.0	2	1	0
PRT	sp|P62805|H4_HUMAN	Histone H4 OS=Homo sapiens OX=9606 GN=H4C1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	46-UNIMOD:267,56-UNIMOD:267	0.16	30.0	3	2	1
PRT	sp|O95336|6PGL_HUMAN	6-phosphogluconolactonase OS=Homo sapiens OX=9606 GN=PGLS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.06	30.0	1	1	1
PRT	sp|O75319-2|DUS11_HUMAN	Isoform 2 of RNA/RNP complex-1-interacting phosphatase OS=Homo sapiens OX=9606 GN=DUSP11	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	111-UNIMOD:188,117-UNIMOD:4,126-UNIMOD:188	0.06	30.0	1	1	1
PRT	sp|P23193|TCEA1_HUMAN	Transcription elongation factor A protein 1 OS=Homo sapiens OX=9606 GN=TCEA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	212-UNIMOD:4	0.05	30.0	1	1	1
PRT	sp|Q9NWT1|PK1IP_HUMAN	p21-activated protein kinase-interacting protein 1 OS=Homo sapiens OX=9606 GN=PAK1IP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	288-UNIMOD:4	0.04	30.0	1	1	1
PRT	sp|Q96PZ0|PUS7_HUMAN	Pseudouridylate synthase 7 homolog OS=Homo sapiens OX=9606 GN=PUS7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	350-UNIMOD:267	0.02	30.0	1	1	1
PRT	sp|Q9BRD0-2|BUD13_HUMAN	Isoform 2 of BUD13 homolog OS=Homo sapiens OX=9606 GN=BUD13	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	1	1	1
PRT	sp|P20042|IF2B_HUMAN	Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	302-UNIMOD:4,305-UNIMOD:4,308-UNIMOD:267	0.04	30.0	2	1	0
PRT	sp|Q9BY44-4|EIF2A_HUMAN	Isoform 4 of Eukaryotic translation initiation factor 2A OS=Homo sapiens OX=9606 GN=EIF2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	155-UNIMOD:188	0.03	30.0	1	1	1
PRT	sp|P11413|G6PD_HUMAN	Glucose-6-phosphate 1-dehydrogenase OS=Homo sapiens OX=9606 GN=G6PD PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	158-UNIMOD:4	0.03	30.0	1	1	1
PRT	sp|P48735-2|IDHP_HUMAN	Isoform 2 of Isocitrate dehydrogenase [NADP], mitochondrial OS=Homo sapiens OX=9606 GN=IDH2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	102-UNIMOD:4	0.04	30.0	1	1	1
PRT	sp|Q92614-3|MY18A_HUMAN	Isoform 3 of Unconventional myosin-XVIIIa OS=Homo sapiens OX=9606 GN=MYO18A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|P51659-3|DHB4_HUMAN	Isoform 3 of Peroxisomal multifunctional enzyme type 2 OS=Homo sapiens OX=9606 GN=HSD17B4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	525-UNIMOD:267,537-UNIMOD:267	0.02	30.0	2	1	0
PRT	sp|P52732|KIF11_HUMAN	Kinesin-like protein KIF11 OS=Homo sapiens OX=9606 GN=KIF11 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	1034-UNIMOD:188,1045-UNIMOD:188	0.03	30.0	3	2	1
PRT	sp|Q14566|MCM6_HUMAN	DNA replication licensing factor MCM6 OS=Homo sapiens OX=9606 GN=MCM6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	55-UNIMOD:267,58-UNIMOD:267	0.04	30.0	2	2	2
PRT	sp|P55039|DRG2_HUMAN	Developmentally-regulated GTP-binding protein 2 OS=Homo sapiens OX=9606 GN=DRG2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.04	30.0	1	1	1
PRT	sp|Q13428-8|TCOF_HUMAN	Isoform 8 of Treacle protein OS=Homo sapiens OX=9606 GN=TCOF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	430-UNIMOD:188,442-UNIMOD:188	0.01	30.0	2	1	0
PRT	sp|Q02218-2|ODO1_HUMAN	Isoform 2 of 2-oxoglutarate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=OGDH	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	879-UNIMOD:267	0.01	30.0	2	1	0
PRT	sp|Q5JRX3-3|PREP_HUMAN	Isoform 3 of Presequence protease, mitochondrial OS=Homo sapiens OX=9606 GN=PITRM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|Q9Y6B6|SAR1B_HUMAN	GTP-binding protein SAR1b OS=Homo sapiens OX=9606 GN=SAR1B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	27-UNIMOD:188,38-UNIMOD:188	0.08	30.0	2	1	0
PRT	sp|Q15257-4|PTPA_HUMAN	Isoform 4 of Serine/threonine-protein phosphatase 2A activator OS=Homo sapiens OX=9606 GN=PTPA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	244-UNIMOD:188	0.08	30.0	2	1	0
PRT	sp|O60313-13|OPA1_HUMAN	Isoform 7 of Dynamin-like 120 kDa protein, mitochondrial OS=Homo sapiens OX=9606 GN=OPA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	750-UNIMOD:4,756-UNIMOD:188,761-UNIMOD:188	0.02	30.0	4	1	0
PRT	sp|P01112|RASH_HUMAN	GTPase HRas OS=Homo sapiens OX=9606 GN=HRAS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.08	30.0	1	1	1
PRT	sp|P38606-2|VATA_HUMAN	Isoform 2 of V-type proton ATPase catalytic subunit A OS=Homo sapiens OX=9606 GN=ATP6V1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	23-UNIMOD:267	0.02	30.0	2	1	0
PRT	sp|Q9BYD3-2|RM04_HUMAN	Isoform 2 of 39S ribosomal protein L4, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	92-UNIMOD:267	0.06	30.0	2	1	0
PRT	sp|P08727|K1C19_HUMAN	Keratin, type I cytoskeletal 19 OS=Homo sapiens OX=9606 GN=KRT19 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	265-UNIMOD:188,274-UNIMOD:267,372-UNIMOD:267,381-UNIMOD:267	0.11	30.0	8	3	0
PRT	sp|P62241|RS8_HUMAN	40S ribosomal protein S8 OS=Homo sapiens OX=9606 GN=RPS8 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	30.0	null	111-UNIMOD:28,59-UNIMOD:267,71-UNIMOD:4,72-UNIMOD:4,74-UNIMOD:267,123-UNIMOD:267	0.16	30.0	5	2	0
PRT	sp|Q9H4A4|AMPB_HUMAN	Aminopeptidase B OS=Homo sapiens OX=9606 GN=RNPEP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	163-UNIMOD:188,176-UNIMOD:267	0.02	30.0	1	1	1
PRT	sp|Q92973|TNPO1_HUMAN	Transportin-1 OS=Homo sapiens OX=9606 GN=TNPO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	205-UNIMOD:4	0.02	30.0	1	1	0
PRT	sp|Q12965|MYO1E_HUMAN	Unconventional myosin-Ie OS=Homo sapiens OX=9606 GN=MYO1E PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	null	896-UNIMOD:28	0.02	30.0	2	1	0
PRT	sp|P69905|HBA_HUMAN	Hemoglobin subunit alpha OS=Homo sapiens OX=9606 GN=HBA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null		0.11	30.0	1	1	1
PRT	sp|Q9UBU9|NXF1_HUMAN	Nuclear RNA export factor 1 OS=Homo sapiens OX=9606 GN=NXF1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	null	143-UNIMOD:385,143-UNIMOD:4,158-UNIMOD:267	0.03	30.0	2	1	0
PRT	sp|P12081|HARS1_HUMAN	Histidine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=HARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	379-UNIMOD:4	0.03	30.0	1	1	1
PRT	sp|P51659|DHB4_HUMAN	Peroxisomal multifunctional enzyme type 2 OS=Homo sapiens OX=9606 GN=HSD17B4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|P55786-2|PSA_HUMAN	Isoform 2 of Puromycin-sensitive aminopeptidase OS=Homo sapiens OX=9606 GN=NPEPPS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	802-UNIMOD:267	0.02	29.0	2	1	0
PRT	sp|P16615-5|AT2A2_HUMAN	Isoform 5 of Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Homo sapiens OX=9606 GN=ATP2A2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	655-UNIMOD:267,666-UNIMOD:267	0.02	29.0	3	1	0
PRT	sp|Q9UPN3|MACF1_HUMAN	Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	5817-UNIMOD:267	0.00	29.0	1	1	1
PRT	sp|P48163-2|MAOX_HUMAN	Isoform 2 of NADP-dependent malic enzyme OS=Homo sapiens OX=9606 GN=ME1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.04	29.0	2	1	0
PRT	sp|P35080-2|PROF2_HUMAN	Isoform IIb of Profilin-2 OS=Homo sapiens OX=9606 GN=PFN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.11	29.0	1	1	1
PRT	sp|Q96GQ7|DDX27_HUMAN	Probable ATP-dependent RNA helicase DDX27 OS=Homo sapiens OX=9606 GN=DDX27 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	450-UNIMOD:267,460-UNIMOD:267	0.02	29.0	2	1	0
PRT	sp|Q5VTE0|EF1A3_HUMAN	Putative elongation factor 1-alpha-like 3 OS=Homo sapiens OX=9606 GN=EEF1A1P5 PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	146-UNIMOD:188,266-UNIMOD:267	0.05	29.0	5	2	1
PRT	sp|P13987|CD59_HUMAN	CD59 glycoprotein OS=Homo sapiens OX=9606 GN=CD59 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	70-UNIMOD:4,78-UNIMOD:267	0.10	29.0	2	1	0
PRT	sp|Q13724-2|MOGS_HUMAN	Isoform 2 of Mannosyl-oligosaccharide glucosidase OS=Homo sapiens OX=9606 GN=MOGS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	135-UNIMOD:267	0.02	29.0	1	1	1
PRT	sp|O75874|IDHC_HUMAN	Isocitrate dehydrogenase [NADP] cytoplasmic OS=Homo sapiens OX=9606 GN=IDH1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	224-UNIMOD:188,233-UNIMOD:188	0.03	29.0	2	1	0
PRT	sp|Q9UKX7-2|NUP50_HUMAN	Isoform 2 of Nuclear pore complex protein Nup50 OS=Homo sapiens OX=9606 GN=NUP50	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.08	29.0	1	1	0
PRT	sp|Q86VP6-2|CAND1_HUMAN	Isoform 2 of Cullin-associated NEDD8-dissociated protein 1 OS=Homo sapiens OX=9606 GN=CAND1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	837-UNIMOD:188	0.02	29.0	2	1	0
PRT	sp|P83436|COG7_HUMAN	Conserved oligomeric Golgi complex subunit 7 OS=Homo sapiens OX=9606 GN=COG7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	482-UNIMOD:4,492-UNIMOD:267	0.02	29.0	2	1	0
PRT	sp|Q8TAQ2-2|SMRC2_HUMAN	Isoform 2 of SWI/SNF complex subunit SMARCC2 OS=Homo sapiens OX=9606 GN=SMARCC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	946-UNIMOD:267,666-UNIMOD:4,672-UNIMOD:267	0.02	29.0	4	2	0
PRT	sp|P19367-4|HXK1_HUMAN	Isoform 4 of Hexokinase-1 OS=Homo sapiens OX=9606 GN=HK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	242-UNIMOD:267	0.01	29.0	2	1	0
PRT	sp|P06737-2|PYGL_HUMAN	Isoform 2 of Glycogen phosphorylase, liver form OS=Homo sapiens OX=9606 GN=PYGL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	325-UNIMOD:188,330-UNIMOD:188	0.03	29.0	2	2	0
PRT	sp|P62258-2|1433E_HUMAN	Isoform SV of 14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	96-UNIMOD:188	0.12	29.0	2	2	2
PRT	sp|Q96F24-2|NRBF2_HUMAN	Isoform 2 of Nuclear receptor-binding factor 2 OS=Homo sapiens OX=9606 GN=NRBF2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	141-UNIMOD:267	0.05	29.0	2	1	0
PRT	sp|P08473|NEP_HUMAN	Neprilysin OS=Homo sapiens OX=9606 GN=MME PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|P68036-2|UB2L3_HUMAN	Isoform 2 of Ubiquitin-conjugating enzyme E2 L3 OS=Homo sapiens OX=9606 GN=UBE2L3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	32-UNIMOD:188,35-UNIMOD:188	0.13	29.0	3	1	0
PRT	sp|Q9NRH3|TBG2_HUMAN	Tubulin gamma-2 chain OS=Homo sapiens OX=9606 GN=TUBG2 PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	1	1	1
PRT	sp|O95834|EMAL2_HUMAN	Echinoderm microtubule-associated protein-like 2 OS=Homo sapiens OX=9606 GN=EML2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	301-UNIMOD:4,304-UNIMOD:267	0.03	29.0	1	1	1
PRT	sp|P16401|H15_HUMAN	Histone H1.5 OS=Homo sapiens OX=9606 GN=H1-5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	37-UNIMOD:188,49-UNIMOD:188	0.11	29.0	3	2	1
PRT	sp|P62277|RS13_HUMAN	40S ribosomal protein S13 OS=Homo sapiens OX=9606 GN=RPS13 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.09	29.0	1	1	1
PRT	sp|P16220-3|CREB1_HUMAN	Isoform 3 of Cyclic AMP-responsive element-binding protein 1 OS=Homo sapiens OX=9606 GN=CREB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.07	29.0	1	1	1
PRT	sp|Q13043|STK4_HUMAN	Serine/threonine-protein kinase 4 OS=Homo sapiens OX=9606 GN=STK4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	2	1	0
PRT	sp|P49792|RBP2_HUMAN	E3 SUMO-protein ligase RanBP2 OS=Homo sapiens OX=9606 GN=RANBP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null	563-UNIMOD:267,348-UNIMOD:4	0.02	29.0	5	4	3
PRT	sp|Q02880-2|TOP2B_HUMAN	Isoform Beta-1 of DNA topoisomerase 2-beta OS=Homo sapiens OX=9606 GN=TOP2B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	1	1	1
PRT	sp|Q9UNK0|STX8_HUMAN	Syntaxin-8 OS=Homo sapiens OX=9606 GN=STX8 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null	98-UNIMOD:188,108-UNIMOD:267	0.08	29.0	2	1	0
PRT	sp|Q05519-2|SRS11_HUMAN	Isoform 2 of Serine/arginine-rich splicing factor 11 OS=Homo sapiens OX=9606 GN=SRSF11	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	211-UNIMOD:188	0.03	29.0	2	1	0
PRT	sp|O60231|DHX16_HUMAN	Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Homo sapiens OX=9606 GN=DHX16 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	48-UNIMOD:267,60-UNIMOD:267	0.01	29.0	1	1	1
PRT	sp|O14773-2|TPP1_HUMAN	Isoform 2 of Tripeptidyl-peptidase 1 OS=Homo sapiens OX=9606 GN=TPP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.05	29.0	2	1	0
PRT	sp|Q92945|FUBP2_HUMAN	Far upstream element-binding protein 2 OS=Homo sapiens OX=9606 GN=KHSRP PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	267-UNIMOD:35	0.03	29.0	1	1	1
PRT	sp|Q8NBJ5|GT251_HUMAN	Procollagen galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=COLGALT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	76-UNIMOD:267	0.03	29.0	2	1	0
PRT	sp|O00220|TR10A_HUMAN	Tumor necrosis factor receptor superfamily member 10A OS=Homo sapiens OX=9606 GN=TNFRSF10A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	434-UNIMOD:267	0.03	29.0	2	1	0
PRT	sp|O43795-2|MYO1B_HUMAN	Isoform 2 of Unconventional myosin-Ib OS=Homo sapiens OX=9606 GN=MYO1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|Q5VWZ2-2|LYPL1_HUMAN	Isoform 2 of Lysophospholipase-like protein 1 OS=Homo sapiens OX=9606 GN=LYPLAL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	137-UNIMOD:188	0.08	29.0	2	1	0
PRT	sp|Q96T23-2|RSF1_HUMAN	Isoform 2 of Remodeling and spacing factor 1 OS=Homo sapiens OX=9606 GN=RSF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	1	1	0
PRT	sp|P33992|MCM5_HUMAN	DNA replication licensing factor MCM5 OS=Homo sapiens OX=9606 GN=MCM5 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	185-UNIMOD:267,195-UNIMOD:267,379-UNIMOD:35	0.05	29.0	4	2	0
PRT	sp|Q15437|SC23B_HUMAN	Protein transport protein Sec23B OS=Homo sapiens OX=9606 GN=SEC23B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|P18124|RL7_HUMAN	60S ribosomal protein L7 OS=Homo sapiens OX=9606 GN=RPL7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	166-UNIMOD:267,177-UNIMOD:267	0.10	29.0	3	2	1
PRT	sp|P06753-3|TPM3_HUMAN	Isoform 3 of Tropomyosin alpha-3 chain OS=Homo sapiens OX=9606 GN=TPM3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	55-UNIMOD:267,65-UNIMOD:267	0.05	29.0	2	1	0
PRT	sp|P63220|RS21_HUMAN	40S ribosomal protein S21 OS=Homo sapiens OX=9606 GN=RPS21 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	61-UNIMOD:267,71-UNIMOD:267	0.14	29.0	2	1	0
PRT	sp|O95251-3|KAT7_HUMAN	Isoform 3 of Histone acetyltransferase KAT7 OS=Homo sapiens OX=9606 GN=KAT7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	1	1	1
PRT	sp|P52799|EFNB2_HUMAN	Ephrin-B2 OS=Homo sapiens OX=9606 GN=EFNB2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.06	29.0	1	1	1
PRT	sp|Q5VTR2|BRE1A_HUMAN	E3 ubiquitin-protein ligase BRE1A OS=Homo sapiens OX=9606 GN=RNF20 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|O75643|U520_HUMAN	U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens OX=9606 GN=SNRNP200 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	1278-UNIMOD:4	0.02	29.0	3	2	1
PRT	sp|Q99439-2|CNN2_HUMAN	Isoform 2 of Calponin-2 OS=Homo sapiens OX=9606 GN=CNN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	93-UNIMOD:188	0.06	29.0	1	1	1
PRT	sp|O60508|PRP17_HUMAN	Pre-mRNA-processing factor 17 OS=Homo sapiens OX=9606 GN=CDC40 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	266-UNIMOD:267	0.03	29.0	2	1	0
PRT	sp|P13647|K2C5_HUMAN	Keratin, type II cytoskeletal 5 OS=Homo sapiens OX=9606 GN=KRT5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	178-UNIMOD:188,185-UNIMOD:188,431-UNIMOD:188,441-UNIMOD:188,228-UNIMOD:267,237-UNIMOD:267	0.06	29.0	5	3	1
PRT	sp|A8MUU1|FB5L3_HUMAN	Putative fatty acid-binding protein 5-like protein 3 OS=Homo sapiens OX=9606 GN=FABP5P3 PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	53-UNIMOD:4	0.28	29.0	1	1	1
PRT	sp|P21281|VATB2_HUMAN	V-type proton ATPase subunit B, brain isoform OS=Homo sapiens OX=9606 GN=ATP6V1B2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	64-UNIMOD:188	0.03	29.0	1	1	1
PRT	sp|O75534-2|CSDE1_HUMAN	Isoform 2 of Cold shock domain-containing protein E1 OS=Homo sapiens OX=9606 GN=CSDE1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|Q96AG4|LRC59_HUMAN	Leucine-rich repeat-containing protein 59 OS=Homo sapiens OX=9606 GN=LRRC59 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	116-UNIMOD:188,126-UNIMOD:188	0.09	29.0	3	2	1
PRT	sp|Q13263|TIF1B_HUMAN	Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	29.0	null	412-UNIMOD:267,427-UNIMOD:267,435-UNIMOD:28,469-UNIMOD:188,470-UNIMOD:267	0.07	29.0	2	2	1
PRT	sp|Q13813|SPTN1_HUMAN	Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	1314-UNIMOD:4	0.01	29.0	1	1	1
PRT	sp|P68104|EF1A1_HUMAN	Elongation factor 1-alpha 1 OS=Homo sapiens OX=9606 GN=EEF1A1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	null	135-UNIMOD:27	0.03	29.0	1	1	0
PRT	sp|P30048|PRDX3_HUMAN	Thioredoxin-dependent peroxide reductase, mitochondrial OS=Homo sapiens OX=9606 GN=PRDX3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	null	167-UNIMOD:28	0.07	29.0	1	1	0
PRT	sp|P56192|SYMC_HUMAN	Methionine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=MARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	29.0	null	192-UNIMOD:28,199-UNIMOD:267,204-UNIMOD:188	0.03	29.0	3	2	1
PRT	sp|P06737|PYGL_HUMAN	Glycogen phosphorylase, liver form OS=Homo sapiens OX=9606 GN=PYGL PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	29.0	null	410-UNIMOD:188,359-UNIMOD:188,364-UNIMOD:188	0.03	29.0	2	2	0
PRT	sp|O43768|ENSA_HUMAN	Alpha-endosulfine OS=Homo sapiens OX=9606 GN=ENSA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	null	81-UNIMOD:28,89-UNIMOD:188,106-UNIMOD:267	0.22	29.0	2	1	0
PRT	sp|Q9UKX7|NUP50_HUMAN	Nuclear pore complex protein Nup50 OS=Homo sapiens OX=9606 GN=NUP50 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	83-UNIMOD:188,104-UNIMOD:188	0.07	29.0	2	1	0
PRT	sp|Q16881|TRXR1_HUMAN	Thioredoxin reductase 1, cytoplasmic OS=Homo sapiens OX=9606 GN=TXNRD1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	null	400-UNIMOD:28,405-UNIMOD:188,416-UNIMOD:267	0.03	29.0	2	1	0
PRT	sp|Q9UHI6|DDX20_HUMAN	Probable ATP-dependent RNA helicase DDX20 OS=Homo sapiens OX=9606 GN=DDX20 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	49-UNIMOD:267,60-UNIMOD:267	0.04	28.0	3	2	1
PRT	sp|O60716|CTND1_HUMAN	Catenin delta-1 OS=Homo sapiens OX=9606 GN=CTNND1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	253-UNIMOD:267,264-UNIMOD:267,287-UNIMOD:267	0.03	28.0	3	2	1
PRT	sp|O00203-3|AP3B1_HUMAN	Isoform 2 of AP-3 complex subunit beta-1 OS=Homo sapiens OX=9606 GN=AP3B1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	458-UNIMOD:4	0.02	28.0	1	1	1
PRT	sp|Q16537-2|2A5E_HUMAN	Isoform 2 of Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilon isoform OS=Homo sapiens OX=9606 GN=PPP2R5E	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	351-UNIMOD:4,362-UNIMOD:267	0.06	28.0	3	2	1
PRT	sp|P12429|ANXA3_HUMAN	Annexin A3 OS=Homo sapiens OX=9606 GN=ANXA3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	169-UNIMOD:188,176-UNIMOD:188	0.04	28.0	2	1	0
PRT	sp|Q9H307|PININ_HUMAN	Pinin OS=Homo sapiens OX=9606 GN=PNN PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.04	28.0	1	1	1
PRT	sp|Q00341-2|VIGLN_HUMAN	Isoform 2 of Vigilin OS=Homo sapiens OX=9606 GN=HDLBP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|P48681|NEST_HUMAN	Nestin OS=Homo sapiens OX=9606 GN=NES PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	222-UNIMOD:267,232-UNIMOD:267	0.01	28.0	2	1	0
PRT	sp|Q9UJC5|SH3L2_HUMAN	SH3 domain-binding glutamic acid-rich-like protein 2 OS=Homo sapiens OX=9606 GN=SH3BGRL2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.14	28.0	1	1	1
PRT	sp|Q9UKF6|CPSF3_HUMAN	Cleavage and polyadenylation specificity factor subunit 3 OS=Homo sapiens OX=9606 GN=CPSF3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	223-UNIMOD:4,232-UNIMOD:267	0.02	28.0	2	1	0
PRT	sp|Q9UK22|FBX2_HUMAN	F-box only protein 2 OS=Homo sapiens OX=9606 GN=FBXO2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	280-UNIMOD:188	0.04	28.0	1	1	1
PRT	sp|P22570-4|ADRO_HUMAN	Isoform 4 of NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Homo sapiens OX=9606 GN=FDXR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	38-UNIMOD:188	0.03	28.0	2	1	0
PRT	sp|P49591|SYSC_HUMAN	Serine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=SARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.05	28.0	2	2	2
PRT	sp|Q9Y617|SERC_HUMAN	Phosphoserine aminotransferase OS=Homo sapiens OX=9606 GN=PSAT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	323-UNIMOD:188,333-UNIMOD:188,45-UNIMOD:267	0.08	28.0	4	2	0
PRT	sp|Q9H6F5|CCD86_HUMAN	Coiled-coil domain-containing protein 86 OS=Homo sapiens OX=9606 GN=CCDC86 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|Q96IU4|ABHEB_HUMAN	Protein ABHD14B OS=Homo sapiens OX=9606 GN=ABHD14B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.07	28.0	1	1	1
PRT	sp|P62491-2|RB11A_HUMAN	Isoform 2 of Ras-related protein Rab-11A OS=Homo sapiens OX=9606 GN=RAB11A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.08	28.0	1	1	1
PRT	sp|Q9BZE9-4|ASPC1_HUMAN	Isoform 4 of Tether containing UBX domain for GLUT4 OS=Homo sapiens OX=9606 GN=ASPSCR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	147-UNIMOD:4,148-UNIMOD:4	0.07	28.0	1	1	1
PRT	sp|P58107|EPIPL_HUMAN	Epiplakin OS=Homo sapiens OX=9606 GN=EPPK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	2402-UNIMOD:267	0.02	28.0	1	1	1
PRT	sp|P60842-2|IF4A1_HUMAN	Isoform 2 of Eukaryotic initiation factor 4A-I OS=Homo sapiens OX=9606 GN=EIF4A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	193-UNIMOD:188,202-UNIMOD:188	0.04	28.0	2	1	0
PRT	sp|P06744-2|G6PI_HUMAN	Isoform 2 of Glucose-6-phosphate isomerase OS=Homo sapiens OX=9606 GN=GPI	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	263-UNIMOD:188,123-UNIMOD:35	0.05	28.0	3	2	1
PRT	sp|O60825-2|F262_HUMAN	Isoform 2 of 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Homo sapiens OX=9606 GN=PFKFB2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	267-UNIMOD:188	0.03	28.0	1	1	1
PRT	sp|Q9UNF0-2|PACN2_HUMAN	Isoform 2 of Protein kinase C and casein kinase substrate in neurons protein 2 OS=Homo sapiens OX=9606 GN=PACSIN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	264-UNIMOD:188	0.03	28.0	2	1	0
PRT	sp|Q9Y613|FHOD1_HUMAN	FH1/FH2 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FHOD1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|Q7Z3D6-5|GLUCM_HUMAN	Isoform 5 of D-glutamate cyclase, mitochondrial OS=Homo sapiens OX=9606 GN=DGLUCY	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	456-UNIMOD:188	0.03	28.0	1	1	1
PRT	sp|P13797-3|PLST_HUMAN	Isoform 3 of Plastin-3 OS=Homo sapiens OX=9606 GN=PLS3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	113-UNIMOD:188	0.03	28.0	2	1	0
PRT	sp|P13796|PLSL_HUMAN	Plastin-2 OS=Homo sapiens OX=9606 GN=LCP1 PE=1 SV=6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	164-UNIMOD:4	0.04	28.0	1	1	1
PRT	sp|Q7Z6Z7-2|HUWE1_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens OX=9606 GN=HUWE1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	3329-UNIMOD:188,1879-UNIMOD:4,1891-UNIMOD:4,1892-UNIMOD:4,1880-UNIMOD:267,1894-UNIMOD:267	0.01	28.0	5	2	0
PRT	sp|P39023|RL3_HUMAN	60S ribosomal protein L3 OS=Homo sapiens OX=9606 GN=RPL3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	294-UNIMOD:188,297-UNIMOD:188	0.03	28.0	2	1	0
PRT	sp|Q14964|RB39A_HUMAN	Ras-related protein Rab-39A OS=Homo sapiens OX=9606 GN=RAB39A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.06	28.0	2	1	0
PRT	sp|P22059|OSBP1_HUMAN	Oxysterol-binding protein 1 OS=Homo sapiens OX=9606 GN=OSBP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|O60437|PEPL_HUMAN	Periplakin OS=Homo sapiens OX=9606 GN=PPL PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	1157-UNIMOD:188,1167-UNIMOD:188	0.01	28.0	1	1	1
PRT	sp|P46459-2|NSF_HUMAN	Isoform 2 of Vesicle-fusing ATPase OS=Homo sapiens OX=9606 GN=NSF	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|Q16527|CSRP2_HUMAN	Cysteine and glycine-rich protein 2 OS=Homo sapiens OX=9606 GN=CSRP2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	58-UNIMOD:4	0.10	28.0	1	1	1
PRT	sp|P14314-2|GLU2B_HUMAN	Isoform 2 of Glucosidase 2 subunit beta OS=Homo sapiens OX=9606 GN=PRKCSH	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.04	28.0	1	1	1
PRT	sp|Q06587|RING1_HUMAN	E3 ubiquitin-protein ligase RING1 OS=Homo sapiens OX=9606 GN=RING1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	146-UNIMOD:267	0.04	28.0	1	1	1
PRT	sp|Q9P1Y5|CAMP3_HUMAN	Calmodulin-regulated spectrin-associated protein 3 OS=Homo sapiens OX=9606 GN=CAMSAP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|Q9C040|TRIM2_HUMAN	Tripartite motif-containing protein 2 OS=Homo sapiens OX=9606 GN=TRIM2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	294-UNIMOD:267	0.02	28.0	1	1	1
PRT	sp|Q9BXP5-5|SRRT_HUMAN	Isoform 5 of Serrate RNA effector molecule homolog OS=Homo sapiens OX=9606 GN=SRRT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	453-UNIMOD:4,451-UNIMOD:267,461-UNIMOD:267	0.02	28.0	2	1	0
PRT	sp|Q16643|DREB_HUMAN	Drebrin OS=Homo sapiens OX=9606 GN=DBN1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null	328-UNIMOD:35,177-UNIMOD:267,185-UNIMOD:188	0.06	28.0	2	2	2
PRT	sp|Q13838|DX39B_HUMAN	Spliceosome RNA helicase DDX39B OS=Homo sapiens OX=9606 GN=DDX39B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	165-UNIMOD:4,175-UNIMOD:267	0.03	28.0	1	1	1
PRT	sp|Q16629-3|SRSF7_HUMAN	Isoform 3 of Serine/arginine-rich splicing factor 7 OS=Homo sapiens OX=9606 GN=SRSF7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	58-UNIMOD:267,65-UNIMOD:267,78-UNIMOD:267,87-UNIMOD:267	0.26	28.0	2	2	1
PRT	sp|O00267-2|SPT5H_HUMAN	Isoform 2 of Transcription elongation factor SPT5 OS=Homo sapiens OX=9606 GN=SUPT5H	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|P13667|PDIA4_HUMAN	Protein disulfide-isomerase A4 OS=Homo sapiens OX=9606 GN=PDIA4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	262-UNIMOD:267,270-UNIMOD:267	0.04	28.0	2	2	2
PRT	sp|P12270|TPR_HUMAN	Nucleoprotein TPR OS=Homo sapiens OX=9606 GN=TPR PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	1367-UNIMOD:267,1377-UNIMOD:267	0.01	28.0	2	1	0
PRT	sp|P37198|NUP62_HUMAN	Nuclear pore glycoprotein p62 OS=Homo sapiens OX=9606 GN=NUP62 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.06	28.0	2	2	2
PRT	sp|P48444-2|COPD_HUMAN	Isoform 2 of Coatomer subunit delta OS=Homo sapiens OX=9606 GN=ARCN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	353-UNIMOD:4	0.04	28.0	1	1	1
PRT	sp|Q9NZB2-4|F120A_HUMAN	Isoform D of Constitutive coactivator of PPAR-gamma-like protein 1 OS=Homo sapiens OX=9606 GN=FAM120A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|Q9UKV3-5|ACINU_HUMAN	Isoform 4 of Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens OX=9606 GN=ACIN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	532-UNIMOD:188,540-UNIMOD:188	0.01	28.0	2	1	0
PRT	sp|Q12906-5|ILF3_HUMAN	Isoform 5 of Interleukin enhancer-binding factor 3 OS=Homo sapiens OX=9606 GN=ILF3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	266-UNIMOD:35,264-UNIMOD:267,273-UNIMOD:267	0.02	28.0	3	1	0
PRT	sp|P16949|STMN1_HUMAN	Stathmin OS=Homo sapiens OX=9606 GN=STMN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	29-UNIMOD:188,41-UNIMOD:188	0.10	28.0	2	1	0
PRT	sp|P21399|ACOC_HUMAN	Cytoplasmic aconitate hydratase OS=Homo sapiens OX=9606 GN=ACO1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1	0.02	28.0	1	1	1
PRT	sp|O76024|WFS1_HUMAN	Wolframin OS=Homo sapiens OX=9606 GN=WFS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|O60828-5|PQBP1_HUMAN	Isoform 5 of Polyglutamine-binding protein 1 OS=Homo sapiens OX=9606 GN=PQBP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	143-UNIMOD:267,153-UNIMOD:267	0.16	28.0	1	1	1
PRT	sp|Q8IZL8|PELP1_HUMAN	Proline-, glutamic acid- and leucine-rich protein 1 OS=Homo sapiens OX=9606 GN=PELP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	61-UNIMOD:267	0.01	28.0	2	1	0
PRT	sp|P52701-4|MSH6_HUMAN	Isoform 4 of DNA mismatch repair protein Msh6 OS=Homo sapiens OX=9606 GN=MSH6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	296-UNIMOD:188,674-UNIMOD:267,686-UNIMOD:267	0.03	28.0	5	2	1
PRT	sp|Q8TEQ6|GEMI5_HUMAN	Gem-associated protein 5 OS=Homo sapiens OX=9606 GN=GEMIN5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	66-UNIMOD:267	0.02	28.0	3	2	1
PRT	sp|Q6PD62|CTR9_HUMAN	RNA polymerase-associated protein CTR9 homolog OS=Homo sapiens OX=9606 GN=CTR9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null	463-UNIMOD:267	0.02	28.0	2	1	0
PRT	sp|P35609|ACTN2_HUMAN	Alpha-actinin-2 OS=Homo sapiens OX=9606 GN=ACTN2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	357-UNIMOD:267,366-UNIMOD:188	0.02	28.0	1	1	1
PRT	sp|P78527|PRKDC_HUMAN	DNA-dependent protein kinase catalytic subunit OS=Homo sapiens OX=9606 GN=PRKDC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	2763-UNIMOD:35,2764-UNIMOD:188,2773-UNIMOD:267	0.00	28.0	1	1	1
PRT	sp|P62736|ACTA_HUMAN	Actin, aortic smooth muscle OS=Homo sapiens OX=9606 GN=ACTA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	52-UNIMOD:188	0.03	28.0	2	1	0
PRT	sp|P61026|RAB10_HUMAN	Ras-related protein Rab-10 OS=Homo sapiens OX=9606 GN=RAB10 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	59-UNIMOD:188,70-UNIMOD:267	0.07	28.0	1	1	1
PRT	sp|Q13561|DCTN2_HUMAN	Dynactin subunit 2 OS=Homo sapiens OX=9606 GN=DCTN2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	null	141-UNIMOD:28,146-UNIMOD:188,156-UNIMOD:188	0.04	28.0	1	1	1
PRT	sp|P00491|PNPH_HUMAN	Purine nucleoside phosphorylase OS=Homo sapiens OX=9606 GN=PNP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null		0.08	28.0	1	1	1
PRT	sp|P02768|ALBU_HUMAN	Serum albumin OS=Homo sapiens OX=9606 GN=ALB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|Q9Y3A5|SBDS_HUMAN	Ribosome maturation protein SBDS OS=Homo sapiens OX=9606 GN=SBDS PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null		0.09	28.0	1	1	1
PRT	sp|O00233|PSMD9_HUMAN	26S proteasome non-ATPase regulatory subunit 9 OS=Homo sapiens OX=9606 GN=PSMD9 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	null	92-UNIMOD:28,103-UNIMOD:267	0.06	28.0	2	1	0
PRT	sp|Q96IZ6|MET2A_HUMAN	tRNA N(3)-methylcytidine methyltransferase METTL2A OS=Homo sapiens OX=9606 GN=METTL2A PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	null	233-UNIMOD:385,233-UNIMOD:4,241-UNIMOD:4,245-UNIMOD:188	0.04	28.0	2	1	0
PRT	sp|Q9NQS7|INCE_HUMAN	Inner centromere protein OS=Homo sapiens OX=9606 GN=INCENP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|A0AVT1|UBA6_HUMAN	Ubiquitin-like modifier-activating enzyme 6 OS=Homo sapiens OX=9606 GN=UBA6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	null	581-UNIMOD:385,581-UNIMOD:4,586-UNIMOD:267,597-UNIMOD:188	0.02	28.0	2	1	0
PRT	sp|P00558-2|PGK1_HUMAN	Isoform 2 of Phosphoglycerate kinase 1 OS=Homo sapiens OX=9606 GN=PGK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	156-UNIMOD:188	0.04	27.0	2	1	0
PRT	sp|P49773|HINT1_HUMAN	Histidine triad nucleotide-binding protein 1 OS=Homo sapiens OX=9606 GN=HINT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.12	27.0	1	1	1
PRT	sp|Q9NV31|IMP3_HUMAN	U3 small nucleolar ribonucleoprotein protein IMP3 OS=Homo sapiens OX=9606 GN=IMP3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.10	27.0	1	1	1
PRT	sp|Q02878|RL6_HUMAN	60S ribosomal protein L6 OS=Homo sapiens OX=9606 GN=RPL6 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	156-UNIMOD:267,285-UNIMOD:188	0.10	27.0	3	2	1
PRT	sp|Q8IWS0-4|PHF6_HUMAN	Isoform 4 of PHD finger protein 6 OS=Homo sapiens OX=9606 GN=PHF6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	211-UNIMOD:4,214-UNIMOD:4	0.05	27.0	1	1	1
PRT	sp|P23229-7|ITA6_HUMAN	Isoform 7 of Integrin alpha-6 OS=Homo sapiens OX=9606 GN=ITGA6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|P49411|EFTU_HUMAN	Elongation factor Tu, mitochondrial OS=Homo sapiens OX=9606 GN=TUFM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	256-UNIMOD:188,271-UNIMOD:267	0.04	27.0	2	1	0
PRT	sp|P19784|CSK22_HUMAN	Casein kinase II subunit alpha' OS=Homo sapiens OX=9606 GN=CSNK2A2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	304-UNIMOD:188	0.09	27.0	2	2	2
PRT	sp|O60220|TIM8A_HUMAN	Mitochondrial import inner membrane translocase subunit Tim8 A OS=Homo sapiens OX=9606 GN=TIMM8A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.19	27.0	1	1	1
PRT	sp|P07437|TBB5_HUMAN	Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.04	27.0	1	1	1
PRT	sp|P50991-2|TCPD_HUMAN	Isoform 2 of T-complex protein 1 subunit delta OS=Homo sapiens OX=9606 GN=CCT4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	109-UNIMOD:188	0.03	27.0	3	1	0
PRT	sp|Q8NFW8-2|NEUA_HUMAN	Isoform 2 of N-acylneuraminate cytidylyltransferase OS=Homo sapiens OX=9606 GN=CMAS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.05	27.0	1	1	1
PRT	sp|Q8NB37-3|GALD1_HUMAN	Isoform 3 of Glutamine amidotransferase-like class 1 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=GATD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	180-UNIMOD:4	0.14	27.0	1	1	1
PRT	sp|Q9NR12-2|PDLI7_HUMAN	Isoform 2 of PDZ and LIM domain protein 7 OS=Homo sapiens OX=9606 GN=PDLIM7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	224-UNIMOD:267	0.03	27.0	1	1	1
PRT	sp|Q15185-3|TEBP_HUMAN	Isoform 3 of Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	40-UNIMOD:4	0.21	27.0	3	2	1
PRT	sp|P17096|HMGA1_HUMAN	High mobility group protein HMG-I/HMG-Y OS=Homo sapiens OX=9606 GN=HMGA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	31-UNIMOD:188,46-UNIMOD:188	0.16	27.0	2	1	0
PRT	sp|O43747|AP1G1_HUMAN	AP-1 complex subunit gamma-1 OS=Homo sapiens OX=9606 GN=AP1G1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|Q9UHD8|SEPT9_HUMAN	Septin-9 OS=Homo sapiens OX=9606 GN=SEPTIN9 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	2	1	0
PRT	sp|Q9Y291|RT33_HUMAN	28S ribosomal protein S33, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS33 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.12	27.0	1	1	1
PRT	sp|Q5JTH9-2|RRP12_HUMAN	Isoform 2 of RRP12-like protein OS=Homo sapiens OX=9606 GN=RRP12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|P54136-2|SYRC_HUMAN	Isoform Monomeric of Arginine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=RARS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|O75340-2|PDCD6_HUMAN	Isoform 2 of Programmed cell death protein 6 OS=Homo sapiens OX=9606 GN=PDCD6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	134-UNIMOD:267	0.06	27.0	2	1	0
PRT	sp|Q9Y4K3|TRAF6_HUMAN	TNF receptor-associated factor 6 OS=Homo sapiens OX=9606 GN=TRAF6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	305-UNIMOD:267	0.02	27.0	1	1	1
PRT	sp|P22087|FBRL_HUMAN	rRNA 2'-O-methyltransferase fibrillarin OS=Homo sapiens OX=9606 GN=FBL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	265-UNIMOD:188	0.03	27.0	1	1	1
PRT	sp|P48147|PPCE_HUMAN	Prolyl endopeptidase OS=Homo sapiens OX=9606 GN=PREP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	373-UNIMOD:188	0.02	27.0	1	1	1
PRT	sp|Q6ZN28|MACC1_HUMAN	Metastasis-associated in colon cancer protein 1 OS=Homo sapiens OX=9606 GN=MACC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	104-UNIMOD:4	0.02	27.0	1	1	1
PRT	sp|Q7L0Y3|TM10C_HUMAN	tRNA methyltransferase 10 homolog C OS=Homo sapiens OX=9606 GN=TRMT10C PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	246-UNIMOD:4,249-UNIMOD:188	0.03	27.0	2	1	0
PRT	sp|Q14137-2|BOP1_HUMAN	Isoform 2 of Ribosome biogenesis protein BOP1 OS=Homo sapiens OX=9606 GN=BOP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	162-UNIMOD:267,183-UNIMOD:267	0.04	27.0	1	1	1
PRT	sp|P52789|HXK2_HUMAN	Hexokinase-2 OS=Homo sapiens OX=9606 GN=HK2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	834-UNIMOD:4	0.02	27.0	1	1	1
PRT	sp|P52948-6|NUP98_HUMAN	Isoform 6 of Nuclear pore complex protein Nup98-Nup96 OS=Homo sapiens OX=9606 GN=NUP98	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	204-UNIMOD:267,212-UNIMOD:267	0.01	27.0	1	1	1
PRT	sp|P42785|PCP_HUMAN	Lysosomal Pro-X carboxypeptidase OS=Homo sapiens OX=9606 GN=PRCP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|Q15370|ELOB_HUMAN	Elongin-B OS=Homo sapiens OX=9606 GN=ELOB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	60-UNIMOD:4,68-UNIMOD:267,80-UNIMOD:267	0.22	27.0	1	1	1
PRT	sp|A8MXV4|NUD19_HUMAN	Nucleoside diphosphate-linked moiety X motif 19 OS=Homo sapiens OX=9606 GN=NUDT19 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	168-UNIMOD:267	0.07	27.0	3	1	0
PRT	sp|P31942-6|HNRH3_HUMAN	Isoform 6 of Heterogeneous nuclear ribonucleoprotein H3 OS=Homo sapiens OX=9606 GN=HNRNPH3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	95-UNIMOD:267	0.08	27.0	2	1	0
PRT	sp|P61604|CH10_HUMAN	10 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPE1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.15	27.0	1	1	1
PRT	sp|P23396|RS3_HUMAN	40S ribosomal protein S3 OS=Homo sapiens OX=9606 GN=RPS3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	45-UNIMOD:267,54-UNIMOD:267	0.06	27.0	2	1	0
PRT	sp|P61163|ACTZ_HUMAN	Alpha-centractin OS=Homo sapiens OX=9606 GN=ACTR1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	34-UNIMOD:4	0.03	27.0	1	1	1
PRT	sp|P46937-4|YAP1_HUMAN	Isoform 4 of Transcriptional coactivator YAP1 OS=Homo sapiens OX=9606 GN=YAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	25-UNIMOD:267	0.05	27.0	2	1	0
PRT	sp|O00231|PSD11_HUMAN	26S proteasome non-ATPase regulatory subunit 11 OS=Homo sapiens OX=9606 GN=PSMD11 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	155-UNIMOD:267	0.03	27.0	1	1	1
PRT	sp|P18283|GPX2_HUMAN	Glutathione peroxidase 2 OS=Homo sapiens OX=9606 GN=GPX2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.09	27.0	1	1	1
PRT	sp|O75367|H2AY_HUMAN	Core histone macro-H2A.1 OS=Homo sapiens OX=9606 GN=MACROH2A1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.04	27.0	2	1	0
PRT	sp|P61978|HNRPK_HUMAN	Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	184-UNIMOD:4,185-UNIMOD:4	0.03	27.0	1	1	1
PRT	sp|O75821|EIF3G_HUMAN	Eukaryotic translation initiation factor 3 subunit G OS=Homo sapiens OX=9606 GN=EIF3G PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	57-UNIMOD:188,65-UNIMOD:188	0.11	27.0	2	1	0
PRT	sp|O43399|TPD54_HUMAN	Tumor protein D54 OS=Homo sapiens OX=9606 GN=TPD52L2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.08	27.0	1	1	0
PRT	sp|O95573|ACSL3_HUMAN	Long-chain-fatty-acid--CoA ligase 3 OS=Homo sapiens OX=9606 GN=ACSL3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|Q9UMS4|PRP19_HUMAN	Pre-mRNA-processing factor 19 OS=Homo sapiens OX=9606 GN=PRPF19 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	null	209-UNIMOD:28,230-UNIMOD:4	0.06	27.0	1	1	1
PRT	sp|Q96I24|FUBP3_HUMAN	Far upstream element-binding protein 3 OS=Homo sapiens OX=9606 GN=FUBP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|P53801|PTTG_HUMAN	Pituitary tumor-transforming gene 1 protein-interacting protein OS=Homo sapiens OX=9606 GN=PTTG1IP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.07	27.0	1	1	1
PRT	sp|P46013|KI67_HUMAN	Proliferation marker protein Ki-67 OS=Homo sapiens OX=9606 GN=MKI67 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.00	27.0	1	1	0
PRT	sp|P08247|SYPH_HUMAN	Synaptophysin OS=Homo sapiens OX=9606 GN=SYP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	87-UNIMOD:4	0.04	27.0	1	1	1
PRT	sp|Q07954|LRP1_HUMAN	Prolow-density lipoprotein receptor-related protein 1 OS=Homo sapiens OX=9606 GN=LRP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.00	27.0	1	1	1
PRT	sp|Q9H832|UBE2Z_HUMAN	Ubiquitin-conjugating enzyme E2 Z OS=Homo sapiens OX=9606 GN=UBE2Z PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	304-UNIMOD:188	0.05	27.0	1	1	1
PRT	sp|O75116|ROCK2_HUMAN	Rho-associated protein kinase 2 OS=Homo sapiens OX=9606 GN=ROCK2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|P31939|PUR9_HUMAN	Bifunctional purine biosynthesis protein PURH OS=Homo sapiens OX=9606 GN=ATIC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null	285-UNIMOD:188	0.09	26.0	3	3	3
PRT	sp|Q96SI9-2|STRBP_HUMAN	Isoform 2 of Spermatid perinuclear RNA-binding protein OS=Homo sapiens OX=9606 GN=STRBP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	559-UNIMOD:188,570-UNIMOD:188	0.03	26.0	1	1	1
PRT	sp|O00170|AIP_HUMAN	AH receptor-interacting protein OS=Homo sapiens OX=9606 GN=AIP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.04	26.0	1	1	1
PRT	sp|Q9H3N1|TMX1_HUMAN	Thioredoxin-related transmembrane protein 1 OS=Homo sapiens OX=9606 GN=TMX1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.05	26.0	1	1	1
PRT	sp|Q99873-2|ANM1_HUMAN	Isoform 2 of Protein arginine N-methyltransferase 1 OS=Homo sapiens OX=9606 GN=PRMT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.04	26.0	1	1	1
PRT	sp|Q99798|ACON_HUMAN	Aconitate hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=ACO2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	448-UNIMOD:4,451-UNIMOD:4	0.03	26.0	1	1	1
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	448-UNIMOD:267	0.05	26.0	4	3	2
PRT	sp|Q99584|S10AD_HUMAN	Protein S100-A13 OS=Homo sapiens OX=9606 GN=S100A13 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	51-UNIMOD:188	0.13	26.0	2	1	0
PRT	sp|Q9Y6M1-5|IF2B2_HUMAN	Isoform 5 of Insulin-like growth factor 2 mRNA-binding protein 2 OS=Homo sapiens OX=9606 GN=IGF2BP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	192-UNIMOD:4	0.05	26.0	1	1	1
PRT	sp|P43487-2|RANG_HUMAN	Isoform 2 of Ran-specific GTPase-activating protein OS=Homo sapiens OX=9606 GN=RANBP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	150-UNIMOD:188,152-UNIMOD:188	0.06	26.0	2	1	0
PRT	sp|Q9P287-4|BCCIP_HUMAN	Isoform 4 of BRCA2 and CDKN1A-interacting protein OS=Homo sapiens OX=9606 GN=BCCIP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.06	26.0	1	1	1
PRT	sp|P11717|MPRI_HUMAN	Cation-independent mannose-6-phosphate receptor OS=Homo sapiens OX=9606 GN=IGF2R PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	249-UNIMOD:267	0.00	26.0	1	1	1
PRT	sp|Q8N1G4|LRC47_HUMAN	Leucine-rich repeat-containing protein 47 OS=Homo sapiens OX=9606 GN=LRRC47 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	390-UNIMOD:4	0.03	26.0	1	1	1
PRT	sp|P46013-2|KI67_HUMAN	Isoform Short of Proliferation marker protein Ki-67 OS=Homo sapiens OX=9606 GN=MKI67	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.00	26.0	1	1	0
PRT	sp|Q10713|MPPA_HUMAN	Mitochondrial-processing peptidase subunit alpha OS=Homo sapiens OX=9606 GN=PMPCA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	140-UNIMOD:4,142-UNIMOD:4,146-UNIMOD:267	0.02	26.0	1	1	1
PRT	sp|Q96EK9|KTI12_HUMAN	Protein KTI12 homolog OS=Homo sapiens OX=9606 GN=KTI12 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.05	26.0	1	1	1
PRT	sp|Q06203|PUR1_HUMAN	Amidophosphoribosyltransferase OS=Homo sapiens OX=9606 GN=PPAT PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	271-UNIMOD:267,100-UNIMOD:4,105-UNIMOD:4	0.07	26.0	3	2	1
PRT	sp|Q9NRW3|ABC3C_HUMAN	DNA dC->dU-editing enzyme APOBEC-3C OS=Homo sapiens OX=9606 GN=APOBEC3C PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	122-UNIMOD:267	0.07	26.0	1	1	1
PRT	sp|P52788-2|SPSY_HUMAN	Isoform 2 of Spermine synthase OS=Homo sapiens OX=9606 GN=SMS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	12-UNIMOD:35,16-UNIMOD:188	0.04	26.0	4	1	0
PRT	sp|P06396-2|GELS_HUMAN	Isoform 2 of Gelsolin OS=Homo sapiens OX=9606 GN=GSN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	137-UNIMOD:267	0.02	26.0	2	1	0
PRT	sp|P60891|PRPS1_HUMAN	Ribose-phosphate pyrophosphokinase 1 OS=Homo sapiens OX=9606 GN=PRPS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.04	26.0	1	1	1
PRT	sp|Q13153|PAK1_HUMAN	Serine/threonine-protein kinase PAK 1 OS=Homo sapiens OX=9606 GN=PAK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|Q96DI7|SNR40_HUMAN	U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens OX=9606 GN=SNRNP40 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	286-UNIMOD:188	0.03	26.0	2	1	0
PRT	sp|Q6DD87|ZN787_HUMAN	Zinc finger protein 787 OS=Homo sapiens OX=9606 GN=ZNF787 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	347-UNIMOD:4,350-UNIMOD:4,356-UNIMOD:267,211-UNIMOD:188	0.09	26.0	2	2	2
PRT	sp|P00568|KAD1_HUMAN	Adenylate kinase isoenzyme 1 OS=Homo sapiens OX=9606 GN=AK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	25-UNIMOD:4	0.10	26.0	1	1	1
PRT	sp|O75131|CPNE3_HUMAN	Copine-3 OS=Homo sapiens OX=9606 GN=CPNE3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	54-UNIMOD:4	0.02	26.0	1	1	1
PRT	sp|O95793-2|STAU1_HUMAN	Isoform Short of Double-stranded RNA-binding protein Staufen homolog 1 OS=Homo sapiens OX=9606 GN=STAU1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	87-UNIMOD:267,93-UNIMOD:267	0.03	26.0	2	1	0
PRT	sp|Q969Q0|RL36L_HUMAN	60S ribosomal protein L36a-like OS=Homo sapiens OX=9606 GN=RPL36AL PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	69-UNIMOD:267,72-UNIMOD:4,77-UNIMOD:4,78-UNIMOD:267	0.13	26.0	2	1	0
PRT	sp|Q13887-2|KLF5_HUMAN	Isoform 2 of Krueppel-like factor 5 OS=Homo sapiens OX=9606 GN=KLF5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	206-UNIMOD:267	0.08	26.0	1	1	1
PRT	sp|O43399-6|TPD54_HUMAN	Isoform 6 of Tumor protein D54 OS=Homo sapiens OX=9606 GN=TPD52L2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.10	26.0	1	1	0
PRT	sp|O14980|XPO1_HUMAN	Exportin-1 OS=Homo sapiens OX=9606 GN=XPO1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	492-UNIMOD:188	0.01	26.0	1	1	1
PRT	sp|Q9BWF3-3|RBM4_HUMAN	Isoform 3 of RNA-binding protein 4 OS=Homo sapiens OX=9606 GN=RBM4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	89-UNIMOD:4,92-UNIMOD:188	0.10	26.0	2	1	0
PRT	sp|P39019|RS19_HUMAN	40S ribosomal protein S19 OS=Homo sapiens OX=9606 GN=RPS19 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	29-UNIMOD:188,38-UNIMOD:188	0.08	26.0	2	1	0
PRT	sp|Q9UET6-2|TRM7_HUMAN	Isoform 2 of Putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase OS=Homo sapiens OX=9606 GN=FTSJ1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.05	26.0	1	1	1
PRT	sp|Q8TBC4|UBA3_HUMAN	NEDD8-activating enzyme E1 catalytic subunit OS=Homo sapiens OX=9606 GN=UBA3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	249-UNIMOD:4,254-UNIMOD:267	0.02	26.0	1	1	1
PRT	sp|P40222|TXLNA_HUMAN	Alpha-taxilin OS=Homo sapiens OX=9606 GN=TXLNA PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	299-UNIMOD:267,308-UNIMOD:267	0.02	26.0	1	1	1
PRT	sp|P46781|RS9_HUMAN	40S ribosomal protein S9 OS=Homo sapiens OX=9606 GN=RPS9 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	93-UNIMOD:188,101-UNIMOD:188	0.06	26.0	2	1	0
PRT	sp|P11142-2|HSP7C_HUMAN	Isoform 2 of Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	237-UNIMOD:35,246-UNIMOD:188	0.02	26.0	3	1	0
PRT	sp|Q9BYD2|RM09_HUMAN	39S ribosomal protein L9, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL9 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	207-UNIMOD:188	0.05	26.0	2	1	0
PRT	sp|Q8N3R9-2|MPP5_HUMAN	Isoform 2 of MAGUK p55 subfamily member 5 OS=Homo sapiens OX=9606 GN=MPP5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|Q13085-3|ACACA_HUMAN	Isoform 3 of Acetyl-CoA carboxylase 1 OS=Homo sapiens OX=9606 GN=ACACA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	579-UNIMOD:267	0.01	26.0	1	1	1
PRT	sp|Q9NV06|DCA13_HUMAN	DDB1- and CUL4-associated factor 13 OS=Homo sapiens OX=9606 GN=DCAF13 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	39-UNIMOD:267,113-UNIMOD:267	0.06	26.0	4	2	0
PRT	sp|P24539|AT5F1_HUMAN	ATP synthase F(0) complex subunit B1, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5PB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	154-UNIMOD:188,162-UNIMOD:188	0.09	26.0	1	1	1
PRT	sp|Q9H0U3|MAGT1_HUMAN	Magnesium transporter protein 1 OS=Homo sapiens OX=9606 GN=MAGT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	150-UNIMOD:267,159-UNIMOD:267	0.03	26.0	1	1	1
PRT	sp|P11172-4|UMPS_HUMAN	Isoform 4 of Uridine 5'-monophosphate synthase OS=Homo sapiens OX=9606 GN=UMPS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	167-UNIMOD:267,176-UNIMOD:267	0.05	26.0	1	1	1
PRT	sp|P62191|PRS4_HUMAN	26S proteasome regulatory subunit 4 OS=Homo sapiens OX=9606 GN=PSMC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	294-UNIMOD:267,303-UNIMOD:267	0.03	26.0	2	1	0
PRT	sp|P11388|TOP2A_HUMAN	DNA topoisomerase 2-alpha OS=Homo sapiens OX=9606 GN=TOP2A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|P61224-2|RAP1B_HUMAN	Isoform 2 of Ras-related protein Rap-1b OS=Homo sapiens OX=9606 GN=RAP1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.11	26.0	1	1	1
PRT	sp|P61978-3|HNRPK_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	37-UNIMOD:267,46-UNIMOD:267	0.03	26.0	2	1	0
PRT	sp|Q15397|PUM3_HUMAN	Pumilio homolog 3 OS=Homo sapiens OX=9606 GN=PUM3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	181-UNIMOD:267	0.02	26.0	1	1	1
PRT	sp|Q9UBQ0|VPS29_HUMAN	Vacuolar protein sorting-associated protein 29 OS=Homo sapiens OX=9606 GN=VPS29 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.06	26.0	1	1	1
PRT	sp|Q9UNH7-2|SNX6_HUMAN	Isoform 2 of Sorting nexin-6 OS=Homo sapiens OX=9606 GN=SNX6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	33-UNIMOD:4	0.04	26.0	1	1	1
PRT	sp|P50914|RL14_HUMAN	60S ribosomal protein L14 OS=Homo sapiens OX=9606 GN=RPL14 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	23-UNIMOD:188	0.06	26.0	2	1	0
PRT	sp|Q9UHX1-4|PUF60_HUMAN	Isoform 4 of Poly(U)-binding-splicing factor PUF60 OS=Homo sapiens OX=9606 GN=PUF60	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	144-UNIMOD:267,163-UNIMOD:267	0.05	26.0	3	1	0
PRT	sp|Q15019|SEPT2_HUMAN	Septin-2 OS=Homo sapiens OX=9606 GN=SEPTIN2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	138-UNIMOD:267	0.03	26.0	2	1	0
PRT	sp|P02533|K1C14_HUMAN	Keratin, type I cytoskeletal 14 OS=Homo sapiens OX=9606 GN=KRT14 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	223-UNIMOD:267,232-UNIMOD:267	0.02	26.0	2	1	0
PRT	sp|P31943|HNRH1_HUMAN	Heterogeneous nuclear ribonucleoprotein H OS=Homo sapiens OX=9606 GN=HNRNPH1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	114-UNIMOD:267	0.04	26.0	1	1	0
PRT	sp|Q92900|RENT1_HUMAN	Regulator of nonsense transcripts 1 OS=Homo sapiens OX=9606 GN=UPF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	null	667-UNIMOD:28,675-UNIMOD:4,683-UNIMOD:4	0.02	26.0	1	1	1
PRT	sp|P62847|RS24_HUMAN	40S ribosomal protein S24 OS=Homo sapiens OX=9606 GN=RPS24 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	26.0	null	22-UNIMOD:28,32-UNIMOD:188	0.09	26.0	2	1	0
PRT	sp|Q9HDC9|APMAP_HUMAN	Adipocyte plasma membrane-associated protein OS=Homo sapiens OX=9606 GN=APMAP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.05	26.0	1	1	1
PRT	sp|Q8N1A0|KT222_HUMAN	Keratin-like protein KRT222 OS=Homo sapiens OX=9606 GN=KRT222 PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	131-UNIMOD:267	0.04	26.0	1	1	1
PRT	sp|Q2NL82|TSR1_HUMAN	Pre-rRNA-processing protein TSR1 homolog OS=Homo sapiens OX=9606 GN=TSR1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	null	575-UNIMOD:28	0.02	26.0	1	1	1
PRT	sp|P08034|CXB1_HUMAN	Gap junction beta-1 protein OS=Homo sapiens OX=9606 GN=GJB1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.05	26.0	1	1	1
PRT	sp|Q7LBC6|KDM3B_HUMAN	Lysine-specific demethylase 3B OS=Homo sapiens OX=9606 GN=KDM3B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	null	893-UNIMOD:28,904-UNIMOD:4,913-UNIMOD:188	0.01	26.0	1	1	1
PRT	sp|Q9NRM2|ZN277_HUMAN	Zinc finger protein 277 OS=Homo sapiens OX=9606 GN=ZNF277 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|Q52LJ0|FA98B_HUMAN	Protein FAM98B OS=Homo sapiens OX=9606 GN=FAM98B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|O95373|IPO7_HUMAN	Importin-7 OS=Homo sapiens OX=9606 GN=IPO7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	477-UNIMOD:4,484-UNIMOD:4,487-UNIMOD:188	0.01	25.0	1	1	1
PRT	sp|Q8N5M4|TTC9C_HUMAN	Tetratricopeptide repeat protein 9C OS=Homo sapiens OX=9606 GN=TTC9C PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.09	25.0	1	1	1
PRT	sp|O75146-2|HIP1R_HUMAN	Isoform 2 of Huntingtin-interacting protein 1-related protein OS=Homo sapiens OX=9606 GN=HIP1R	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q9H2G2-2|SLK_HUMAN	Isoform 2 of STE20-like serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=SLK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	973-UNIMOD:267,983-UNIMOD:267	0.01	25.0	1	1	1
PRT	sp|P30419-2|NMT1_HUMAN	Isoform Short of Glycylpeptide N-tetradecanoyltransferase 1 OS=Homo sapiens OX=9606 GN=NMT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	275-UNIMOD:267	0.03	25.0	1	1	1
PRT	sp|Q9P2R7-2|SUCB1_HUMAN	Isoform 2 of Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=SUCLA2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q99714-2|HCD2_HUMAN	Isoform 2 of 3-hydroxyacyl-CoA dehydrogenase type-2 OS=Homo sapiens OX=9606 GN=HSD17B10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	91-UNIMOD:4	0.08	25.0	1	1	1
PRT	sp|P61106|RAB14_HUMAN	Ras-related protein Rab-14 OS=Homo sapiens OX=9606 GN=RAB14 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	40-UNIMOD:4,51-UNIMOD:267	0.08	25.0	1	1	1
PRT	sp|Q15008-3|PSMD6_HUMAN	Isoform 3 of 26S proteasome non-ATPase regulatory subunit 6 OS=Homo sapiens OX=9606 GN=PSMD6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.05	25.0	1	1	1
PRT	sp|Q07955-3|SRSF1_HUMAN	Isoform ASF-3 of Serine/arginine-rich splicing factor 1 OS=Homo sapiens OX=9606 GN=SRSF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	65-UNIMOD:267,74-UNIMOD:267	0.12	25.0	3	1	0
PRT	sp|P47897-2|SYQ_HUMAN	Isoform 2 of Glutamine--tRNA ligase OS=Homo sapiens OX=9606 GN=QARS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|P78406|RAE1L_HUMAN	mRNA export factor OS=Homo sapiens OX=9606 GN=RAE1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.05	25.0	1	1	1
PRT	sp|Q86X29-6|LSR_HUMAN	Isoform 6 of Lipolysis-stimulated lipoprotein receptor OS=Homo sapiens OX=9606 GN=LSR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	321-UNIMOD:267,329-UNIMOD:267	0.03	25.0	1	1	1
PRT	sp|Q53GS9-3|SNUT2_HUMAN	Isoform 3 of U4/U6.U5 tri-snRNP-associated protein 2 OS=Homo sapiens OX=9606 GN=USP39	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	105-UNIMOD:4,113-UNIMOD:267	0.02	25.0	1	1	1
PRT	sp|Q7Z406|MYH14_HUMAN	Myosin-14 OS=Homo sapiens OX=9606 GN=MYH14 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	1233-UNIMOD:267	0.01	25.0	1	1	1
PRT	sp|Q6P1K8|T2H2L_HUMAN	General transcription factor IIH subunit 2-like protein OS=Homo sapiens OX=9606 GN=GTF2H2C PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q9NX40-3|OCAD1_HUMAN	Isoform 3 of OCIA domain-containing protein 1 OS=Homo sapiens OX=9606 GN=OCIAD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.07	25.0	1	1	1
PRT	sp|Q13200|PSMD2_HUMAN	26S proteasome non-ATPase regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PSMD2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	773-UNIMOD:188	0.01	25.0	2	1	0
PRT	sp|P27695|APEX1_HUMAN	DNA-(apurinic or apyrimidinic site) lyase OS=Homo sapiens OX=9606 GN=APEX1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	296-UNIMOD:4,299-UNIMOD:188	0.06	25.0	1	1	1
PRT	sp|P62753|RS6_HUMAN	40S ribosomal protein S6 OS=Homo sapiens OX=9606 GN=RPS6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.05	25.0	1	1	1
PRT	sp|Q6NXS1|IPP2B_HUMAN	Protein phosphatase inhibitor 2 family member B OS=Homo sapiens OX=9606 GN=PPP1R2B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	155-UNIMOD:188	0.05	25.0	1	1	1
PRT	sp|P08754|GNAI3_HUMAN	Guanine nucleotide-binding protein G(i) subunit alpha OS=Homo sapiens OX=9606 GN=GNAI3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|P00403|COX2_HUMAN	Cytochrome c oxidase subunit 2 OS=Homo sapiens OX=9606 GN=MT-CO2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	141-UNIMOD:267,151-UNIMOD:267	0.08	25.0	1	1	1
PRT	sp|Q99832-3|TCPH_HUMAN	Isoform 3 of T-complex protein 1 subunit eta OS=Homo sapiens OX=9606 GN=CCT7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q6PI48|SYDM_HUMAN	Aspartate--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=DARS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	456-UNIMOD:267,459-UNIMOD:4,466-UNIMOD:267	0.02	25.0	1	1	1
PRT	sp|Q12789-3|TF3C1_HUMAN	Isoform 2 of General transcription factor 3C polypeptide 1 OS=Homo sapiens OX=9606 GN=GTF3C1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	1704-UNIMOD:4	0.01	25.0	1	1	1
PRT	sp|Q9UGI8-2|TES_HUMAN	Isoform 2 of Testin OS=Homo sapiens OX=9606 GN=TES	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	1-UNIMOD:35,13-UNIMOD:4,15-UNIMOD:188	0.04	25.0	1	1	1
PRT	sp|Q53FA7-2|QORX_HUMAN	Isoform 2 of Quinone oxidoreductase PIG3 OS=Homo sapiens OX=9606 GN=TP53I3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	1-UNIMOD:1	0.08	25.0	1	1	1
PRT	sp|P08243-3|ASNS_HUMAN	Isoform 3 of Asparagine synthetase [glutamine-hydrolyzing] OS=Homo sapiens OX=9606 GN=ASNS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	1-UNIMOD:35,12-UNIMOD:188	0.03	25.0	1	1	1
PRT	sp|P46940|IQGA1_HUMAN	Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens OX=9606 GN=IQGAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	892-UNIMOD:35,893-UNIMOD:267,901-UNIMOD:267	0.01	25.0	1	1	1
PRT	sp|O00148|DX39A_HUMAN	ATP-dependent RNA helicase DDX39A OS=Homo sapiens OX=9606 GN=DDX39A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	164-UNIMOD:4,174-UNIMOD:267	0.03	25.0	3	1	0
PRT	sp|P17844-2|DDX5_HUMAN	Isoform 2 of Probable ATP-dependent RNA helicase DDX5 OS=Homo sapiens OX=9606 GN=DDX5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	67-UNIMOD:267	0.02	25.0	2	1	0
PRT	sp|P11216|PYGB_HUMAN	Glycogen phosphorylase, brain form OS=Homo sapiens OX=9606 GN=PYGB PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null	581-UNIMOD:4,590-UNIMOD:267	0.04	25.0	2	2	2
PRT	sp|Q9BTV4|TMM43_HUMAN	Transmembrane protein 43 OS=Homo sapiens OX=9606 GN=TMEM43 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q9BVC6|TM109_HUMAN	Transmembrane protein 109 OS=Homo sapiens OX=9606 GN=TMEM109 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.06	25.0	1	1	1
PRT	sp|Q9Y3B8-2|ORN_HUMAN	Isoform 2 of Oligoribonuclease, mitochondrial OS=Homo sapiens OX=9606 GN=REXO2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.07	25.0	1	1	1
PRT	sp|Q12931-2|TRAP1_HUMAN	Isoform 2 of Heat shock protein 75 kDa, mitochondrial OS=Homo sapiens OX=9606 GN=TRAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q13951|PEBB_HUMAN	Core-binding factor subunit beta OS=Homo sapiens OX=9606 GN=CBFB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.06	25.0	1	1	1
PRT	sp|Q14CX7-2|NAA25_HUMAN	Isoform 2 of N-alpha-acetyltransferase 25, NatB auxiliary subunit OS=Homo sapiens OX=9606 GN=NAA25	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	813-UNIMOD:188,818-UNIMOD:188	0.02	25.0	1	1	1
PRT	sp|P09960-3|LKHA4_HUMAN	Isoform 3 of Leukotriene A-4 hydrolase OS=Homo sapiens OX=9606 GN=LTA4H	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|P36542-2|ATPG_HUMAN	Isoform Heart of ATP synthase subunit gamma, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.04	25.0	1	1	1
PRT	sp|O95168-2|NDUB4_HUMAN	Isoform 2 of NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 OS=Homo sapiens OX=9606 GN=NDUFB4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.12	25.0	1	1	1
PRT	sp|P50570-3|DYN2_HUMAN	Isoform 3 of Dynamin-2 OS=Homo sapiens OX=9606 GN=DNM2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	290-UNIMOD:267	0.01	25.0	2	1	0
PRT	sp|P16422|EPCAM_HUMAN	Epithelial cell adhesion molecule OS=Homo sapiens OX=9606 GN=EPCAM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	218-UNIMOD:188	0.05	25.0	1	1	1
PRT	sp|Q9Y4L1|HYOU1_HUMAN	Hypoxia up-regulated protein 1 OS=Homo sapiens OX=9606 GN=HYOU1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q99878|H2A1J_HUMAN	Histone H2A type 1-J OS=Homo sapiens OX=9606 GN=H2AC14 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.16	25.0	1	1	1
PRT	sp|Q99613-2|EIF3C_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit C OS=Homo sapiens OX=9606 GN=EIF3C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|Q96C90|PP14B_HUMAN	Protein phosphatase 1 regulatory subunit 14B OS=Homo sapiens OX=9606 GN=PPP1R14B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.18	25.0	1	1	1
PRT	sp|P47895|AL1A3_HUMAN	Aldehyde dehydrogenase family 1 member A3 OS=Homo sapiens OX=9606 GN=ALDH1A3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	150-UNIMOD:188,154-UNIMOD:188	0.03	25.0	1	1	1
PRT	sp|Q04323|UBXN1_HUMAN	UBX domain-containing protein 1 OS=Homo sapiens OX=9606 GN=UBXN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.11	25.0	1	1	1
PRT	sp|P0DMV8|HS71A_HUMAN	Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|P26038|MOES_HUMAN	Moesin OS=Homo sapiens OX=9606 GN=MSN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	25.0	null	371-UNIMOD:267,379-UNIMOD:267	0.04	25.0	2	2	2
PRT	sp|P55265|DSRAD_HUMAN	Double-stranded RNA-specific adenosine deaminase OS=Homo sapiens OX=9606 GN=ADAR PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.01	25.0	1	1	0
PRT	sp|Q16629|SRSF7_HUMAN	Serine/arginine-rich splicing factor 7 OS=Homo sapiens OX=9606 GN=SRSF7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.05	25.0	1	1	0
PRT	sp|Q8NBJ7|SUMF2_HUMAN	Inactive C-alpha-formylglycine-generating enzyme 2 OS=Homo sapiens OX=9606 GN=SUMF2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.05	25.0	1	1	0
PRT	sp|P14324|FPPS_HUMAN	Farnesyl pyrophosphate synthase OS=Homo sapiens OX=9606 GN=FDPS PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	null	81-UNIMOD:28,92-UNIMOD:267	0.03	25.0	1	1	1
PRT	sp|P78367|NKX32_HUMAN	Homeobox protein Nkx-3.2 OS=Homo sapiens OX=9606 GN=NKX3-2 PE=2 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.08	25.0	1	1	1
PRT	sp|Q9H3U1-3|UN45A_HUMAN	Isoform 3 of Protein unc-45 homolog A OS=Homo sapiens OX=9606 GN=UNC45A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	127-UNIMOD:267,131-UNIMOD:4,133-UNIMOD:267	0.09	24.0	1	1	1
PRT	sp|O60763|USO1_HUMAN	General vesicular transport factor p115 OS=Homo sapiens OX=9606 GN=USO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	678-UNIMOD:4	0.03	24.0	1	1	1
PRT	sp|P50151|GBG10_HUMAN	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-10 OS=Homo sapiens OX=9606 GN=GNG10 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	60-UNIMOD:267,63-UNIMOD:267	0.28	24.0	1	1	1
PRT	sp|Q9UQ35-3|SRRM2_HUMAN	Isoform 3 of Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.07	24.0	1	1	1
PRT	sp|Q14247-3|SRC8_HUMAN	Isoform 3 of Src substrate cortactin OS=Homo sapiens OX=9606 GN=CTTN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	2	2	2
PRT	sp|Q96L21|RL10L_HUMAN	60S ribosomal protein L10-like OS=Homo sapiens OX=9606 GN=RPL10L PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.06	24.0	1	1	1
PRT	sp|P62249|RS16_HUMAN	40S ribosomal protein S16 OS=Homo sapiens OX=9606 GN=RPS16 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.09	24.0	1	1	1
PRT	sp|Q9UL25|RAB21_HUMAN	Ras-related protein Rab-21 OS=Homo sapiens OX=9606 GN=RAB21 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	177-UNIMOD:4	0.06	24.0	1	1	1
PRT	sp|P63000|RAC1_HUMAN	Ras-related C3 botulinum toxin substrate 1 OS=Homo sapiens OX=9606 GN=RAC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.06	24.0	1	1	1
PRT	sp|Q9BT78-2|CSN4_HUMAN	Isoform 2 of COP9 signalosome complex subunit 4 OS=Homo sapiens OX=9606 GN=COPS4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	290-UNIMOD:188	0.05	24.0	1	1	1
PRT	sp|Q13126-7|MTAP_HUMAN	Isoform 7 of S-methyl-5'-thioadenosine phosphorylase OS=Homo sapiens OX=9606 GN=MTAP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	136-UNIMOD:4,145-UNIMOD:4	0.06	24.0	1	1	1
PRT	sp|P55957|BID_HUMAN	BH3-interacting domain death agonist OS=Homo sapiens OX=9606 GN=BID PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	99-UNIMOD:267	0.06	24.0	1	1	1
PRT	sp|P48449|ERG7_HUMAN	Lanosterol synthase OS=Homo sapiens OX=9606 GN=LSS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	672-UNIMOD:267	0.01	24.0	2	1	0
PRT	sp|O94925-3|GLSK_HUMAN	Isoform 3 of Glutaminase kidney isoform, mitochondrial OS=Homo sapiens OX=9606 GN=GLS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	568-UNIMOD:188	0.03	24.0	1	1	1
PRT	sp|P16144-4|ITB4_HUMAN	Isoform Beta-4D of Integrin beta-4 OS=Homo sapiens OX=9606 GN=ITGB4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	1726-UNIMOD:267	0.01	24.0	2	1	0
PRT	sp|Q86XP3-2|DDX42_HUMAN	Isoform 2 of ATP-dependent RNA helicase DDX42 OS=Homo sapiens OX=9606 GN=DDX42	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	2	1	0
PRT	sp|P49189-2|AL9A1_HUMAN	Isoform 2 of 4-trimethylaminobutyraldehyde dehydrogenase OS=Homo sapiens OX=9606 GN=ALDH9A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|O95628-5|CNOT4_HUMAN	Isoform 5 of CCR4-NOT transcription complex subunit 4 OS=Homo sapiens OX=9606 GN=CNOT4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	53-UNIMOD:4,56-UNIMOD:4	0.03	24.0	1	1	1
PRT	sp|Q9HAU5|RENT2_HUMAN	Regulator of nonsense transcripts 2 OS=Homo sapiens OX=9606 GN=UPF2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|P27361-2|MK03_HUMAN	Isoform 2 of Mitogen-activated protein kinase 3 OS=Homo sapiens OX=9606 GN=MAPK3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|Q8N684-2|CPSF7_HUMAN	Isoform 2 of Cleavage and polyadenylation specificity factor subunit 7 OS=Homo sapiens OX=9606 GN=CPSF7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	148-UNIMOD:188,154-UNIMOD:188	0.03	24.0	1	1	1
PRT	sp|Q5T9A4|ATD3B_HUMAN	ATPase family AAA domain-containing protein 3B OS=Homo sapiens OX=9606 GN=ATAD3B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|P78344-2|IF4G2_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 4 gamma 2 OS=Homo sapiens OX=9606 GN=EIF4G2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q00169|PIPNA_HUMAN	Phosphatidylinositol transfer protein alpha isoform OS=Homo sapiens OX=9606 GN=PITPNA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	74-UNIMOD:35,86-UNIMOD:188	0.05	24.0	1	1	1
PRT	sp|P28331-3|NDUS1_HUMAN	Isoform 3 of NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q8IWX8|CHERP_HUMAN	Calcium homeostasis endoplasmic reticulum protein OS=Homo sapiens OX=9606 GN=CHERP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q16881-7|TRXR1_HUMAN	Isoform 7 of Thioredoxin reductase 1, cytoplasmic OS=Homo sapiens OX=9606 GN=TXNRD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	1	1	0
PRT	sp|O94776-2|MTA2_HUMAN	Isoform 2 of Metastasis-associated protein MTA2 OS=Homo sapiens OX=9606 GN=MTA2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|Q04828|AK1C1_HUMAN	Aldo-keto reductase family 1 member C1 OS=Homo sapiens OX=9606 GN=AKR1C1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|P51531-2|SMCA2_HUMAN	Isoform Short of Probable global transcription activator SNF2L2 OS=Homo sapiens OX=9606 GN=SMARCA2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|O60701-3|UGDH_HUMAN	Isoform 3 of UDP-glucose 6-dehydrogenase OS=Homo sapiens OX=9606 GN=UGDH	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q96LD4|TRI47_HUMAN	E3 ubiquitin-protein ligase TRIM47 OS=Homo sapiens OX=9606 GN=TRIM47 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	176-UNIMOD:267,182-UNIMOD:4,184-UNIMOD:267	0.02	24.0	2	1	0
PRT	sp|Q03252|LMNB2_HUMAN	Lamin-B2 OS=Homo sapiens OX=9606 GN=LMNB2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q7Z4W1|DCXR_HUMAN	L-xylulose reductase OS=Homo sapiens OX=9606 GN=DCXR PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|P05091|ALDH2_HUMAN	Aldehyde dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ALDH2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|P48643-2|TCPE_HUMAN	Isoform 2 of T-complex protein 1 subunit epsilon OS=Homo sapiens OX=9606 GN=CCT5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	314-UNIMOD:4	0.02	24.0	1	1	1
PRT	sp|Q9GZY6-2|NTAL_HUMAN	Isoform 2 of Linker for activation of T-cells family member 2 OS=Homo sapiens OX=9606 GN=LAT2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	46-UNIMOD:267,56-UNIMOD:267	0.13	24.0	2	1	0
PRT	sp|Q9Y4E1-5|WAC2C_HUMAN	Isoform 5 of WASH complex subunit 2C OS=Homo sapiens OX=9606 GN=WASHC2C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q9BQG0|MBB1A_HUMAN	Myb-binding protein 1A OS=Homo sapiens OX=9606 GN=MYBBP1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q9Y5L0-5|TNPO3_HUMAN	Isoform 4 of Transportin-3 OS=Homo sapiens OX=9606 GN=TNPO3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|P83731|RL24_HUMAN	60S ribosomal protein L24 OS=Homo sapiens OX=9606 GN=RPL24 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	27-UNIMOD:188,35-UNIMOD:188	0.08	24.0	2	1	0
PRT	sp|P13645|K1C10_HUMAN	Keratin, type I cytoskeletal 10 OS=Homo sapiens OX=9606 GN=KRT10 PE=1 SV=6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.05	24.0	1	1	1
PRT	sp|Q9Y265-2|RUVB1_HUMAN	Isoform 2 of RuvB-like 1 OS=Homo sapiens OX=9606 GN=RUVBL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	162-UNIMOD:188	0.03	24.0	1	1	1
PRT	sp|Q15056-2|IF4H_HUMAN	Isoform Short of Eukaryotic translation initiation factor 4H OS=Homo sapiens OX=9606 GN=EIF4H	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	217-UNIMOD:267,219-UNIMOD:267	0.11	24.0	1	1	1
PRT	sp|O00764|PDXK_HUMAN	Pyridoxal kinase OS=Homo sapiens OX=9606 GN=PDXK PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	16-UNIMOD:267	0.04	24.0	1	1	1
PRT	sp|Q14008-2|CKAP5_HUMAN	Isoform 2 of Cytoskeleton-associated protein 5 OS=Homo sapiens OX=9606 GN=CKAP5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|P25205|MCM3_HUMAN	DNA replication licensing factor MCM3 OS=Homo sapiens OX=9606 GN=MCM3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	37-UNIMOD:267,46-UNIMOD:267	0.01	24.0	1	1	1
PRT	sp|Q15075|EEA1_HUMAN	Early endosome antigen 1 OS=Homo sapiens OX=9606 GN=EEA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q8N6H7-3|ARFG2_HUMAN	Isoform 3 of ADP-ribosylation factor GTPase-activating protein 2 OS=Homo sapiens OX=9606 GN=ARFGAP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	90-UNIMOD:188,103-UNIMOD:267	0.06	24.0	1	1	1
PRT	sp|O75369|FLNB_HUMAN	Filamin-B OS=Homo sapiens OX=9606 GN=FLNB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	758-UNIMOD:188,769-UNIMOD:4,782-UNIMOD:188,2003-UNIMOD:267,2004-UNIMOD:267	0.02	24.0	2	2	2
PRT	sp|P50991|TCPD_HUMAN	T-complex protein 1 subunit delta OS=Homo sapiens OX=9606 GN=CCT4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	410-UNIMOD:4,413-UNIMOD:267	0.02	24.0	2	1	0
PRT	sp|P23246|SFPQ_HUMAN	Splicing factor, proline- and glutamine-rich OS=Homo sapiens OX=9606 GN=SFPQ PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	421-UNIMOD:188,425-UNIMOD:267	0.02	24.0	1	1	1
PRT	sp|Q9NSD9|SYFB_HUMAN	Phenylalanine--tRNA ligase beta subunit OS=Homo sapiens OX=9606 GN=FARSB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	571-UNIMOD:188	0.02	24.0	1	1	1
PRT	sp|O43324|MCA3_HUMAN	Eukaryotic translation elongation factor 1 epsilon-1 OS=Homo sapiens OX=9606 GN=EEF1E1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null	157-UNIMOD:28	0.06	24.0	1	1	1
PRT	sp|P57740|NU107_HUMAN	Nuclear pore complex protein Nup107 OS=Homo sapiens OX=9606 GN=NUP107 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	72-UNIMOD:267,78-UNIMOD:4,85-UNIMOD:188	0.02	24.0	1	1	0
PRT	sp|P13861|KAP2_HUMAN	cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	271-UNIMOD:35,272-UNIMOD:188,280-UNIMOD:188	0.03	24.0	1	1	1
PRT	sp|Q92621|NU205_HUMAN	Nuclear pore complex protein Nup205 OS=Homo sapiens OX=9606 GN=NUP205 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|P62263|RS14_HUMAN	40S ribosomal protein S14 OS=Homo sapiens OX=9606 GN=RPS14 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null	85-UNIMOD:385,85-UNIMOD:4,86-UNIMOD:188,96-UNIMOD:188	0.09	24.0	1	1	1
PRT	sp|Q96T23|RSF1_HUMAN	Remodeling and spacing factor 1 OS=Homo sapiens OX=9606 GN=RSF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	195-UNIMOD:267,206-UNIMOD:188	0.01	24.0	1	1	0
PRT	sp|O60739|EIF1B_HUMAN	Eukaryotic translation initiation factor 1b OS=Homo sapiens OX=9606 GN=EIF1B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	69-UNIMOD:4	0.23	24.0	1	1	1
PRT	sp|Q9NVA2|SEP11_HUMAN	Septin-11 OS=Homo sapiens OX=9606 GN=SEPTIN11 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	327-UNIMOD:267,336-UNIMOD:188	0.03	24.0	1	1	1
PRT	sp|P04844|RPN2_HUMAN	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Homo sapiens OX=9606 GN=RPN2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null	524-UNIMOD:28	0.02	24.0	1	1	1
PRT	sp|P19367|HXK1_HUMAN	Hexokinase-1 OS=Homo sapiens OX=9606 GN=HK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	254-UNIMOD:267	0.01	24.0	1	1	0
PRT	sp|Q96HS1|PGAM5_HUMAN	Serine/threonine-protein phosphatase PGAM5, mitochondrial OS=Homo sapiens OX=9606 GN=PGAM5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	88-UNIMOD:188,93-UNIMOD:188	0.06	24.0	1	1	0
PRT	sp|P51828|ADCY7_HUMAN	Adenylate cyclase type 7 OS=Homo sapiens OX=9606 GN=ADCY7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	6-UNIMOD:267,24-UNIMOD:188	0.02	24.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	NLHQSGFSLSGAQIDDNIPR	1	sp|Q16555|DPYL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0		ms_run[2]:scan=7911	48.795	2	2168.061	2168.0610	R	R	533	553
PSM	NLHQSGFSLSGAQIDDNIPR	2	sp|Q16555|DPYL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	20-UNIMOD:267	ms_run[2]:scan=7913	48.806	2	2178.0693	2178.0693	R	R	533	553
PSM	IEHTYTGGVDSDLGEAMSDCDPDGPLMCHTTK	3	sp|Q15029-2|U5S1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	20-UNIMOD:4,28-UNIMOD:4	ms_run[2]:scan=8388	51.849	3	3508.4527	3508.4527	K	M	414	446
PSM	FVPYLIAGIQHSCQDIGAK	4	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	13-UNIMOD:4,19-UNIMOD:188	ms_run[2]:scan=10075	62.495	2	2122.0977	2122.0977	K	S	456	475
PSM	AKGILFVGSGVSGGEEGAR	5	sp|P52209-2|6PGD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0		ms_run[2]:scan=6609	41.033	2	1789.9323	1789.9323	K	Y	105	124
PSM	FGVPVIADGGIQNVGHIAK	6	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0		ms_run[2]:scan=9343	57.86	2	1891.0316	1891.0316	R	A	357	376
PSM	GHSTCLSEGALSPDGTVLATASHDGYVK	7	sp|Q6P2E9|EDC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	5-UNIMOD:4	ms_run[2]:scan=7603	46.953	3	2829.3239	2829.3239	K	F	295	323
PSM	HTGPGILSMANAGPNTNGSQFFICTAK	8	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	47.0	9-UNIMOD:35,24-UNIMOD:4,27-UNIMOD:188	ms_run[1]:scan=8874	54.912281666666665	2	2813.323078	2812.336813	K	T	92	119
PSM	IGEHTPSALAIMENANVLAR	9	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	20-UNIMOD:267	ms_run[2]:scan=10647	66.213	2	2116.0974	2116.0974	K	Y	154	174
PSM	IGEHTPSALAIMENANVLAR	10	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0		ms_run[2]:scan=10650	66.231	2	2106.0892	2106.0892	K	Y	154	174
PSM	LGHPEALSAGTGSPQPPSFTYAQQR	11	sp|Q15942-2|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	25-UNIMOD:267	ms_run[2]:scan=6842	42.421	2	2606.2753	2606.2753	K	E	139	164
PSM	MHSPQTSAMLFTVDNEAGK	12	sp|P49588|SYAC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	1-UNIMOD:35	ms_run[2]:scan=6930	42.93	2	2078.9401	2078.9401	K	I	880	899
PSM	NSSYVHGGLDSNGKPADAVYGQK	13	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0		ms_run[2]:scan=4192	26.916	2	2363.1142	2363.1142	K	E	37	60
PSM	HSAPGLLSMANSGPSTNGCQFFITCSK	14	sp|O43447|PPIH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46.0	19-UNIMOD:4,25-UNIMOD:4	ms_run[1]:scan=10161	63.066051666666674	3	2869.288989	2868.299319	R	C	104	131
PSM	ACVVHGSDLKDMTSEQLDDILK	15	sp|P05023-3|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	2-UNIMOD:4,10-UNIMOD:188,22-UNIMOD:188	ms_run[2]:scan=9571	59.291	3	2485.2231	2485.2231	K	Y	631	653
PSM	GGVDTAAAPAGGAPPAHAPGPGR	16	sp|Q14657|LAGE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=3194	21.077	2	1950.966	1950.9660	R	D	25	48
PSM	HILLAVANDEELNQLLK	17	sp|O75367-2|H2AY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	17-UNIMOD:188	ms_run[2]:scan=11098	69.232	2	1938.0882	1938.0882	R	G	80	97
PSM	HSPTEDEESAKAEADAYIR	18	sp|P46821|MAP1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=5791	36.145	2	2117.9502	2117.9502	K	E	969	988
PSM	LGHPEALSAGTGSPQPPSFTYAQQR	19	sp|Q15942-2|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=6836	42.388	2	2596.267	2596.2670	K	E	139	164
PSM	LKEGDTIIVPGVEGPIVTQIR	20	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=10006	62.058	2	2233.2682	2233.2682	R	G	882	903
PSM	VNIEGGAIALGHPLGASGCR	21	sp|Q9BWD1|THIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	19-UNIMOD:4,20-UNIMOD:267	ms_run[2]:scan=7457	46.083	2	1958.0031	1958.0031	K	I	342	362
PSM	QQSHFAMMHGGTGFAGIDSSSPEVK	22	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	45.0	1-UNIMOD:28	ms_run[1]:scan=7959	49.083215	3	2588.1446	2588.1419	R	G	244	269
PSM	ALVSHNGSLINVGSLLQR	23	sp|Q8N163-2|CCAR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=9797	60.73	2	1877.0483	1877.0483	K	A	801	819
PSM	FVPYLIAGIQHSCQDIGAK	24	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	13-UNIMOD:4	ms_run[2]:scan=10106	62.692	2	2116.0775	2116.0775	K	S	456	475
PSM	GHVFEESQVAGTPMFVVK	25	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	18-UNIMOD:188	ms_run[2]:scan=8493	52.497	2	1966.9918	1966.9918	R	A	768	786
PSM	HLCEPGADGAETFADGVPR	26	sp|Q14839|CHD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	3-UNIMOD:4	ms_run[2]:scan=6479	40.258	2	1997.8901	1997.8901	R	E	1466	1485
PSM	IGEHTPSALAIMENANVLAR	27	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=10797	67.232	2	2106.0892	2106.0892	K	Y	154	174
PSM	KTVLGTPEVLLGALPGAGGTQR	28	sp|P40939|ECHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=10558	65.637	2	2134.211	2134.2110	R	L	166	188
PSM	NSSYVHGGLDSNGKPADAVYGQK	29	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	14-UNIMOD:188,23-UNIMOD:188	ms_run[2]:scan=4189	26.899	2	2375.1545	2375.1545	K	E	37	60
PSM	QLFHPEQLITGKEDAANNYAR	30	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	44.0	1-UNIMOD:28,12-UNIMOD:188,21-UNIMOD:267	ms_run[1]:scan=9546	59.128780000000006	2	2413.2017	2413.1992	R	G	85	106
PSM	ALVSHNGSLINVGSLLQR	31	sp|Q8N163|CCAR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	18-UNIMOD:267	ms_run[1]:scan=9796	60.72376833333333	2	1888.063051	1887.056564	K	A	801	819
PSM	QQSHFAMMHGGTGFAGIDSSSPEVK	32	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	44.0	1-UNIMOD:28,25-UNIMOD:188	ms_run[1]:scan=7933	48.92735333333333	3	2594.1650	2594.1620	R	G	244	269
PSM	DLSHIGDAVVISCAKDGVK	33	sp|P12004|PCNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	13-UNIMOD:4	ms_run[2]:scan=7424	45.891	2	1983.0095	1983.0095	R	F	150	169
PSM	FSHLTSLPQQLPSQQLMSK	34	sp|Q6PKG0-3|LARP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=8325	51.453	2	2169.1252	2169.1252	R	D	502	521
PSM	HFIMQVVCEATQCPDTR	35	sp|Q14974-2|IMB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	4-UNIMOD:35,8-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=7122	44.074	2	2106.9285	2106.9285	R	V	71	88
PSM	NMVHPNVICDGCNGPVVGTR	36	sp|Q13501|SQSTM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	9-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=5922	36.926	2	2195.0034	2195.0034	R	Y	120	140
PSM	RPTEICADPQFIIGGATR	37	sp|P17655|CAN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:267,6-UNIMOD:4,18-UNIMOD:267	ms_run[2]:scan=7939	48.964	2	2021.0267	2021.0267	K	T	77	95
PSM	TAHLDEEVNKGDILVVATGQPEMVK	38	sp|P11586|C1TC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=8344	51.571	2	2692.3742	2692.3742	K	G	199	224
PSM	TFLRPSPEDEAIYGPNTK	39	sp|Q9UDY2-5|ZO2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=6752	41.889	2	2034.0058	2034.0058	R	M	494	512
PSM	ACVVHGSDLKDMTSEQLDDILK	40	sp|P05023-3|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	2-UNIMOD:4	ms_run[2]:scan=9573	59.3	3	2473.1829	2473.1829	K	Y	631	653
PSM	AFPQLGGRPGPEGEGSLESQPPPLQTQACPESSCLR	41	sp|O94992|HEXI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	29-UNIMOD:4,34-UNIMOD:4	ms_run[2]:scan=8496	52.52	3	3833.8101	3833.8101	R	E	51	87
PSM	DQPAFTPSGILTPHALGSR	42	sp|Q9H0D6-2|XRN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	19-UNIMOD:267	ms_run[2]:scan=9152	56.639	2	1974.0198	1974.0198	R	N	352	371
PSM	EAEKLESEHPDQAQAILSR	43	sp|Q01082-3|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=4919	31.054	2	2150.0604	2150.0604	K	L	1005	1024
PSM	FGVPVIADGGIQNVGHIAK	44	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	19-UNIMOD:188	ms_run[2]:scan=9340	57.843	2	1897.0517	1897.0517	R	A	357	376
PSM	FRQDLMNIAGTTLSSK	45	sp|P78371-2|TCPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=8447	52.207	2	1780.9142	1780.9142	K	L	108	124
PSM	GPGGSSLLIEALSNSSHK	46	sp|Q9BSH4|TACO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	18-UNIMOD:188	ms_run[2]:scan=9172	56.767	2	1758.9208	1758.9208	R	C	142	160
PSM	HEPLVLFCESCDTLTCR	47	sp|Q13263-2|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	8-UNIMOD:4,11-UNIMOD:4,16-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=8896	55.049	2	2145.9521	2145.9521	K	D	132	149
PSM	HILLAVANDEELNQLLK	48	sp|O75367-2|H2AY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=11099	69.238	2	1932.068	1932.0680	R	G	80	97
PSM	HLVGVDSLIGPETQIGEK	49	sp|Q9NR50-3|EI2BG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=8610	53.23	2	1891.0051	1891.0051	K	S	350	368
PSM	HSMNPFCEIAVEEAVR	50	sp|P38117|ETFB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	7-UNIMOD:4	ms_run[2]:scan=9500	58.846	2	1887.8608	1887.8608	K	L	36	52
PSM	HSMNPFCEIAVEEAVR	51	sp|P38117|ETFB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	7-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=9502	58.857	2	1897.869	1897.8690	K	L	36	52
PSM	HTGPNSPDTANDGFVR	52	sp|P55795|HNRH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	16-UNIMOD:267	ms_run[2]:scan=3170	20.948	2	1693.7684	1693.7684	K	L	99	115
PSM	IGDLQAFQGHGAGNLAGLK	53	sp|P08195-2|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	19-UNIMOD:188	ms_run[2]:scan=7894	48.702	2	1871.9949	1871.9949	R	G	126	145
PSM	IGEHTPSALAIMENANVLAR	54	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	20-UNIMOD:267	ms_run[2]:scan=10796	67.226	2	2116.0974	2116.0974	K	Y	154	174
PSM	KFNALFAQGNYSEAAK	55	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=6607	41.022	2	1769.9139	1769.9139	R	V	367	383
PSM	KNLDSTTVAVHGEEIYCK	56	sp|P21291|CSRP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:188,17-UNIMOD:4,18-UNIMOD:188	ms_run[2]:scan=4853	30.7	2	2075.0396	2075.0396	K	S	42	60
PSM	LRGPSGGGEEPALSQYQR	57	sp|Q99567|NUP88_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	2-UNIMOD:267,18-UNIMOD:267	ms_run[2]:scan=4595	29.216	2	1920.9557	1920.9557	R	L	83	101
PSM	LSHEGPGSELPAGALYR	58	sp|Q14203-5|DCTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	17-UNIMOD:267	ms_run[2]:scan=6269	39.003	2	1762.8878	1762.8878	K	K	995	1012
PSM	RDDGTGQLLLPLSDAR	59	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=8414	52.013	2	1745.9175	1745.9175	R	K	3834	3850
PSM	HTGPGILSMANAGPNTNGSQFFICTAK	60	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	9-UNIMOD:35,24-UNIMOD:4,27-UNIMOD:188	ms_run[1]:scan=8872	54.90091999999999	3	2813.323558	2812.336813	K	T	92	119
PSM	HTGPGILSMANAGPNTNGSQFFICTAK	61	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	9-UNIMOD:35,24-UNIMOD:4	ms_run[1]:scan=8875	54.918305000000004	2	2807.303724	2806.316684	K	T	92	119
PSM	ACVVHGSDLKDMTSEQLDDILK	62	sp|P05023-3|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	2-UNIMOD:4,10-UNIMOD:188,22-UNIMOD:188	ms_run[2]:scan=9576	59.317	2	2485.2231	2485.2231	K	Y	631	653
PSM	AFREEFGAEPELAVSAPGR	63	sp|P51570|GALK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=7716	47.65	2	2032.0014	2032.0014	R	V	19	38
PSM	DLSHIGDAVVISCAKDGVK	64	sp|P12004|PCNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	13-UNIMOD:4,15-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=7425	45.898	2	1995.0498	1995.0498	R	F	150	169
PSM	GGVDTAAAPAGGAPPAHAPGPGR	65	sp|Q14657|LAGE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=3193	21.071	3	1950.966	1950.9660	R	D	25	48
PSM	GHVFEESQVAGTPMFVVK	66	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=8498	52.532	2	1960.9717	1960.9717	R	A	768	786
PSM	GVTIASGGVLPNIHPELLAK	67	sp|O75367-2|H2AY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	20-UNIMOD:188	ms_run[2]:scan=10019	62.143	2	1991.1511	1991.1511	K	K	97	117
PSM	HFIDVGAGVIDEDYR	68	sp|P33316-2|DUT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	15-UNIMOD:267	ms_run[2]:scan=8184	50.564	2	1714.819	1714.8190	K	G	92	107
PSM	HFIMQVVCEATQCPDTR	69	sp|Q14974-2|IMB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	4-UNIMOD:35,8-UNIMOD:4,13-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=7119	44.056	2	2116.9368	2116.9368	R	V	71	88
PSM	HFIMQVVCEATQCPDTR	70	sp|Q14974-2|IMB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	8-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=8342	51.56	2	2090.9336	2090.9336	R	V	71	88
PSM	HISPTAPDTLGCYPFYK	71	sp|P49005|DPOD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	12-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=7932	48.921	2	1971.9496	1971.9496	R	T	373	390
PSM	HLLVSNVGGDGEEIER	72	sp|O75694-2|NU155_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	16-UNIMOD:267	ms_run[2]:scan=5525	34.56	2	1732.8619	1732.8619	R	F	463	479
PSM	HLSSCAAPAPLTSAER	73	sp|Q6IBS0|TWF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	5-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=3769	24.409	2	1676.818	1676.8180	K	E	137	153
PSM	HNQLPLVIEFTEQTAPK	74	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=10511	65.329	2	1964.0367	1964.0367	K	I	231	248
PSM	HSGFCLETQNWPDAVNQPR	75	sp|Q96C23|GALM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	5-UNIMOD:4	ms_run[2]:scan=8308	51.347	2	2255.0178	2255.0178	K	F	301	320
PSM	HTGPNSPDTANDGFVR	76	sp|P55795|HNRH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=2995	19.933	2	1683.7601	1683.7601	K	L	99	115
PSM	HTGPNSPDTANDGFVR	77	sp|P55795|HNRH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=3171	20.953	2	1683.7601	1683.7601	K	L	99	115
PSM	IGDLQAFQGHGAGNLAGLK	78	sp|P08195-2|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=7895	48.707	2	1865.9748	1865.9748	R	G	126	145
PSM	ITDSAGHILYSKEDATK	79	sp|P49755|TMEDA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=3706	24.068	2	1847.9265	1847.9265	K	G	76	93
PSM	KGLPQLFCSSSCLTTFSK	80	sp|Q14202-3|ZMYM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	8-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=9772	60.57	2	2060.0071	2060.0071	R	K	328	346
PSM	KICYQEVSQCFGVLSSR	81	sp|Q16531|DDB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=8646	53.454	2	2059.9819	2059.9819	R	I	723	740
PSM	LKAFLASPEYVNLPINGNGK	82	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	2-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=9754	60.453	2	2156.2032	2156.2032	K	Q	190	210
PSM	LLAALLEDEGGSGRPLLQAAK	83	sp|Q9Y490|TLN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=10045	62.311	2	2121.1794	2121.1794	K	G	593	614
PSM	LRGPSGGGEEPALSQYQR	84	sp|Q99567|NUP88_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=4596	29.222	2	1900.9391	1900.9391	R	L	83	101
PSM	LSHEGPGSELPAGALYR	85	sp|Q14203-5|DCTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=6266	38.986	2	1752.8795	1752.8795	K	K	995	1012
PSM	MMANGILKVPAINVNDSVTK	86	sp|P23526-2|SAHH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:35	ms_run[2]:scan=8726	53.944	2	2130.1177	2130.1177	K	S	139	159
PSM	NKETLGSEAVSSNVIDYGHASK	87	sp|Q14966-2|ZN638_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=5667	35.394	2	2305.1186	2305.1186	R	Y	195	217
PSM	PNIVLFSGSSHQDLSQR	88	sp|P11908|PRPS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=7064	43.72	2	1883.949	1883.9490	M	V	2	19
PSM	PNIVLFSGSSHQDLSQR	89	sp|P11908|PRPS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	17-UNIMOD:267	ms_run[2]:scan=7069	43.749	2	1893.9572	1893.9572	M	V	2	19
PSM	RFDEILEASDGIMVAR	90	sp|P14618-3|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=9888	61.314	2	1820.9091	1820.9091	R	G	264	280
PSM	RNFILDQCNVYNSGQR	91	sp|Q1KMD3|HNRL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	8-UNIMOD:4	ms_run[2]:scan=6519	40.502	2	1982.9381	1982.9381	K	R	531	547
PSM	RNFILDQTNVSAAAQR	92	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=6353	39.489	2	1802.9387	1802.9387	K	R	556	572
PSM	RNFILDQTNVSAAAQR	93	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=6363	39.55	2	1822.9553	1822.9553	K	R	556	572
PSM	SDKDLETQVIQLNEQVHSLK	94	sp|Q15555-4|MARE2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=9409	58.284	2	2323.202	2323.2020	K	L	183	203
PSM	TERPVNSAALSPNYDHVVLGGGQEAMDVTTTSTR	95	sp|Q13347|EIF3I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:267,34-UNIMOD:267	ms_run[2]:scan=8146	50.31	3	3592.7331	3592.7331	R	I	228	262
PSM	VKNSQSFFSGLFGGSSK	96	sp|P54920|SNAA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=10171	63.131	2	1775.8842	1775.8842	K	I	21	38
PSM	VLDSGAPIKIPVGPETLGR	97	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=8927	55.242	2	1918.0888	1918.0888	K	I	125	144
PSM	YTHAANTVVYSSNKIDDTIR	98	sp|Q6UXN9|WDR82_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=5223	32.812	2	2267.1182	2267.1182	R	Y	71	91
PSM	GLVHAAGPGQDSGSQAGSPPTR	99	sp|Q96ER9|MITOK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	22-UNIMOD:267	ms_run[1]:scan=2645	17.79297	2	2055.982115	2055.996148	R	D	271	293
PSM	AAVSHWQQQSYLDSGIHSGATTTAPSLSGK	100	sp|P35222|CTNB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	30-UNIMOD:188	ms_run[2]:scan=6777	42.038	3	3090.5102	3090.5102	K	G	20	50
PSM	ACVVHGSDLKDMTSEQLDDILK	101	sp|P05023-3|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	2-UNIMOD:4	ms_run[2]:scan=9590	59.403	2	2473.1829	2473.1829	K	Y	631	653
PSM	AIEPPPLDAVIEAEHTLR	102	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	18-UNIMOD:267	ms_run[2]:scan=11513	71.983	2	1980.0556	1980.0556	K	E	820	838
PSM	DAKDYADSIHAIFVETSAK	103	sp|Q9UL26|RB22A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=10030	62.213	2	2092.0516	2092.0516	R	N	132	151
PSM	FFDHSGTLVMDAYEPEISR	104	sp|Q15005|SPCS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=9620	59.594	2	2213.0099	2213.0099	K	L	196	215
PSM	FVIGGPQGDAGLTGRK	105	sp|P31153|METK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=5927	36.954	2	1571.842	1571.8420	R	I	250	266
PSM	GHSTCLSEGALSPDGTVLATASHDGYVK	106	sp|Q6P2E9|EDC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	5-UNIMOD:4	ms_run[2]:scan=7620	47.061	2	2829.3239	2829.3239	K	F	295	323
PSM	HFPIEIDSTDYVSSGPSVR	107	sp|P82673-2|RT35_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=8547	52.841	2	2105.0065	2105.0065	K	N	146	165
PSM	HLVGVDSLIGPETQIGEK	108	sp|Q9NR50-3|EI2BG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	18-UNIMOD:188	ms_run[2]:scan=8609	53.224	2	1897.0252	1897.0252	K	S	350	368
PSM	HSGFCLETQNWPDAVNQPR	109	sp|Q96C23|GALM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	5-UNIMOD:4,19-UNIMOD:267	ms_run[2]:scan=8293	51.252	2	2265.0261	2265.0261	K	F	301	320
PSM	HSGPNSADSANDGFVR	110	sp|P52597|HNRPF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=2310	15.887	2	1629.7132	1629.7132	K	L	99	115
PSM	IFCCHGGLSPDLQSMEQIR	111	sp|P62136|PP1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:4,4-UNIMOD:4,19-UNIMOD:267	ms_run[2]:scan=8856	54.8	2	2257.0317	2257.0317	K	R	169	188
PSM	IREGMAALQSDPWQQELYR	112	sp|P49748-2|ACADV_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	2-UNIMOD:267,19-UNIMOD:267	ms_run[2]:scan=9330	57.78	2	2310.133	2310.1330	R	N	592	611
PSM	IYGADDIELLPEAQHKAEVYTK	113	sp|P11586|C1TC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=8598	53.155	2	2502.2642	2502.2642	K	Q	833	855
PSM	KELEQVCNPIISGLYQGAGGPGPGGFGAQGPK	114	sp|P0DMV8-2|HS71A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	7-UNIMOD:4	ms_run[2]:scan=10320	64.096	3	3182.5819	3182.5819	R	G	542	574
PSM	KGFSEGLWEIENNPTVK	115	sp|P51858-2|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=8779	54.281	2	1959.014	1959.0140	R	A	73	90
PSM	KGVNLPGAAVDLPAVSEK	116	sp|P14618-3|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=7691	47.501	2	1776.0184	1776.0184	K	D	192	210
PSM	KLLMMAGIDDCYTSAR	117	sp|P15880|RS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	11-UNIMOD:4	ms_run[2]:scan=8116	50.107	2	1843.8631	1843.8631	K	G	212	228
PSM	KLSLGQYDNDAGGQLPFSK	118	sp|Q68CZ2-2|TENS3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=8012	49.408	2	2037.0167	2037.0167	R	C	534	553
PSM	LGDVGMAELCPGLLHPSSR	119	sp|P13489|RINI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	10-UNIMOD:4,19-UNIMOD:267	ms_run[2]:scan=9300	57.589	2	2017.9953	2017.9953	K	L	239	258
PSM	NMVHPNVICDGCNGPVVGTR	120	sp|Q13501|SQSTM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	2-UNIMOD:35,9-UNIMOD:4,12-UNIMOD:4,20-UNIMOD:267	ms_run[2]:scan=5019	31.635	2	2221.0066	2221.0066	R	Y	120	140
PSM	RFDEILEASDGIMVAR	121	sp|P14618-3|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=9892	61.341	2	1840.9256	1840.9256	R	G	264	280
PSM	RFDEILEASDGIMVAR	122	sp|P14618-3|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=9894	61.352	2	1820.9091	1820.9091	R	G	264	280
PSM	TERPVNSAALSPNYDHVVLGGGQEAMDVTTTSTR	123	sp|Q13347|EIF3I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=8126	50.174	3	3572.7165	3572.7165	R	I	228	262
PSM	TVQHQDCSPLSGDYVIEDVQGDDKR	124	sp|Q8N6R0-1|EFNMT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	7-UNIMOD:4	ms_run[2]:scan=7106	43.979	3	2860.2934	2860.2934	R	Y	229	254
PSM	TYGADLASVDFQHASEDARK	125	sp|P30740|ILEU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=6705	41.606	2	2180.0134	2180.0134	K	T	111	131
PSM	VNIEGGAIALGHPLGASGCR	126	sp|Q9BWD1|THIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	19-UNIMOD:4	ms_run[2]:scan=7463	46.118	2	1947.9949	1947.9949	K	I	342	362
PSM	VTHETSAHEGQTEAPSIDEK	127	sp|P15374|UCHL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=1842	13.303	2	2164.9873	2164.9873	R	V	146	166
PSM	YILPDEPAIIVHPNWAAK	128	sp|Q8IX12-2|CCAR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=10429	64.795	2	2046.0938	2046.0938	R	S	706	724
PSM	YRSDGALLLGASSLSGR	129	sp|Q9BQA1-2|MEP50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	2-UNIMOD:267,17-UNIMOD:267	ms_run[2]:scan=7686	47.473	2	1741.9226	1741.9226	R	C	36	53
PSM	VVCDENGSKGYGFVHFETQEAAER	130	sp|P11940|PABP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	3-UNIMOD:4	ms_run[1]:scan=7328	45.30059666666667	3	2729.202302	2728.218744	K	A	130	154
PSM	HTGPGILSMANAGPNTNGSQFFICTAK	131	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	24-UNIMOD:4,27-UNIMOD:188	ms_run[1]:scan=10144	62.954033333333335	3	2797.331850	2796.341898	K	T	92	119
PSM	HSAPGLLSMANSGPSTNGCQFFITCSK	132	sp|O43447|PPIH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	9-UNIMOD:35,19-UNIMOD:4,25-UNIMOD:4,27-UNIMOD:188	ms_run[1]:scan=8839	54.694295	3	2891.300065	2890.314363	R	C	104	131
PSM	QQSHFAMMHGGTGFAGIDSSSPEVK	133	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:28,25-UNIMOD:188	ms_run[1]:scan=8201	50.675821666666664	3	2594.1617	2594.1620	R	G	244	269
PSM	AFPQLGGRPGPEGEGSLESQPPPLQTQACPESSCLR	134	sp|O94992|HEXI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	8-UNIMOD:267,29-UNIMOD:4,34-UNIMOD:4,36-UNIMOD:267	ms_run[2]:scan=8480	52.416	3	3853.8267	3853.8267	R	E	51	87
PSM	ASEDLKTHMVVANTMEDFQK	135	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=7114	44.025	2	2293.0719	2293.0719	R	I	1416	1436
PSM	CSQEDHCLTSDLEDDRK	136	sp|Q9NZU5|LMCD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=3771	24.421	2	2106.8582	2106.8582	K	I	52	69
PSM	DQPAFTPSGILTPHALGSR	137	sp|Q9H0D6-2|XRN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=9143	56.583	2	1964.0116	1964.0116	R	N	352	371
PSM	FEAHPNDLYVEGLPENIPFR	138	sp|P78347-2|GTF2I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=10715	66.657	2	2356.1488	2356.1488	K	S	454	474
PSM	FFGKDISTTLNADEAVAR	139	sp|Q92598-2|HS105_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=8307	51.341	2	1953.9796	1953.9796	K	G	357	375
PSM	GGPNIITLADIVKDPVSR	140	sp|P68400|CSK21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=11378	71.087	2	1864.0418	1864.0418	R	T	90	108
PSM	HFIDVGAGVIDEDYR	141	sp|P33316-2|DUT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=8180	50.537	2	1704.8107	1704.8107	K	G	92	107
PSM	HLLVSNVGGDGEEIER	142	sp|O75694-2|NU155_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=5527	34.571	2	1722.8537	1722.8537	R	F	463	479
PSM	HNQLPLVIEFTEQTAPK	143	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	17-UNIMOD:188	ms_run[2]:scan=10370	64.412	2	1970.0569	1970.0569	K	I	231	248
PSM	HSGNITFDEIVNIAR	144	sp|P30050-2|RL12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	15-UNIMOD:267	ms_run[2]:scan=10088	62.572	2	1694.8616	1694.8616	K	Q	67	82
PSM	HSGNITFDEIVNIAR	145	sp|P30050-2|RL12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=10091	62.594	2	1684.8533	1684.8533	K	Q	67	82
PSM	HSGPNSADSANDGFVR	146	sp|P52597|HNRPF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	16-UNIMOD:267	ms_run[2]:scan=2287	15.748	2	1639.7214	1639.7214	K	L	99	115
PSM	HTYLPLEVCNIVAGQR	147	sp|Q9HCK5|AGO4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	9-UNIMOD:4	ms_run[2]:scan=9616	59.57	2	1868.9567	1868.9567	K	C	326	342
PSM	IGEHTPSALAIMENANVLAR	148	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	12-UNIMOD:35,20-UNIMOD:267	ms_run[2]:scan=7465	46.129	2	2132.0924	2132.0924	K	Y	154	174
PSM	KLSVACFYGGTPYGGQFER	149	sp|Q9NR30-2|DDX21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:4	ms_run[2]:scan=8659	53.537	2	2136.0099	2136.0099	K	M	218	237
PSM	KNQDDFECVTTLEGHENEVK	150	sp|O76071|CIAO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	8-UNIMOD:4	ms_run[2]:scan=6195	38.552	3	2391.0649	2391.0649	K	S	90	110
PSM	KQGGLGPMNIPLVSDPK	151	sp|Q06830|PRDX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=8549	52.857	2	1749.9447	1749.9447	K	R	93	110
PSM	KQSLGELIGTLNAAK	152	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=8747	54.081	2	1553.918	1553.9180	R	V	56	71
PSM	LADVDKDGLLDDEEFALANHLIK	153	sp|Q9H4M9|EHD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:188,23-UNIMOD:188	ms_run[2]:scan=11286	70.476	3	2565.3365	2565.3365	K	V	487	510
PSM	LADVDKDGLLDDEEFALANHLIK	154	sp|Q9H4M9|EHD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=11294	70.53	3	2553.2962	2553.2962	K	V	487	510
PSM	LLHPSPDLVSQEATLSEAR	155	sp|Q8IY22-3|CMIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=7609	46.993	2	2062.0695	2062.0695	R	L	220	239
PSM	NGGLGHMNIALLSDLTK	156	sp|P30048-2|PRDX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=11114	69.333	2	1752.9193	1752.9193	K	Q	132	149
PSM	NKEDQYDHLDAADMTK	157	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=4345	27.786	2	1892.8211	1892.8211	K	V	718	734
PSM	NVESGEEELASKLDHYK	158	sp|Q96HS1-2|PGAM5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=7223	44.667	2	1946.9222	1946.9222	R	A	77	94
PSM	SAFEEEGKETADITHALSK	159	sp|Q15042-4|RB3GP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=7083	43.84	2	2061.9855	2061.9855	R	L	304	323
PSM	SEAEEAITSFNGHKPPGSSEPITVK	160	sp|Q15717|ELAV1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=6696	41.549	2	2611.2766	2611.2766	R	F	158	183
PSM	TKGVDEVTIVNILTNR	161	sp|P07355-2|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=10682	66.433	2	1770.984	1770.9840	K	S	66	82
PSM	VGNPWDPNVLYGPLHTK	162	sp|P49419|AL7A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=9831	60.95	2	1905.9737	1905.9737	R	Q	359	376
PSM	GHVFEESQVAGTPMFVVK	163	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	18-UNIMOD:188	ms_run[1]:scan=8517	52.653290000000005	2	1966.986204	1966.991813	R	A	768	786
PSM	HTGPGILSMANAGPNTNGSQFFICTAK	164	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	9-UNIMOD:35,24-UNIMOD:4,27-UNIMOD:188	ms_run[1]:scan=9141	56.57049333333333	3	2814.308201	2812.336813	K	T	92	119
PSM	IDASKNEEDEGHSNSSPR	165	sp|Q14103|HNRPD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0		ms_run[1]:scan=646	6.857153333333334	2	1971.853114	1970.856590	K	H	68	86
PSM	QLFHPEQLITGKEDAANNYAR	166	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:28	ms_run[1]:scan=9547	59.13494833333333	2	2397.1735	2397.1708	R	G	85	106
PSM	AAAAKPNNLSLVVHGPGDLR	167	sp|Q00796|DHSO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:1	ms_run[2]:scan=7623	47.079	2	2041.1069	2041.1069	M	L	2	22
PSM	AAEAHVDAHYYEQNEQPTGTCAACITGDNR	168	sp|P55263-3|ADK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	21-UNIMOD:4,24-UNIMOD:4	ms_run[2]:scan=5247	32.954	3	3348.416	3348.4160	K	S	120	150
PSM	ADVLDLHEAGGEDFAMDEDGDESIHKLK	169	sp|Q9Y5S9-2|RBM8A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:1,16-UNIMOD:35	ms_run[2]:scan=8850	54.763	3	3113.3772	3113.3772	M	E	2	30
PSM	AIAHYEQSADYYKGEESNSSANK	170	sp|P54920|SNAA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=3686	23.957	3	2561.1306	2561.1306	K	C	141	164
PSM	DHTLEDEDVIQIVKK	171	sp|Q9Y295|DRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	14-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=6943	43.005	2	1792.961	1792.9610	K	-	353	368
PSM	EHAPSIIFMDEIDSIGSSR	172	sp|P62195-2|PRS8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	19-UNIMOD:267	ms_run[2]:scan=11617	72.708	2	2113.0025	2113.0025	R	L	232	251
PSM	FCFTPHTEEGCLSER	173	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	2-UNIMOD:4,11-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=6339	39.408	2	1878.7904	1878.7904	K	A	1117	1132
PSM	GFVPSPTSQPGGHESLVDR	174	sp|P26640|SYVC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=5986	37.31	2	1965.9545	1965.9545	K	W	967	986
PSM	GSGGLFSPSTAHVPDGALGQR	175	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=7409	45.798	2	2009.9919	2009.9919	R	D	1023	1044
PSM	GVTIASGGVLPNIHPELLAK	176	sp|O75367-2|H2AY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=10021	62.155	2	1985.131	1985.1310	K	K	97	117
PSM	IFCCHGGLSPDLQSMEQIR	177	sp|P62136|PP1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:4,4-UNIMOD:4	ms_run[2]:scan=8857	54.806	2	2247.0235	2247.0235	K	R	169	188
PSM	IGGVQQDTILAEGLHFR	178	sp|Q99623-2|PHB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=9795	60.719	2	1852.9795	1852.9795	R	I	55	72
PSM	ITDSAGHILYSKEDATK	179	sp|P49755|TMEDA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	12-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=3708	24.079	2	1859.9668	1859.9668	K	G	76	93
PSM	ITKPGSIDSNNQLFAPGGR	180	sp|Q04637-6|IF4G1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=6067	37.799	2	1971.0174	1971.0174	K	L	876	895
PSM	KANIPIMDTGENPEVPFPR	181	sp|Q93050-1|VPP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=8902	55.088	2	2124.0674	2124.0674	R	D	74	93
PSM	KDYSQYEENITHLQEQIVDGK	182	sp|Q9C075|K1C23_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:188,21-UNIMOD:188	ms_run[2]:scan=9429	58.407	3	2548.2484	2548.2484	K	M	117	138
PSM	KFDFDACNEVPPAPK	183	sp|Q15424-2|SAFB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:188,7-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=6445	40.046	2	1745.8486	1745.8486	R	E	287	302
PSM	KFGYVDFESAEDLEK	184	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=8664	53.565	2	1775.8254	1775.8254	R	A	348	363
PSM	KFLDGNELTLADCNLLPK	185	sp|O00299|CLIC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	13-UNIMOD:4	ms_run[2]:scan=10513	65.341	2	2060.0612	2060.0612	R	L	166	184
PSM	KGFNEGLWEIDNNPK	186	sp|O75475-3|PSIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=7709	47.608	2	1759.8529	1759.8529	R	V	75	90
PSM	KLLMMAGIDDCYTSAR	187	sp|P15880|RS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	11-UNIMOD:4	ms_run[2]:scan=8127	50.18	2	1843.8631	1843.8631	K	G	212	228
PSM	KTFVGTPCWMAPEVMEQVR	188	sp|Q9UEW8-2|STK39_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	8-UNIMOD:4	ms_run[2]:scan=10413	64.692	2	2265.0745	2265.0745	R	G	211	230
PSM	LAQAHPAGPPTLDPVNDLQLK	189	sp|Q15477|SKIV2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=8508	52.596	2	2194.1746	2194.1746	R	D	971	992
PSM	LVEVNGENVEKETHQQVVSR	190	sp|O14745|NHRF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=4990	31.47	2	2293.1662	2293.1662	R	I	59	79
PSM	NITRPFEDQTSLEFFSK	191	sp|Q9H7B2|RPF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=9849	61.066	2	2058.0058	2058.0058	K	K	67	84
PSM	NMVHPNVICDGCNGPVVGTR	192	sp|Q13501|SQSTM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	9-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=5931	36.981	3	2195.0034	2195.0034	R	Y	120	140
PSM	NYLWREENAEQQALAAK	193	sp|Q9UQE7|SMC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=7111	44.009	2	2032.9967	2032.9967	R	R	470	487
PSM	RFDEILEASDGIMVAR	194	sp|P14618-3|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:267,13-UNIMOD:35,16-UNIMOD:267	ms_run[2]:scan=8661	53.548	2	1856.9205	1856.9205	R	G	264	280
PSM	RFDEILEASDGIMVAR	195	sp|P14618-3|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	13-UNIMOD:35	ms_run[2]:scan=8662	53.553	2	1836.904	1836.9040	R	G	264	280
PSM	RFDEILEASDGIMVAR	196	sp|P14618-3|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=9283	57.478	2	1840.9256	1840.9256	R	G	264	280
PSM	SEASLHPVLMSEAPWNTR	197	sp|O96019-2|ACL6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	18-UNIMOD:267	ms_run[2]:scan=8954	55.411	2	2033.9868	2033.9868	K	A	71	89
PSM	SQKADSPSIDYAELLQHFEK	198	sp|Q08AM6-2|VAC14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=10540	65.518	3	2305.1226	2305.1226	K	V	170	190
PSM	SQKADSPSIDYAELLQHFEK	199	sp|Q08AM6-2|VAC14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=10544	65.542	2	2305.1226	2305.1226	K	V	170	190
PSM	TKDEYLINSQTTEHIVK	200	sp|Q9NSE4|SYIM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=5508	34.46	2	2018.032	2018.0320	K	L	539	556
PSM	TNHIYVSSDDIKETGYTYILPK	201	sp|Q6P2Q9|PRP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=8398	51.911	2	2556.2748	2556.2748	R	N	2087	2109
PSM	TNHIYVSSDDIKETGYTYILPK	202	sp|Q6P2Q9|PRP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	12-UNIMOD:188,22-UNIMOD:188	ms_run[2]:scan=8399	51.917	2	2568.315	2568.3150	R	N	2087	2109
PSM	TSPADHGGSVGSESGGSAVDSVAGEHSVSGR	203	sp|Q5T4S7-3|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	31-UNIMOD:267	ms_run[2]:scan=4060	26.134	3	2849.2688	2849.2688	R	S	2860	2891
PSM	TVIKEGEEQLQTQHQK	204	sp|P30876|RPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=3289	21.642	2	1894.9749	1894.9749	K	T	131	147
PSM	VGEVCHITCKPEYAYGSAGSPPK	205	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	5-UNIMOD:4,9-UNIMOD:4,10-UNIMOD:188,23-UNIMOD:188	ms_run[2]:scan=4704	29.828	3	2518.2023	2518.2023	K	I	99	122
PSM	VGEVCHITCKPEYAYGSAGSPPK	206	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	5-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=4710	29.862	3	2506.1621	2506.1621	K	I	99	122
PSM	YRSDGALLLGASSLSGR	207	sp|Q9BQA1-2|MEP50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=7687	47.479	2	1721.906	1721.9060	R	C	36	53
PSM	STPKEETVNDPEEAGHR	208	sp|O00567|NOP56_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0		ms_run[1]:scan=1210	9.81179	2	1894.876727	1894.865698	K	S	537	554
PSM	HTGPGILSMANAGPNTNGSQFFICTAK	209	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	24-UNIMOD:4,27-UNIMOD:188	ms_run[1]:scan=10364	64.37565166666667	3	2797.3282	2796.3412	K	T	92	119
PSM	VKNSQSFFSGLFGGSSK	210	sp|P54920|SNAA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	2-UNIMOD:188,17-UNIMOD:188	ms_run[1]:scan=10170	63.12477	2	1788.948257	1787.924507	K	I	21	38
PSM	LLSDATVEKDESHAGK	211	sp|Q14320|FA50A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	9-UNIMOD:188,16-UNIMOD:188	ms_run[1]:scan=2837	18.97674333333333	2	1710.878403	1710.882702	R	V	290	306
PSM	RGDACEGDSGGPFVMK	212	sp|P00734|THRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	5-UNIMOD:4	ms_run[1]:scan=4469	28.477731666666664	2	1681.717692	1681.718840	K	S	560	576
PSM	LGDVGMAELCPGLLHPSSR	213	sp|P13489|RINI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	10-UNIMOD:4	ms_run[1]:scan=9301	57.595083333333335	2	2007.986847	2007.987017	K	L	239	258
PSM	ALEEDIENHATDVHQAVK	214	sp|Q9UPN3-3|MACF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	18-UNIMOD:188	ms_run[2]:scan=5773	36.03	2	2023.9906	2023.9906	K	I	3375	3393
PSM	ALIEVLQPLIAEHQAR	215	sp|P23381-2|SYWC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	16-UNIMOD:267	ms_run[2]:scan=11017	68.693	2	1810.034	1810.0340	K	R	392	408
PSM	ALPGQLKPFETLLSQNQGGK	216	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=10462	65.012	2	2125.1532	2125.1532	K	T	122	142
PSM	ANAEEMTKYHSDDYIK	217	sp|Q13547|HDAC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=4310	27.583	2	1913.8465	1913.8465	K	F	59	75
PSM	CRPDQLTGLSLLPLSEK	218	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:4	ms_run[2]:scan=10332	64.173	2	1926.0244	1926.0244	R	A	3167	3184
PSM	FAQHGTFEYEYSQR	219	sp|P23246-2|SFPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=5085	32.012	2	1761.7747	1761.7747	R	W	480	494
PSM	GIAFPTSISVNNCVCHFSPLK	220	sp|Q9UQ80|PA2G4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	13-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=10587	65.827	2	2347.1453	2347.1453	K	S	73	94
PSM	GPIKFNVWDTAGQEK	221	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=7884	48.648	2	1688.8522	1688.8522	R	F	57	72
PSM	GPVREGDVLTLLESER	222	sp|P62857|RS28_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=10055	62.374	2	1768.9319	1768.9319	K	E	48	64
PSM	GPVREGDVLTLLESER	223	sp|P62857|RS28_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	4-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=10064	62.428	2	1788.9485	1788.9485	K	E	48	64
PSM	GSSYGVTSTESYKETLHK	224	sp|P98175-4|RBM10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	13-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=4119	26.482	2	1984.9781	1984.9781	R	T	825	843
PSM	GYGFVHFETQEAAER	225	sp|P11940-2|PABP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	15-UNIMOD:267	ms_run[2]:scan=6911	42.818	2	1749.7986	1749.7986	K	A	139	154
PSM	HDADGQATLLNLLLR	226	sp|O43242-2|PSMD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	15-UNIMOD:267	ms_run[2]:scan=12465	78.879	2	1658.8979	1658.8979	R	N	104	119
PSM	HFVCEGCEQLLSGR	227	sp|Q9NZU5|LMCD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	4-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=5917	36.895	2	1690.7556	1690.7556	K	A	332	346
PSM	HLCEPGADGAETFADGVPR	228	sp|Q14839|CHD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:4,19-UNIMOD:267	ms_run[2]:scan=6477	40.241	2	2007.8984	2007.8984	R	E	1466	1485
PSM	HLCEPGADGAETFADGVPR	229	sp|Q14839|CHD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:4,19-UNIMOD:267	ms_run[2]:scan=6500	40.382	2	2007.8984	2007.8984	R	E	1466	1485
PSM	HSMNPFCEIAVEEAVR	230	sp|P38117|ETFB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:35,7-UNIMOD:4	ms_run[2]:scan=8559	52.919	2	1903.8557	1903.8557	K	L	36	52
PSM	HTGPNSPDTANDGFVR	231	sp|P55795|HNRH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	16-UNIMOD:267	ms_run[2]:scan=2991	19.91	2	1693.7684	1693.7684	K	L	99	115
PSM	KASVVTLPVYLNFTR	232	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=10653	66.248	2	1706.9719	1706.9719	K	A	4601	4616
PSM	KGFNEGLWEIDNNPK	233	sp|O75475-3|PSIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=7708	47.602	2	1771.8932	1771.8932	R	V	75	90
PSM	KGVNLPGAAVDLPAVSEK	234	sp|P14618-3|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=7693	47.513	2	1763.9781	1763.9781	K	D	192	210
PSM	KQFGAQANVIGPWIQTK	235	sp|P12814-2|ACTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=8346	51.583	2	1897.0613	1897.0613	R	M	633	650
PSM	KQSLGELIGTLNAAK	236	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=8749	54.093	2	1541.8777	1541.8777	R	V	56	71
PSM	LGLEALAANHQQLFTDGR	237	sp|Q9Y2Z4|SYYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=9365	58.002	2	1953.0068	1953.0068	R	S	146	164
PSM	MRYVASYLLAALGGNSSPSAK	238	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:35	ms_run[2]:scan=10988	68.504	2	2171.1045	2171.1045	-	D	1	22
PSM	MVMIQDGPQNTGADKPLR	239	sp|Q96AE4|FUBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:35	ms_run[2]:scan=4570	29.075	2	1985.9663	1985.9663	K	I	219	237
PSM	MWDPHNDPNAQGDAFK	240	sp|P08621-2|RU17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:35	ms_run[2]:scan=4730	29.977	2	1857.774	1857.7740	K	T	88	104
PSM	MYSTDDGVQFHAFGR	241	sp|Q15029-2|U5S1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:35	ms_run[2]:scan=6791	42.119	2	1745.7468	1745.7468	K	V	446	461
PSM	NDTKEDVFVHQTAIK	242	sp|P16989-2|YBOX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=4328	27.689	2	1743.8792	1743.8792	R	K	110	125
PSM	NENRDISEVIALGVPNPR	243	sp|Q13573|SNW1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=8994	55.663	2	1992.0389	1992.0389	R	T	383	401
PSM	NFFTRYDYEEVEAEGANK	244	sp|P36871-2|PGM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=8009	49.39	2	2180.9651	2180.9651	R	M	441	459
PSM	NGGLGHMNIALLSDLTK	245	sp|P30048-2|PRDX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:35	ms_run[2]:scan=9318	57.704	2	1768.9142	1768.9142	K	Q	132	149
PSM	NGGLGHMNIALLSDLTK	246	sp|P30048-2|PRDX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	17-UNIMOD:188	ms_run[2]:scan=11125	69.409	2	1758.9394	1758.9394	K	Q	132	149
PSM	NKEDQYDHLDAADMTK	247	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=4340	27.761	2	1904.8613	1904.8613	K	V	718	734
PSM	NLEAYAANPHSFVFTR	248	sp|Q9NQ55-2|SSF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=8528	52.722	2	1835.8955	1835.8955	R	G	21	37
PSM	NVTDVVNTCHDAGISKK	249	sp|Q9Y3I0|RTCB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	9-UNIMOD:4	ms_run[2]:scan=3671	23.865	2	1856.9051	1856.9051	K	A	477	494
PSM	REDLVVAPAGITLK	250	sp|P12268|IMDH2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=7561	46.69	2	1480.8613	1480.8613	K	E	182	196
PSM	RTGLFSATQTQEVENLVR	251	sp|Q8NHQ9|DDX55_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=9413	58.308	2	2048.0651	2048.0651	R	A	197	215
PSM	TFVNITPAEVGVLVGKDR	252	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=10778	67.109	2	1914.0575	1914.0575	K	S	39	57
PSM	TNVNGGAIALGHPLGGSGSR	253	sp|P42765|THIM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=5514	34.497	2	1833.9446	1833.9446	K	I	341	361
PSM	VGDFGDAINWPTPGEIAHK	254	sp|Q6PKG0-3|LARP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	19-UNIMOD:188	ms_run[2]:scan=10041	62.283	2	2029.0001	2029.0001	K	S	90	109
PSM	VLDSGAPIKIPVGPETLGR	255	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=8921	55.204	3	1918.0888	1918.0888	K	I	125	144
PSM	VNRLSVLGAITSVQQR	256	sp|P62495-2|ERF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=8883	54.97	2	1760.0172	1760.0172	R	L	33	49
PSM	YCVEEEEKAAEMHK	257	sp|P78347-2|GTF2I_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:4	ms_run[2]:scan=3986	25.662	2	1751.7495	1751.7495	K	M	79	93
PSM	YILPDEPAIIVHPNWAAK	258	sp|Q8IX12-2|CCAR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	18-UNIMOD:188	ms_run[2]:scan=10431	64.807	2	2052.114	2052.1140	R	S	706	724
PSM	YTHAANTVVYSSNKIDDTIR	259	sp|Q6UXN9|WDR82_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=5220	32.797	3	2267.1182	2267.1182	R	Y	71	91
PSM	LGLEALAANHQQLFTDGR	260	sp|Q9Y2Z4|SYYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	18-UNIMOD:267	ms_run[1]:scan=9347	57.88766999999999	2	1963.026336	1963.015093	R	S	146	164
PSM	NFEATLGWLQEHACSR	261	sp|Q9P2J5|SYLC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	14-UNIMOD:4,16-UNIMOD:267	ms_run[1]:scan=10616	66.012005	2	1928.892521	1927.887450	R	T	560	576
PSM	NSSYVHGGLDSNGKPADAVYGQK	262	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=4514	28.737985	2	2364.096099	2363.114202	K	E	37	60
PSM	GLVHAAGPGQDSGSQAGSPPTR	263	sp|Q96ER9|MITOK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=2648	17.809876666666668	2	2045.976053	2045.987879	R	D	271	293
PSM	DKTSDLVEEYFEAHSSSK	264	sp|Q13416|ORC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=8998	55.691125	2	2070.935233	2070.938195	R	V	234	252
PSM	HDADGQATLLNLLLR	265	sp|O43242|PSMD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=12466	78.88480166666668	2	1648.888381	1648.889669	R	N	242	257
PSM	AIMSDKFVTSTSDHFVEGQTVAAK	266	sp|Q14690|RRP5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:188,24-UNIMOD:188	ms_run[2]:scan=7374	45.581	3	2580.2933	2580.2933	K	V	759	783
PSM	AQQNNVEHKVETFSGVYK	267	sp|P62081|RS7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=5663	35.372	2	2077.0229	2077.0229	K	K	161	179
PSM	ASAPSPNAQVACDHCLKEAAVK	268	sp|Q14258|TRI25_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	12-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=4053	26.09	2	2323.1049	2323.1049	R	T	96	118
PSM	ASPNTPPGRVDENGPELLPR	269	sp|Q92616|GCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=6026	37.552	2	2115.0709	2115.0709	R	V	1018	1038
PSM	ATSSGRLPLPSPALEYTLGSR	270	sp|Q8IU81|I2BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=9541	59.096	2	2172.1539	2172.1539	R	L	115	136
PSM	AVTEQGHELSNEERNLLSVAYK	271	sp|P31946-2|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=8436	52.145	2	2486.2401	2486.2401	K	N	28	50
PSM	AYHSFLVEPISCHAWNK	272	sp|O15143|ARC1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:1,12-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=9932	61.59	2	2106.0089	2106.0089	M	D	2	19
PSM	EGPHYTPPIPNYQPPEGR	273	sp|Q9NQ50|RM40_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=6510	40.447	2	2047.9752	2047.9752	K	Y	174	192
PSM	FFSDCKIQNGTSGIR	274	sp|P55795|HNRH2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	5-UNIMOD:4	ms_run[2]:scan=5406	33.845	2	1728.8254	1728.8254	R	F	30	45
PSM	FLLHQETLPEQLLAEK	275	sp|Q8WUM0|NU133_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	16-UNIMOD:188	ms_run[2]:scan=9974	61.853	2	1914.0558	1914.0558	R	Q	1001	1017
PSM	FLLHQETLPEQLLAEK	276	sp|Q8WUM0|NU133_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=9975	61.859	2	1908.0357	1908.0357	R	Q	1001	1017
PSM	FNEEHIPDSPFVVPVASPSGDAR	277	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	23-UNIMOD:267	ms_run[2]:scan=9664	59.876	2	2476.1898	2476.1898	K	R	2303	2326
PSM	FNEEHIPDSPFVVPVASPSGDAR	278	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=9693	60.064	2	2466.1816	2466.1816	K	R	2303	2326
PSM	FRQDLMNIAGTTLSSK	279	sp|P78371-2|TCPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:35	ms_run[2]:scan=6565	40.78	2	1796.9091	1796.9091	K	L	108	124
PSM	GLPCTELFVAPVGVASKR	280	sp|O00515|LAD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	4-UNIMOD:4	ms_run[2]:scan=9437	58.456	2	1900.0241	1900.0241	R	H	425	443
PSM	GPAPGSKPVQFMDFEGK	281	sp|Q8WUX1|S38A5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	7-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=7269	44.95	2	1802.9064	1802.9064	R	T	31	48
PSM	GPIKFNVWDTAGQEK	282	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	4-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=7883	48.644	2	1700.8925	1700.8925	R	F	57	72
PSM	GSSYGVTSTESYKETLHK	283	sp|P98175-4|RBM10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=4129	26.542	2	1972.9378	1972.9378	R	T	825	843
PSM	GYGFVHFETQEAAER	284	sp|P11940-2|PABP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=6912	42.823	2	1739.7903	1739.7903	K	A	139	154
PSM	HAPLADQILAGNAVR	285	sp|Q13895|BYST_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	15-UNIMOD:267	ms_run[2]:scan=6834	42.377	2	1554.8506	1554.8506	K	A	16	31
PSM	HEIEGTGLPQAQLLWR	286	sp|Q96TA1-2|NIBA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	16-UNIMOD:267	ms_run[2]:scan=9450	58.536	2	1856.9772	1856.9773	R	K	33	49
PSM	HEPLVLFCESCDTLTCR	287	sp|Q13263-2|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	8-UNIMOD:4,11-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=8910	55.138	2	2135.9438	2135.9438	K	D	132	149
PSM	HISPTAPDTLGCYPFYK	288	sp|P49005|DPOD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	12-UNIMOD:4	ms_run[2]:scan=7930	48.91	2	1965.9295	1965.9295	R	T	373	390
PSM	HLYECTEEENDNSLEKDIATK	289	sp|Q9NXC5-2|MIO_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	5-UNIMOD:4	ms_run[2]:scan=5810	36.265	2	2537.1228	2537.1228	R	M	373	394
PSM	HNQLPLVIEFTEQTAPK	290	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=10359	64.34	2	1964.0367	1964.0367	K	I	231	248
PSM	HNQLPLVIEFTEQTAPK	291	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	17-UNIMOD:188	ms_run[2]:scan=10520	65.387	2	1970.0569	1970.0569	K	I	231	248
PSM	HQSFVLVGETGSGK	292	sp|O43143|DHX15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	14-UNIMOD:188	ms_run[2]:scan=5010	31.58	2	1450.7512	1450.7512	R	T	153	167
PSM	HTYLPLEVCNIVAGQR	293	sp|Q9HCK5|AGO4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	9-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=9625	59.628	2	1878.965	1878.9650	K	C	326	342
PSM	ICHQIEYYFGDFNLPR	294	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	2-UNIMOD:4	ms_run[2]:scan=11110	69.309	2	2070.9622	2070.9622	K	D	17	33
PSM	IGGVQQDTILAEGLHFR	295	sp|Q99623-2|PHB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	17-UNIMOD:267	ms_run[2]:scan=9794	60.714	2	1862.9878	1862.9878	R	I	55	72
PSM	IPEAPAGPPSDFGLFLSDDDPKK	296	sp|Q9Y490|TLN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	22-UNIMOD:188,23-UNIMOD:188	ms_run[2]:scan=10626	66.077	3	2424.2252	2424.2252	R	G	36	59
PSM	IYGADDIELLPEAQHKAEVYTK	297	sp|P11586|C1TC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	16-UNIMOD:188,22-UNIMOD:188	ms_run[2]:scan=8592	53.117	2	2514.3045	2514.3045	K	Q	833	855
PSM	KFLDGNELTLADCNLLPK	298	sp|O00299|CLIC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:188,13-UNIMOD:4,18-UNIMOD:188	ms_run[2]:scan=10508	65.306	2	2072.1015	2072.1015	R	L	166	184
PSM	KLSVACFYGGTPYGGQFER	299	sp|Q9NR30-2|DDX21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:4	ms_run[2]:scan=8658	53.532	3	2136.0099	2136.0099	K	M	218	237
PSM	KLTFLYLANDVIQNSK	300	sp|Q9NQG5|RPR1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=11761	73.702	2	1878.0654	1878.0654	R	R	56	72
PSM	KPPLLNNADSVQAK	301	sp|P09874|PARP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=3566	23.251	2	1505.8604	1505.8604	K	V	748	762
PSM	KQFGAQANVIGPWIQTK	302	sp|P12814-2|ACTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=8378	51.786	2	1885.021	1885.0210	R	M	633	650
PSM	LASEAKPAAVAAENEEIGSHIK	303	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:188,22-UNIMOD:188	ms_run[2]:scan=5295	33.23	3	2246.1945	2246.1945	R	H	1896	1918
PSM	LKVLATAFDTTLGGR	304	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=8809	54.49	2	1561.8828	1561.8828	K	K	220	235
PSM	LLSRPQDALEGVVLSPSLEAR	305	sp|Q9NVI7|ATD3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=10108	62.704	2	2249.2379	2249.2379	R	V	355	376
PSM	LVSEKVDDYEHAAK	306	sp|O43148|MCES_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	5-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=3343	21.96	2	1614.8292	1614.8292	K	Y	429	443
PSM	MQKEITALAPSTMK	307	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:35,3-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=4843	30.644	2	1575.8403	1575.8403	R	I	313	327
PSM	NFEATLGWLQEHACSR	308	sp|Q9P2J5|SYLC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	14-UNIMOD:4	ms_run[2]:scan=10619	66.035	2	1917.8792	1917.8792	R	T	560	576
PSM	NLVDFLTGEEVVCHVAR	309	sp|Q9H9J2|RM44_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	13-UNIMOD:4	ms_run[2]:scan=11757	73.677	2	1956.9727	1956.9727	K	N	155	172
PSM	NMVHPNVICDGCNGPVVGTR	310	sp|Q13501|SQSTM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	9-UNIMOD:4,12-UNIMOD:4,20-UNIMOD:267	ms_run[2]:scan=5914	36.879	2	2205.0117	2205.0117	R	Y	120	140
PSM	NRLENDGATALAEAFR	311	sp|P46060|RAGP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	2-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=8711	53.855	2	1766.8814	1766.8814	R	V	190	206
PSM	QISRDYGVLLEGSGLALR	312	sp|P30048-2|PRDX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=9969	61.819	2	1946.0585	1946.0585	K	G	149	167
PSM	RGFFICDQPYEPVSPYSCK	313	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:4,18-UNIMOD:4	ms_run[2]:scan=8867	54.867	2	2349.0558	2349.0558	R	E	675	694
PSM	RGPFELEAFYSDPQGVPYPEAK	314	sp|Q92598-2|HS105_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=10527	65.429	2	2496.1961	2496.1961	R	I	437	459
PSM	RPTEICADPQFIIGGATR	315	sp|P17655|CAN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:4	ms_run[2]:scan=7956	49.066	2	2001.0102	2001.0102	K	T	77	95
PSM	SEASLHPVLMSEAPWNTR	316	sp|O96019-2|ACL6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=8955	55.417	2	2023.9786	2023.9786	K	A	71	89
PSM	SPWSNKYDPPLEDGAMPSAR	317	sp|P47756-2|CAPZB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=7388	45.67	2	2217.0161	2217.0161	R	L	73	93
PSM	SSPGQTPEEGAQALAEFAALHGPALR	318	sp|Q14166|TTL12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	26-UNIMOD:267	ms_run[2]:scan=11479	71.757	2	2614.3015	2614.3015	R	A	15	41
PSM	TLHPAPNAPQPCQVSSLSER	319	sp|Q8N3E9|PLCD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	12-UNIMOD:4,20-UNIMOD:267	ms_run[2]:scan=5144	32.357	3	2198.0778	2198.0778	R	K	542	562
PSM	TTLTSDESVKDHTTAGR	320	sp|Q9UBV2-2|SE1L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=1994	14.159	2	1817.8755	1817.8755	K	V	37	54
PSM	TVIKEGEEQLQTQHQK	321	sp|P30876|RPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	4-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=3297	21.69	2	1907.0151	1907.0151	K	T	131	147
PSM	VRPCVVYGGADIGQQIR	322	sp|O00571-2|DDX3X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	2-UNIMOD:267,4-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=6416	39.867	2	1906.995	1906.9950	R	D	279	296
PSM	IQEIIEQLDVTTSEYEKEK	323	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	17-UNIMOD:188,19-UNIMOD:188	ms_run[1]:scan=9881	61.26868666666667	2	2308.206583	2306.193197	R	L	371	390
PSM	QLPDKWQHDLFDSGFGGGAGVETGGK	324	sp|Q86V81|THOC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:28	ms_run[1]:scan=11094	69.20130833333334	3	2685.2373	2685.2454	K	L	82	108
PSM	AQQNNVEHKVETFSGVYK	325	sp|P62081|RS7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=6221	38.70985666666667	2	2078.006995	2077.022868	K	K	161	179
PSM	FLLHQETLPEQLLAEK	326	sp|Q8WUM0|NU133_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	16-UNIMOD:188	ms_run[1]:scan=10009	62.08045833333334	2	1914.057351	1914.055793	R	Q	1001	1017
PSM	AAQASDLEKIHLDEK	327	sp|P37837|TALDO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	9-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=5059	31.871	2	1678.8929	1678.8929	K	S	278	293
PSM	AGHNVIALVGGATAR	328	sp|Q9Y2Z4|SYYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=6185	38.495	2	1405.779	1405.7790	R	L	104	119
PSM	ALIEVLQPLIAEHQAR	329	sp|P23381-2|SYWC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=11020	68.711	2	1800.0258	1800.0258	K	R	392	408
PSM	DDKHGSYEDAVHSGALND	330	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:188	ms_run[2]:scan=3887	25.081	2	1934.8338	1934.8338	K	-	539	557
PSM	DKTSDLVEEYFEAHSSSK	331	sp|Q13416|ORC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=8991	55.645	2	2082.9785	2082.9785	R	V	234	252
PSM	DTKEIYTHFTCATDTK	332	sp|P63096-2|GNAI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	11-UNIMOD:4	ms_run[2]:scan=5703	35.608	2	1929.8778	1929.8778	K	N	263	279
PSM	DTKEIYTHFTCATDTK	333	sp|P63096-2|GNAI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:188,11-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=5706	35.626	2	1941.9181	1941.9181	K	N	263	279
PSM	GFVPSPTSQPGGHESLVDR	334	sp|P26640|SYVC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	19-UNIMOD:267	ms_run[2]:scan=5997	37.377	2	1975.9627	1975.9627	K	W	967	986
PSM	GIDSEGHAANFVETEQIVHYNGSK	335	sp|Q9NTJ5-2|SAC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	24-UNIMOD:188	ms_run[2]:scan=6989	43.277	2	2607.2297	2607.2297	R	A	166	190
PSM	GSGGLFSPSTAHVPDGALGQR	336	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	21-UNIMOD:267	ms_run[2]:scan=7416	45.841	2	2020.0002	2020.0002	R	D	1023	1044
PSM	GSLGDSDGKHETVNQEEK	337	sp|P98172|EFNB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	9-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=949	8.4454	2	1940.9114	1940.9114	R	S	200	218
PSM	HCLSAANVIFGQTGK	338	sp|Q96EK5|KBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:4	ms_run[2]:scan=7150	44.241	2	1601.7984	1601.7984	R	I	271	286
PSM	HSQFLGYPITLYLEK	339	sp|Q58FF8|H90B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=11155	69.607	2	1807.9509	1807.9509	K	E	127	142
PSM	HTEVLPAEEENDSLGADGTHGAGAMESAAGVLIK	340	sp|Q6P2E9|EDC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=9189	56.873	3	3375.5889	3375.5889	R	L	474	508
PSM	ICHQIEYYFGDFNLPR	341	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=11117	69.356	2	2080.9704	2080.9705	K	D	17	33
PSM	IFRDGEEAGAYDGPR	342	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=4226	27.109	2	1651.759	1651.7590	K	T	105	120
PSM	IRIDSLSAQLSQLQK	343	sp|P02545-5|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=9034	55.913	2	1698.9628	1698.9628	R	Q	198	213
PSM	KFDFDACNEVPPAPK	344	sp|Q15424-2|SAFB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	7-UNIMOD:4	ms_run[2]:scan=6446	40.052	2	1733.8083	1733.8083	R	E	287	302
PSM	KGFSEGLWEIENNPTVK	345	sp|P51858-2|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=8770	54.224	2	1946.9738	1946.9738	R	A	73	90
PSM	KNLDSTTVAVHGEEIYCK	346	sp|P21291|CSRP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:188,17-UNIMOD:4,18-UNIMOD:188	ms_run[2]:scan=4856	30.716	3	2075.0396	2075.0396	K	S	42	60
PSM	KVAEPELMGTPDGTCYPPPPVPR	347	sp|P27708|PYR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:4	ms_run[2]:scan=7624	47.085	2	2507.2189	2507.2189	R	Q	1875	1898
PSM	LHNAIEGGTQLSR	348	sp|O60832-2|DKC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=3138	20.765	2	1394.7266	1394.7266	R	A	159	172
PSM	LIQLMEEIMAEKENK	349	sp|Q92841-1|DDX17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=10670	66.354	2	1817.9267	1817.9267	K	T	327	342
PSM	LKPNLGNGADLPNYR	350	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=5834	36.414	2	1640.8635	1640.8635	K	W	159	174
PSM	LNRLPAAGVGDMVMATVK	351	sp|P62829|RL23_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=9519	58.964	2	1841.9856	1841.9856	R	K	49	67
PSM	LQAEAPHIVVGTPGR	352	sp|Q14240|IF4A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:267	ms_run[2]:scan=5541	34.658	2	1553.8553	1553.8553	K	V	148	163
PSM	MAPVPLDDSNRPASLTK	353	sp|Q9NYF8-4|BCLF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:35	ms_run[2]:scan=4816	30.483	2	1826.9196	1826.9196	K	D	378	395
PSM	MGLVDQLVEPLGPGLKPPEER	354	sp|P40939|ECHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:35	ms_run[2]:scan=10261	63.711	2	2289.2039	2289.2039	K	T	215	236
PSM	MWDPHNDPNAQGDAFK	355	sp|P08621-2|RU17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:35,16-UNIMOD:188	ms_run[2]:scan=4732	29.989	2	1863.7942	1863.7942	K	T	88	104
PSM	NIFLKDQNIFVQK	356	sp|P53004|BIEA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	5-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=8451	52.233	2	1617.9281	1617.9281	K	L	249	262
PSM	NLVDFLTGEEVVCHVAR	357	sp|Q9H9J2|RM44_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	13-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=11759	73.69	2	1966.981	1966.9810	K	N	155	172
PSM	NRLENDGATALAEAFR	358	sp|P46060|RAGP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=8677	53.648	2	1746.8649	1746.8649	R	V	190	206
PSM	NSSYVHGGLDSNGKPADAVYGQK	359	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=4191	26.91	3	2363.1142	2363.1142	K	E	37	60
PSM	QKYFLVGAGAIGCELLK	360	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:188,13-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=10865	67.684	2	1878.0476	1878.0476	K	N	429	446
PSM	QLILVGDHCQLGPVVMCK	361	sp|Q92900-2|RENT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	9-UNIMOD:4,17-UNIMOD:4,18-UNIMOD:188	ms_run[2]:scan=9045	55.984	2	2072.0676	2072.0676	K	K	656	674
PSM	REPFLLSGGDDGALK	362	sp|Q9BQ67|GRWD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=7336	45.351	2	1573.81	1573.8100	R	I	319	334
PSM	RFDEILEASDGIMVAR	363	sp|P14618-3|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	13-UNIMOD:35	ms_run[2]:scan=8666	53.581	3	1836.904	1836.9040	R	G	264	280
PSM	RVAAALPGMESTQDR	364	sp|P20340-3|RAB6A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=4687	29.735	2	1600.7991	1600.7991	R	S	65	80
PSM	RYNFPVEVEVPMER	365	sp|P78527-2|PRKDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=9046	55.99	2	1763.8665	1763.8665	R	K	1987	2001
PSM	SEAEEAITSFNGHKPPGSSEPITVK	366	sp|Q15717|ELAV1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	14-UNIMOD:188,25-UNIMOD:188	ms_run[2]:scan=6698	41.561	2	2623.3168	2623.3168	R	F	158	183
PSM	SHAVACVNQFIISR	367	sp|Q92973-3|TNPO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=6868	42.57	2	1610.8227	1610.8227	R	T	150	164
PSM	SIYGEKFEDENFILK	368	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=9088	56.248	2	1830.904	1830.9040	K	H	77	92
PSM	SLWSSLCLGPAPAPPGPVSPEGR	369	sp|Q9BRR6-6|ADPGK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	7-UNIMOD:4,23-UNIMOD:267	ms_run[2]:scan=11416	71.334	2	2341.1764	2341.1764	R	L	34	57
PSM	SSFFIEPQKPVFPETR	370	sp|Q96JM3|CHAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=9101	56.325	2	1907.9781	1907.9781	K	K	482	498
PSM	SYDVPPPPMEPDHPFYSNISK	371	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=8281	51.175	2	2416.1045	2416.1045	R	D	118	139
PSM	TDEEGKDVPDHAVLEMK	372	sp|Q9BUJ2-3|HNRL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=4957	31.268	2	1911.8884	1911.8884	R	A	432	449
PSM	TKGDFILVGDLMR	373	sp|Q16531|DDB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=10343	64.241	2	1463.7806	1463.7806	K	S	916	929
PSM	TLLDQHGQYPIWMNQR	374	sp|Q9BRT6|LLPH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=8972	55.524	2	1998.9734	1998.9734	K	Q	85	101
PSM	TTEDEVHICHNQDGYSYPSR	375	sp|P01130-2|LDLR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	9-UNIMOD:4,20-UNIMOD:267	ms_run[2]:scan=4456	28.401	2	2417.0218	2417.0218	K	Q	653	673
PSM	TVNKHGDEIITSTTSNYETQTFSSK	376	sp|Q6P2Q9|PRP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	4-UNIMOD:188,25-UNIMOD:188	ms_run[2]:scan=5844	36.471	2	2799.3602	2799.3602	R	T	2046	2071
PSM	VAPEEHPVLLTEAPLNPK	377	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	18-UNIMOD:188	ms_run[2]:scan=7281	45.024	2	1959.0773	1959.0773	R	A	96	114
PSM	VLSRPNAQELPSMYQR	378	sp|Q99623-2|PHB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	4-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=6110	38.05	2	1907.9791	1907.9791	R	L	108	124
PSM	VNRLSVLGAITSVQQR	379	sp|P62495-2|ERF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=8878	54.936	2	1740.0006	1740.0006	R	L	33	49
PSM	YGEGHQAWIIGIVEK	380	sp|P49903-3|SPS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=9612	59.541	2	1698.873	1698.8730	K	G	278	293
PSM	YGEGHQAWIIGIVEK	381	sp|P49903-3|SPS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:188	ms_run[2]:scan=9618	59.582	2	1704.8931	1704.8931	K	G	278	293
PSM	CRPDQLTGLSLLPLSEK	382	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:267,17-UNIMOD:188	ms_run[1]:scan=11803	74.00005999999999	2	1925.0218	1925.0258	R	A	3336	3353
PSM	ISMPGFKGEGPDVDVNLPK	383	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	7-UNIMOD:188,19-UNIMOD:188	ms_run[1]:scan=9091	56.265584999999994	2	2012.054708	2011.048721	K	A	2774	2793
PSM	HTGPGILSMANAGPNTNGSQFFICTAK	384	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	24-UNIMOD:4	ms_run[1]:scan=10451	64.94097166666667	3	2793.299385	2790.321769	K	T	92	119
PSM	HQVEYLGLLENVR	385	sp|O94832|MYO1D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	13-UNIMOD:267	ms_run[1]:scan=9391	58.16842166666667	2	1578.835917	1578.839360	R	V	608	621
PSM	AQQNNVEHKVETFSGVYK	386	sp|P62081|RS7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	9-UNIMOD:188,18-UNIMOD:188	ms_run[1]:scan=6220	38.70377666666667	2	2090.046211	2089.063126	K	K	161	179
PSM	AGLNCSTENMPIKINLIAPPR	387	sp|P05198|IF2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	5-UNIMOD:4	ms_run[2]:scan=9914	61.477	2	2308.2032	2308.2032	R	Y	214	235
PSM	AHGGYSVFAGVGER	388	sp|P06576|ATPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:267	ms_run[2]:scan=5853	36.524	2	1415.6821	1415.6821	K	T	226	240
PSM	AIEPPPLDAVIEAEHTLR	389	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=11512	71.977	2	1970.0473	1970.0473	K	E	820	838
PSM	ALPGQLKPFETLLSQNQGGK	390	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	7-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=10467	65.047	2	2137.1934	2137.1934	K	T	122	142
PSM	AVSFNKSESQEEMLQVFNVETHTSK	391	sp|Q9H583|HEAT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9553	59.176	3	2868.36	2868.3600	K	Q	1484	1509
PSM	AYHNSPAYLAYINAK	392	sp|Q969G3-6|SMCE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=6918	42.854	2	1694.8417	1694.8417	K	S	62	77
PSM	AYHSFLVEPISCHAWNK	393	sp|O15143|ARC1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:1,12-UNIMOD:4	ms_run[2]:scan=9931	61.584	2	2099.9887	2099.9887	M	D	2	19
PSM	DDKHGSYEDAVHSGALND	394	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=3888	25.087	2	1928.8137	1928.8137	K	-	539	557
PSM	DVDIIDHHDNTYTVK	395	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=5211	32.743	2	1783.8377	1783.8377	R	Y	922	937
PSM	EATTDFTVDSRPLTQVGGDHIK	396	sp|O75369-7|FLNB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=6889	42.689	2	2386.1765	2386.1765	R	A	1077	1099
PSM	FAQHGTFEYEYSQR	397	sp|P23246-2|SFPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:267	ms_run[2]:scan=5086	32.017	2	1771.783	1771.7830	R	W	480	494
PSM	FCFTPHTEEGCLSER	398	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=6341	39.419	2	1868.7822	1868.7822	K	A	1117	1132
PSM	FDRGYISPYFINTSK	399	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=8270	51.107	2	1806.8941	1806.8941	K	G	219	234
PSM	FSMPGFKAEGPEVDVNLPK	400	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:35,7-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=7823	48.291	2	2089.0593	2089.0593	K	A	885	904
PSM	GKMSSYAFFVQTCR	401	sp|B2RPK0|HGB1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	13-UNIMOD:4	ms_run[2]:scan=7481	46.224	2	1680.7752	1680.7752	R	E	11	25
PSM	GLGGEVPGSHQGPDPYR	402	sp|Q6UW68|TM205_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=4489	28.594	2	1721.8121	1721.8121	R	Q	125	142
PSM	GLLEMMETDEKEGLR	403	sp|Q86W92-4|LIPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=10272	63.78	2	1749.8277	1749.8277	R	C	57	72
PSM	GNSLTLIDLPGHESLR	404	sp|Q9Y5M8|SRPRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	16-UNIMOD:267	ms_run[2]:scan=8877	54.931	2	1730.9191	1730.9191	R	L	110	126
PSM	GQVQEVGWHDVAGWLGR	405	sp|P17858|PFKAL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	17-UNIMOD:267	ms_run[2]:scan=10601	65.92	3	1902.9364	1902.9364	K	G	445	462
PSM	GRQVFQQTISCPEGLR	406	sp|Q14653|IRF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:267,11-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=6198	38.569	2	1894.9587	1894.9587	R	L	212	228
PSM	GTADVTHDLQEMKEESR	407	sp|P11166|GTR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=5896	36.77	2	1944.8847	1944.8847	R	Q	233	250
PSM	GVEVTVGHEQEEGGKWPYAGTAEAIK	408	sp|P0DPI2-2|GAL3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=6926	42.903	2	2741.3297	2741.3297	R	A	158	184
PSM	HELLQPFNVLYEK	409	sp|Q9UQ80|PA2G4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9956	61.739	2	1628.8562	1628.8562	K	E	299	312
PSM	HLAGLGLTEAIDK	410	sp|P50454|SERPH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	13-UNIMOD:188	ms_run[2]:scan=6891	42.7	2	1342.7552	1342.7552	K	N	320	333
PSM	HQVLFIADEIQTGLAR	411	sp|P04181-2|OAT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	16-UNIMOD:267	ms_run[2]:scan=10308	64.016	2	1819.982	1819.9820	R	T	118	134
PSM	HSGPNSADSANDGFVR	412	sp|P52597|HNRPF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=2125	14.875	2	1629.7132	1629.7132	K	L	99	115
PSM	HVFGESDELIGQK	413	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	13-UNIMOD:188	ms_run[2]:scan=5555	34.75	2	1463.7352	1463.7352	R	V	138	151
PSM	HVFGESDELIGQK	414	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=5556	34.755	2	1457.7151	1457.7151	R	V	138	151
PSM	HWELTAEGEEIAR	415	sp|Q9Y285-2|SYFA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	13-UNIMOD:267	ms_run[2]:scan=6670	41.398	2	1549.74	1549.7400	K	E	60	73
PSM	IFRDGEEAGAYDGPR	416	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:267,15-UNIMOD:267	ms_run[2]:scan=4251	27.249	2	1671.7756	1671.7756	K	T	105	120
PSM	IGGVQQDTILAEGLHFR	417	sp|Q99623-2|PHB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	17-UNIMOD:267	ms_run[2]:scan=9786	60.664	3	1862.9878	1862.9878	R	I	55	72
PSM	ILHCLGLAEEIQK	418	sp|P53004|BIEA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=7011	43.404	2	1528.8379	1528.8379	R	Y	278	291
PSM	KAGPGSLELCGLPSQK	419	sp|Q14684-2|RRP1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:188,10-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=6131	38.177	2	1652.8958	1652.8958	K	T	556	572
PSM	KFPGYYVTGDGCQR	420	sp|Q9NR19|ACSA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	12-UNIMOD:4	ms_run[2]:scan=5155	32.42	2	1646.7511	1646.7511	K	D	543	557
PSM	KLFDTLNEDLFQK	421	sp|P48723|HSP13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=10029	62.207	2	1609.8352	1609.8352	R	I	368	381
PSM	KLTPVQVLEYGEAIAK	422	sp|Q9BX66-4|SRBS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=10840	67.521	2	1770.033	1770.0330	K	F	510	526
PSM	LAQAHPAGPPTLDPVNDLQLK	423	sp|Q15477|SKIV2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	21-UNIMOD:188	ms_run[2]:scan=8509	52.602	2	2200.1947	2200.1947	R	D	971	992
PSM	LFELDPLTGEWHYK	424	sp|Q9BZF1-3|OSBL8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=11237	70.149	2	1746.8617	1746.8617	K	F	689	703
PSM	LIQLMEEIMAEKENK	425	sp|Q92841-1|DDX17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	12-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=10671	66.361	2	1829.967	1829.9670	K	T	327	342
PSM	LKGPQITGPSLEGDLGLK	426	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=8865	54.856	2	1834.0603	1834.0603	K	G	370	388
PSM	LLSRPQDALEGVVLSPSLEAR	427	sp|Q9NVI7|ATD3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:267,21-UNIMOD:267	ms_run[2]:scan=10133	62.876	2	2269.2545	2269.2545	R	V	355	376
PSM	LRGDAAAGPGPGAGAGAAAEPEPR	428	sp|Q6DKJ4|NXN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=3114	20.621	3	2115.0457	2115.0457	R	R	60	84
PSM	MMANGILKVPAINVNDSVTK	429	sp|P23526-2|SAHH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:35	ms_run[2]:scan=8715	53.878	3	2130.1177	2130.1177	K	S	139	159
PSM	MQEHSDQVPVGNIPR	430	sp|P33993|MCM7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:35,15-UNIMOD:267	ms_run[2]:scan=4219	27.069	2	1731.8238	1731.8238	K	S	237	252
PSM	MTDQEAIQDLWQWRK	431	sp|P06748|NPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:35	ms_run[2]:scan=10095	62.617	2	1962.9258	1962.9258	R	S	278	293
PSM	MVLAAAGGVEHQQLLDLAQK	432	sp|P31930|QCR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:35	ms_run[2]:scan=7904	48.756	3	2107.1096	2107.1096	R	H	229	249
PSM	NLGFTAIPLHGQMSQSK	433	sp|Q9H0S4|DDX47_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	17-UNIMOD:188	ms_run[2]:scan=7854	48.474	2	1833.9503	1833.9503	R	R	285	302
PSM	NLHQSGFSLSGAQIDDNIPR	434	sp|Q16555|DPYL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=7910	48.79	3	2168.061	2168.0610	R	R	533	553
PSM	NLLHVTDTGVGMTR	435	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=6480	40.263	2	1512.7719	1512.7719	K	E	143	157
PSM	NPPGFAFVEFEDPRDAADAVR	436	sp|P84103-2|SRSF3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:267,21-UNIMOD:267	ms_run[2]:scan=10843	67.543	2	2339.1085	2339.1085	R	E	44	65
PSM	NTLIQFEDFGNHNAFR	437	sp|P23368-2|MAOM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9763	60.511	2	1921.9071	1921.9071	R	F	249	265
PSM	RFEAEPLPENTNR	438	sp|Q9BTU6|P4K2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=4088	26.295	2	1571.7692	1571.7692	R	Q	276	289
PSM	RGDIIGVQGNPGK	439	sp|Q15046|SYK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=2882	19.249	2	1309.7102	1309.7102	R	T	178	191
PSM	RGEAQLLMNEFESAK	440	sp|Q13451|FKBP5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9204	56.97	2	1721.8407	1721.8407	R	G	357	372
PSM	RLQSIGTENTEENR	441	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=2079	14.629	2	1645.802	1645.8020	K	R	43	57
PSM	RNENQLIIFADDTYPR	442	sp|Q15393|SF3B3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9234	57.159	2	1963.9752	1963.9752	K	W	1016	1032
PSM	RPTELLSNPQFIVDGATR	443	sp|P07384|CAN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=8734	53.996	2	2013.0643	2013.0643	K	T	87	105
PSM	SIEIPRPVDGVEVPGCGK	444	sp|P26368-2|U2AF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	16-UNIMOD:4	ms_run[2]:scan=7614	47.023	2	1907.9775	1907.9775	K	I	410	428
PSM	SIYGEKFEDENFILK	445	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=9083	56.217	2	1842.9442	1842.9442	K	H	77	92
PSM	SIYGSRFPDENFTLK	446	sp|P30405-2|PPIF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=8354	51.633	2	1772.8733	1772.8733	K	H	119	134
PSM	SKGVFVQSVLPYFVATK	447	sp|Q53GQ0|DHB12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=11126	69.415	2	1881.0803	1881.0803	R	L	222	239
PSM	SLHDALCVLAQTVK	448	sp|P78371-2|TCPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	7-UNIMOD:4	ms_run[2]:scan=10676	66.393	2	1553.8236	1553.8236	R	D	342	356
PSM	SSEKNEDFAAHPGEDAVPTGPDCQAK	449	sp|Q02952-3|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:188,23-UNIMOD:4,26-UNIMOD:188	ms_run[2]:scan=4327	27.683	3	2768.2387	2768.2387	K	S	1352	1378
PSM	SVTLGYLFSQGHLTR	450	sp|P55265-5|DSRAD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9989	61.947	2	1677.8839	1677.8839	K	A	769	784
PSM	SYDVPPPPMEPDHPFYSNISK	451	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	21-UNIMOD:188	ms_run[2]:scan=8284	51.193	2	2422.1247	2422.1247	R	D	118	139
PSM	THVADFAPEVAWVTR	452	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9690	60.046	2	1697.8526	1697.8526	K	S	1092	1107
PSM	THVADFAPEVAWVTR	453	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	15-UNIMOD:267	ms_run[2]:scan=9732	60.315	2	1707.8608	1707.8608	K	S	1092	1107
PSM	TSPADHGGSVGSESGGSAVDSVAGEHSVSGR	454	sp|Q5T4S7-3|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=4076	26.221	3	2839.2605	2839.2605	R	S	2860	2891
PSM	VAPEEHPVLLTEAPLNPK	455	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=7264	44.921	2	1953.0571	1953.0571	R	A	96	114
PSM	VGDFGDAINWPTPGEIAHK	456	sp|Q6PKG0-3|LARP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	19-UNIMOD:188	ms_run[2]:scan=10138	62.912	3	2029.0001	2029.0001	K	S	90	109
PSM	VGDFGDAINWPTPGEIAHK	457	sp|Q6PKG0-3|LARP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=10047	62.323	2	2022.9799	2022.9799	K	S	90	109
PSM	VIIWREENGTWEK	458	sp|P55735-2|SEC13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=6823	42.313	2	1658.8417	1658.8417	K	S	69	82
PSM	VIKDFMIQGGDFTR	459	sp|P23284|PPIB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=8064	49.748	2	1625.8236	1625.8236	R	G	96	110
PSM	VMSNLVEHNGVLESEAGQPQALGSSGTCSSLKK	460	sp|Q14684-2|RRP1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	28-UNIMOD:4	ms_run[2]:scan=6879	42.631	3	3413.6555	3413.6555	R	Q	583	616
PSM	VRPCVVYGGADIGQQIR	461	sp|O00571-2|DDX3X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:267,4-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=6407	39.816	3	1906.995	1906.9950	R	D	279	296
PSM	VSHLLGINVTDFTR	462	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:267	ms_run[2]:scan=9545	59.123	2	1580.855	1580.8550	K	G	374	388
PSM	VSHLLGINVTDFTR	463	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9544	59.117	2	1570.8467	1570.8467	K	G	374	388
PSM	YRPASASVSALIGGR	464	sp|P46108-2|CRK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:267,15-UNIMOD:267	ms_run[2]:scan=6740	41.818	2	1523.8323	1523.8323	K	-	190	205
PSM	LKGPQITGPSLEGDLGLK	465	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=8892	55.026394999999994	2	1822.028582	1822.020014	K	G	370	388
PSM	TVNKHGDEIITSTTSNYETQTFSSK	466	sp|Q6P2Q9|PRP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=5836	36.42512166666667	3	2787.321236	2787.319897	R	T	2046	2071
PSM	VEGIVHPTTAEIDLKEDIGK	467	sp|Q9P0M6|H2AW_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=7322	45.26179666666667	3	2164.145214	2163.142314	R	A	212	232
PSM	GQAFVIFKELGSSTNALR	468	sp|P08579|RU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	8-UNIMOD:188,18-UNIMOD:267	ms_run[1]:scan=11049	68.90636500000001	3	1953.055259	1953.065459	R	Q	50	68
PSM	AAQASDLEKIHLDEK	469	sp|P37837|TALDO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=5061	31.881	2	1666.8526	1666.8526	K	S	278	293
PSM	AITHLNNNFMFGQK	470	sp|P14866-2|HNRPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=7179	44.411	2	1633.8035	1633.8035	R	L	302	316
PSM	AKLVILANNCPALR	471	sp|P62888|RL30_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	10-UNIMOD:4	ms_run[2]:scan=6894	42.719	2	1551.8919	1551.8919	K	K	43	57
PSM	AQQNNVEHKVETFSGVYK	472	sp|P62081|RS7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	9-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=5659	35.345	2	2089.0631	2089.0631	K	K	161	179
PSM	DAKDYADSIHAIFVETSAK	473	sp|Q9UL26|RB22A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=10013	62.104	3	2080.0113	2080.0113	R	N	132	151
PSM	EAIQHPADEKLQEK	474	sp|Q9NUQ9|FA49B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=1689	12.461	2	1634.8264	1634.8264	R	A	65	79
PSM	FIGSPPGYVGHEEGGQLTK	475	sp|Q9H078-5|CLPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	19-UNIMOD:188	ms_run[2]:scan=5826	36.367	2	1977.9892	1977.9892	K	K	222	241
PSM	FIGSPPGYVGHEEGGQLTK	476	sp|Q9H078-5|CLPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=5829	36.384	2	1971.969	1971.9690	K	K	222	241
PSM	GFGFVYFQNHDAADK	477	sp|Q13151|ROA0_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=8645	53.448	2	1714.774	1714.7740	R	A	140	155
PSM	GGAAVDPDSGLEHSAHVLEK	478	sp|P09874|PARP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	20-UNIMOD:188	ms_run[2]:scan=5462	34.181	2	1993.9801	1993.9801	K	G	529	549
PSM	GGVDTAAAPAGGAPPAHAPGPGR	479	sp|Q14657|LAGE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	23-UNIMOD:267	ms_run[2]:scan=3206	21.154	2	1960.9743	1960.9743	R	D	25	48
PSM	GILADEDSSRPVWLK	480	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=8212	50.743	2	1684.8784	1684.8784	K	A	1430	1445
PSM	GPAPGSKPVQFMDFEGK	481	sp|Q8WUX1|S38A5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=7263	44.915	2	1790.8662	1790.8662	R	T	31	48
PSM	HFIMQVVCEATQCPDTR	482	sp|Q14974-2|IMB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	8-UNIMOD:4,13-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=8333	51.504	3	2100.9419	2100.9419	R	V	71	88
PSM	HLIIENFIPLEEK	483	sp|O15066|KIF3B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	13-UNIMOD:188	ms_run[2]:scan=11474	71.722	2	1599.8968	1599.8968	K	S	584	597
PSM	HLQELVGQETLPR	484	sp|Q8WX92|NELFB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=5898	36.781	2	1518.8154	1518.8154	R	D	321	334
PSM	HLSSCAAPAPLTSAER	485	sp|Q6IBS0|TWF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	5-UNIMOD:4	ms_run[2]:scan=3775	24.445	2	1666.8097	1666.8097	K	E	137	153
PSM	HMSEFMECNLNELVK	486	sp|P25786|PSA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	8-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=9324	57.74	2	1885.8468	1885.8468	R	H	175	190
PSM	HNELTGDNVGPLILK	487	sp|Q8N5K1|CISD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=7673	47.389	2	1618.8679	1618.8679	K	K	117	132
PSM	HNELTGDNVGPLILK	488	sp|Q8N5K1|CISD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	15-UNIMOD:188	ms_run[2]:scan=7674	47.395	2	1624.888	1624.8880	K	K	117	132
PSM	HQVEYLGLLENVR	489	sp|O94832|MYO1D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=9379	58.09	2	1568.8311	1568.8311	R	V	608	621
PSM	IAKEEIFGPVQPLFK	490	sp|P30837|AL1B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=10086	62.56	2	1714.9658	1714.9658	R	F	412	427
PSM	IAKEEIFGPVQPLFK	491	sp|P30837|AL1B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=10094	62.611	2	1727.0061	1727.0061	R	F	412	427
PSM	IDIFPAKQENGDLSPFSGTSLR	492	sp|P19174-2|PLCG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=10245	63.606	2	2391.207	2391.2070	K	E	1209	1231
PSM	IGGVQQDTILAEGLHFR	493	sp|Q99623-2|PHB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=9788	60.675	3	1852.9795	1852.9795	R	I	55	72
PSM	ILFIFIDSDHTDNQR	494	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=10792	67.196	2	1832.9057	1832.9057	K	I	286	301
PSM	ILPVFDEPPNPTNVEESLKR	495	sp|Q9NYL9|TMOD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=10217	63.429	2	2293.1954	2293.1954	K	T	173	193
PSM	IREGMAALQSDPWQQELYR	496	sp|P49748-2|ACADV_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=9323	57.734	2	2290.1165	2290.1165	R	N	592	611
PSM	KEFSPFGTITSAK	497	sp|P11940-2|PABP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=7001	43.347	2	1423.775	1423.7750	R	V	312	325
PSM	KGFNEGLWEIDNNPK	498	sp|O75475-3|PSIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=7725	47.709	2	1771.8932	1771.8932	R	V	75	90
PSM	KITSQIFIGPTYYQR	499	sp|P30876|RPB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=7692	47.507	2	1813.9727	1813.9727	R	L	1036	1051
PSM	KLTFLYLANDVIQNSK	500	sp|Q9NQG5|RPR1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=11766	73.739	2	1866.0251	1866.0251	R	R	56	72
PSM	KLVIPSELGYGER	501	sp|P26885|FKBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=7148	44.231	2	1459.8035	1459.8035	R	G	103	116
PSM	KVPGVTAIELGEETCTFR	502	sp|P51116|FXR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	15-UNIMOD:4	ms_run[2]:scan=8552	52.873	2	2006.0143	2006.0143	R	I	256	274
PSM	LASEAKPAAVAAENEEIGSHIK	503	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=5288	33.191	3	2234.1543	2234.1543	R	H	1896	1918
PSM	LFELDPLTGEWHYK	504	sp|Q9BZF1-3|OSBL8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	14-UNIMOD:188	ms_run[2]:scan=11236	70.143	2	1752.8819	1752.8819	K	F	689	703
PSM	LKAFLASPEYVNLPINGNGK	505	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=9753	60.447	2	2144.163	2144.1630	K	Q	190	210
PSM	LNLSCIHSPVVNELMR	506	sp|Q9Y2X3|NOP58_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	5-UNIMOD:4	ms_run[2]:scan=9998	62.006	2	1880.9601	1880.9601	K	G	102	118
PSM	LQAEAPHIVVGTPGR	507	sp|Q14240|IF4A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=5547	34.697	2	1543.8471	1543.8471	K	V	148	163
PSM	MGPGAASGGERPNLK	508	sp|Q9H0U4|RAB1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:35	ms_run[2]:scan=1570	11.79	2	1456.7093	1456.7093	R	I	173	188
PSM	MMANGILKVPAINVNDSVTK	509	sp|P23526-2|SAHH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:35,8-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=8721	53.915	2	2142.158	2142.1580	K	S	139	159
PSM	NKEDQYDHLDAADMTK	510	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:188,14-UNIMOD:35,16-UNIMOD:188	ms_run[2]:scan=2514	17.049	2	1920.8562	1920.8562	K	V	718	734
PSM	NLHQSGFSLSGAQIDDNIPR	511	sp|Q16555|DPYL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	20-UNIMOD:267	ms_run[2]:scan=7919	48.846	3	2178.0693	2178.0693	R	R	533	553
PSM	NRVQNMALYADVGGK	512	sp|P51571|SSRD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=5906	36.83	2	1634.8199	1634.8199	K	Q	59	74
PSM	NTLIQFEDFGNHNAFR	513	sp|P23368-2|MAOM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	16-UNIMOD:267	ms_run[2]:scan=9764	60.517	2	1931.9154	1931.9154	R	F	249	265
PSM	PGHLQEGFGCVVTNR	514	sp|Q8NC51-4|PAIRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	10-UNIMOD:4	ms_run[2]:scan=5411	33.877	2	1669.7995	1669.7995	M	F	2	17
PSM	QLILVGDHCQLGPVVMCK	515	sp|Q92900-2|RENT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	9-UNIMOD:4,17-UNIMOD:4	ms_run[2]:scan=9048	56.001	2	2066.0475	2066.0475	K	K	656	674
PSM	QTVNRGPGLGSTQGQTIALPAQGLIEFR	516	sp|Q00577|PURA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=10779	67.114	3	2908.5519	2908.5519	R	D	172	200
PSM	RADLNQGIGEPQSPSR	517	sp|Q96C19|EFHD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=3255	21.447	2	1723.8602	1723.8602	R	R	62	78
PSM	RFDEILEASDGIMVAR	518	sp|P14618-3|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=9910	61.456	3	1840.9256	1840.9256	R	G	264	280
PSM	RFDEILEASDGIMVAR	519	sp|P14618-3|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=9893	61.347	3	1820.9091	1820.9091	R	G	264	280
PSM	SCFGHPLAPQALEDVK	520	sp|Q8IXI1-2|MIRO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:4	ms_run[2]:scan=7060	43.694	2	1767.8614	1767.8614	K	T	88	104
PSM	SDTEHSTNEVGTLCHK	521	sp|Q8N573-3|OXR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	14-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=1776	12.939	2	1819.8102	1819.8102	R	T	329	345
PSM	SDTEHSTNEVGTLCHK	522	sp|Q8N573-3|OXR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	14-UNIMOD:4	ms_run[2]:scan=1782	12.975	2	1813.7901	1813.7901	R	T	329	345
PSM	SGHELGMTPLQELSLR	523	sp|Q9Y6D5|BIG2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=9451	58.542	2	1766.8985	1766.8985	R	K	545	561
PSM	SLHDALCVLAQTVK	524	sp|P78371-2|TCPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	7-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=10675	66.388	2	1559.8437	1559.8437	R	D	342	356
PSM	SSEKNEDFAAHPGEDAVPTGPDCQAK	525	sp|Q02952-3|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	23-UNIMOD:4	ms_run[2]:scan=4337	27.74	3	2756.1984	2756.1984	K	S	1352	1378
PSM	SVTLGYLFSQGHLTR	526	sp|P55265-5|DSRAD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	15-UNIMOD:267	ms_run[2]:scan=9986	61.929	2	1687.8921	1687.8921	K	A	769	784
PSM	TFVNITPAEVGVLVGKDR	527	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=10630	66.104	2	1914.0575	1914.0575	K	S	39	57
PSM	THNGESVSYLFSHVPL	528	sp|P11908|PRPS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=11016	68.687	2	1785.8686	1785.8686	R	-	303	319
PSM	TKDGQILPVPNVVVR	529	sp|Q9P258|RCC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=7758	47.903	2	1633.9515	1633.9515	K	D	319	334
PSM	TVETRDGQVINETSQHHDDLE	530	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=4600	29.247	3	2422.0997	2422.0997	K	-	446	467
PSM	VLSRPNAQELPSMYQR	531	sp|Q99623-2|PHB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=6084	37.897	2	1887.9625	1887.9625	R	L	108	124
PSM	VRPCVVYGGADIGQQIR	532	sp|O00571-2|DDX3X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	4-UNIMOD:4	ms_run[2]:scan=6409	39.825	3	1886.9785	1886.9785	R	D	279	296
PSM	VRPCVVYGGADIGQQIR	533	sp|O00571-2|DDX3X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	4-UNIMOD:4	ms_run[2]:scan=6412	39.841	2	1886.9785	1886.9785	R	D	279	296
PSM	YLILPVHSNIPMMDQK	534	sp|Q7L2E3-3|DHX30_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=9854	61.096	2	1897.9794	1897.9794	K	A	660	676
PSM	YNEQHVPGSPFTAR	535	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	14-UNIMOD:267	ms_run[2]:scan=4871	30.794	2	1611.7669	1611.7669	K	V	1930	1944
PSM	YNEQHVPGSPFTAR	536	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=4881	30.849	2	1601.7587	1601.7587	K	V	1930	1944
PSM	YRWTEYGLTFTEK	537	sp|P21796|VDAC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=9021	55.831	2	1692.8148	1692.8148	K	W	62	75
PSM	YSVLQQHAEANGVDGVDALDTASHTNK	538	sp|Q99523-2|SORT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	27-UNIMOD:188	ms_run[2]:scan=6790	42.113	3	2845.3574	2845.3574	R	S	655	682
PSM	YYRESADPLGAWLQDAR	539	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:267,17-UNIMOD:267	ms_run[2]:scan=10638	66.157	3	2029.9761	2029.9761	R	R	1179	1196
PSM	QKYFLVGAGAIGCELLK	540	sp|P22314|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:28,2-UNIMOD:188,13-UNIMOD:4,17-UNIMOD:188	ms_run[1]:scan=12640	80.35787166666667	2	1861.0184	1861.0205	K	N	469	486
PSM	VGLQVVAVKAPGFGDNR	541	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=7830	48.33700666666667	2	1725.955849	1725.952603	K	K	293	310
PSM	LGLEALAANHQQLFTDGR	542	sp|Q9Y2Z4|SYYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	18-UNIMOD:267	ms_run[1]:scan=9346	57.88235	3	1963.021445	1963.015093	R	S	146	164
PSM	QATINIGTIGHVAHGK	543	sp|P41091|IF2G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:28,16-UNIMOD:188	ms_run[1]:scan=6984	43.25100833333333	2	1604.8720	1604.8725	R	S	39	55
PSM	HSAPGLLSMANSGPSTNGCQFFITCSK	544	sp|O43447|PPIH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	9-UNIMOD:35,19-UNIMOD:4,25-UNIMOD:4	ms_run[1]:scan=8829	54.62537833333333	3	2885.278711	2884.294234	R	C	104	131
PSM	ASLPTLGFTHFQPAQLTTVGK	545	sp|P30566|PUR8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	21-UNIMOD:188	ms_run[1]:scan=10825	67.42060833333333	2	2219.213109	2219.204583	R	R	150	171
PSM	KNQDDFECVTTLEGHENEVK	546	sp|O76071|CIAO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	1-UNIMOD:188,8-UNIMOD:4,20-UNIMOD:188	ms_run[1]:scan=6202	38.596615	3	2404.098543	2403.105127	K	S	90	110
PSM	CDLYLLEEGPPVTTVLTR	547	sp|P29803|ODPAT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	1-UNIMOD:4	ms_run[1]:scan=9549	59.14666999999999	3	2075.050237	2075.060893	K	A	39	57
PSM	ACQSIYPLHDVFVR	548	sp|P61247|RS3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=8740	54.035	2	1713.8536	1713.8536	K	K	200	214
PSM	AIDLFTDAIKLNPR	549	sp|Q8IZP2|ST134_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=10593	65.868	2	1585.8828	1585.8828	K	L	129	143
PSM	AITHLNNNFMFGQK	550	sp|P14866-2|HNRPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	14-UNIMOD:188	ms_run[2]:scan=7178	44.406	2	1639.8236	1639.8236	R	L	302	316
PSM	AKGILFVGSGVSGGEEGAR	551	sp|P52209-2|6PGD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=6611	41.044	3	1789.9323	1789.9323	K	Y	105	124
PSM	CGAALAGHQLIR	552	sp|P78527-2|PRKDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=4386	28.009	2	1275.6745	1275.6745	R	G	25	37
PSM	CQHAAEIITDLLR	553	sp|Q96AE4|FUBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=10180	63.189	2	1548.7958	1548.7958	R	S	332	345
PSM	DGLTDVYNKIHMGSCAENTAK	554	sp|P24752|THIL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	15-UNIMOD:4	ms_run[2]:scan=7838	48.387	2	2323.0573	2323.0573	K	K	182	203
PSM	DGLTDVYNKIHMGSCAENTAK	555	sp|P24752|THIL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	9-UNIMOD:188,15-UNIMOD:4,21-UNIMOD:188	ms_run[2]:scan=7839	48.393	2	2335.0975	2335.0975	K	K	182	203
PSM	DLIHDQDEDEEEEEGQRFYAGGSER	556	sp|Q9UNZ2-4|NSF1C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	17-UNIMOD:267,25-UNIMOD:267	ms_run[2]:scan=6635	41.188	3	2972.2447	2972.2447	R	S	77	102
PSM	DLVHTEGQLQNEEIVAHDGSATYLR	557	sp|Q9Y547|IFT25_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=8255	51.009	3	2794.3522	2794.3522	K	F	92	117
PSM	DMTVPILVSKPPVFTGK	558	sp|P11182|ODB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	10-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=10283	63.85	2	1840.0571	1840.0571	K	D	234	251
PSM	DQVTAQEIFQDNHEDGPTAKK	559	sp|P13010|XRCC5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=5774	36.036	2	2370.1088	2370.1088	K	L	546	567
PSM	DVDIIDHHDNTYTVK	560	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	15-UNIMOD:188	ms_run[2]:scan=5204	32.701	2	1789.8578	1789.8578	R	Y	922	937
PSM	EQLEEEEEAKHNLEK	561	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	10-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=3354	22.024	2	1865.9046	1865.9046	R	Q	1343	1358
PSM	FEAHPNDLYVEGLPENIPFR	562	sp|P78347-2|GTF2I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	20-UNIMOD:267	ms_run[2]:scan=10717	66.669	2	2366.1571	2366.1571	K	S	454	474
PSM	FFDHSGTLVMDAYEPEISR	563	sp|Q15005|SPCS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	19-UNIMOD:267	ms_run[2]:scan=9640	59.721	2	2223.0182	2223.0182	K	L	196	215
PSM	FGRDEDPVCLQLDDILSK	564	sp|Q9NX01|TXN4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	9-UNIMOD:4	ms_run[2]:scan=11091	69.183	2	2119.0256	2119.0256	R	T	30	48
PSM	FQTIPLYYIEDHNGR	565	sp|Q14692|BMS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9770	60.558	2	1864.9108	1864.9108	R	Q	951	966
PSM	FSVPGFKAEGPEVDVNLPK	566	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=9771	60.564	2	2041.0923	2041.0923	K	A	757	776
PSM	FVDKLFEAVEEGR	567	sp|O43395|PRPF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9495	58.815	2	1537.7777	1537.7777	R	S	62	75
PSM	GPWALEEESLVGREPEER	568	sp|O00515|LAD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=8689	53.719	2	2082.0018	2082.0018	R	K	152	170
PSM	GQAFVIFKELGSSTNALR	569	sp|P08579|RU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=11053	68.931	2	1937.0371	1937.0371	R	Q	50	68
PSM	GRELPTAFDYVEFTR	570	sp|Q13813-3|SPTN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9880	61.262	2	1799.8842	1799.8842	K	S	2433	2448
PSM	GVEVTVGHEQEEGGKWPYAGTAEAIK	571	sp|P0DPI2-2|GAL3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	15-UNIMOD:188,26-UNIMOD:188	ms_run[2]:scan=6929	42.924	3	2753.3699	2753.3699	R	A	158	184
PSM	GVGSGPHPPDTQQPSPSK	572	sp|Q68CZ2-2|TENS3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=1875	13.496	2	1771.8489	1771.8489	R	A	406	424
PSM	HAEATLGSGNLR	573	sp|Q9H8S9-2|MOB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:267	ms_run[2]:scan=2223	15.383	2	1234.6294	1234.6294	K	Q	31	43
PSM	HAPLADQILAGNAVR	574	sp|Q13895|BYST_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=6826	42.33	2	1544.8423	1544.8423	K	A	16	31
PSM	HCAPSGTPTGPEILAAAVPPSSLK	575	sp|Q8NDD1-7|CA131_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:4	ms_run[2]:scan=9040	55.948	2	2357.2049	2357.2049	R	N	99	123
PSM	HCLSAANVIFGQTGK	576	sp|Q96EK5|KBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=7130	44.122	2	1607.8185	1607.8185	R	I	271	286
PSM	HEPLVLFCESCDTLTCR	577	sp|Q13263-2|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	8-UNIMOD:4,11-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=8918	55.188	3	2135.9438	2135.9438	K	D	132	149
PSM	HGGTIPIVPTAEFQDR	578	sp|P00367-2|DHE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7451	46.053	2	1736.8846	1736.8846	K	I	314	330
PSM	HGLEAISIMDSR	579	sp|P26640|SYVC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7008	43.383	2	1327.6554	1327.6554	R	G	607	619
PSM	HGVPISVTGIAQVK	580	sp|O75955|FLOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	14-UNIMOD:188	ms_run[2]:scan=6601	40.986	2	1410.829	1410.8290	R	I	59	73
PSM	HLQDLMEGLTAK	581	sp|P11387|TOP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:188	ms_run[2]:scan=7865	48.542	2	1360.7116	1360.7116	K	V	576	588
PSM	HLQDLMEGLTAK	582	sp|P11387|TOP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7867	48.551	2	1354.6915	1354.6915	K	V	576	588
PSM	HVVAVVLGDVGR	583	sp|Q9BT22|ALG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:267	ms_run[2]:scan=6306	39.226	2	1229.712	1229.7120	R	S	34	46
PSM	ICDQWDALGSLTHSR	584	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=8858	54.812	2	1767.8238	1767.8238	K	R	498	513
PSM	IHDIVLVGGSTR	585	sp|P34931|HS71L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:267	ms_run[2]:scan=5178	32.555	2	1275.7175	1275.7175	K	I	333	345
PSM	IHNLALNCCTQLADLYR	586	sp|P53992-2|SC24C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	8-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=8855	54.795	3	2074.0088	2074.0088	R	N	72	89
PSM	IIEDLRAQIFANTVDNAR	587	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9505	58.875	2	2058.0858	2058.0858	K	I	132	150
PSM	KDYSQYEENITHLQEQIVDGK	588	sp|Q9C075|K1C23_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:188,21-UNIMOD:188	ms_run[2]:scan=9445	58.507	2	2548.2484	2548.2484	K	M	117	138
PSM	KLFGQESGPSAEK	589	sp|Q9BWH2|FUND2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=2861	19.12	2	1376.6936	1376.6936	R	Y	68	81
PSM	KLGEMWSEQSAK	590	sp|P26583|HMGB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=4615	29.329	2	1404.711	1404.7110	K	D	128	140
PSM	KPPLLNNADSVQAK	591	sp|P09874|PARP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=3562	23.225	2	1493.8202	1493.8202	K	V	748	762
PSM	LAILGIHNEVSK	592	sp|P12814-2|ACTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=6589	40.92	2	1292.7452	1292.7452	R	I	566	578
PSM	LALLGLAQPSEKPSSPSPDLPFTTPAPK	593	sp|Q9Y4U1|MMAC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=11083	69.13	3	2858.543	2858.5430	R	K	231	259
PSM	LAQANGWGVMVSHR	594	sp|P06733-2|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=6347	39.453	2	1524.762	1524.7620	K	S	266	280
PSM	LGDVGMAELCPGLLHPSSR	595	sp|P13489|RINI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:35,10-UNIMOD:4	ms_run[2]:scan=7643	47.202	2	2023.9819	2023.9819	K	L	239	258
PSM	LGDVGMAELCPGLLHPSSR	596	sp|P13489|RINI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:35,10-UNIMOD:4,19-UNIMOD:267	ms_run[2]:scan=7645	47.219	2	2033.9902	2033.9902	K	L	239	258
PSM	LHNAIEGGTQLSR	597	sp|O60832-2|DKC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:267	ms_run[2]:scan=3137	20.76	2	1404.7349	1404.7349	R	A	159	172
PSM	LHNMIVDLDNVVK	598	sp|Q16891-3|MIC60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9124	56.471	2	1508.8021	1508.8021	K	K	299	312
PSM	LKEAELLEPLMPAIR	599	sp|P53618|COPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=10860	67.653	2	1721.975	1721.9750	K	A	127	142
PSM	LLELGPKPEVAQQTR	600	sp|P53621|COPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=5776	36.048	2	1677.9414	1677.9414	R	K	1128	1143
PSM	LLSDATVEKDESHAGK	601	sp|Q14320|FA50A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=2849	19.05	2	1698.8424	1698.8424	R	V	290	306
PSM	LPGPPDAPGAVFVLGGEGLR	602	sp|Q96GD0|PLPP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=11528	72.084	2	1918.0312	1918.0312	R	A	100	120
PSM	LRGDAAAGPGPGAGAGAAAEPEPR	603	sp|Q6DKJ4|NXN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:267,24-UNIMOD:267	ms_run[2]:scan=3127	20.699	3	2135.0623	2135.0623	R	R	60	84
PSM	LVSEKVDDYEHAAK	604	sp|O43148|MCES_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=3345	21.971	2	1602.789	1602.7890	K	Y	429	443
PSM	MEGSGEQPGPQPQHPGDHR	605	sp|Q9UJA5-3|TRM6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:1	ms_run[2]:scan=2609	17.574	2	2081.8973	2081.8973	-	I	1	20
PSM	MFDYTDDPEGPVMPGSHSVER	606	sp|Q09161|NCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:35,21-UNIMOD:267	ms_run[2]:scan=6808	42.222	2	2391.0023	2391.0023	R	F	291	312
PSM	MGPGAASGGERPNLK	607	sp|Q9H0U4|RAB1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=2449	16.675	2	1440.7143	1440.7143	R	I	173	188
PSM	MLETKWSLLQQQK	608	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7528	46.495	2	1631.8705	1631.8705	K	T	118	131
PSM	MVLAAAGGVEHQQLLDLAQK	609	sp|P31930|QCR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:35,20-UNIMOD:188	ms_run[2]:scan=7912	48.801	3	2113.1297	2113.1297	R	H	229	249
PSM	NCISTVVHQGLIR	610	sp|P78527-2|PRKDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=6771	41.999	2	1505.8012	1505.8012	R	I	477	490
PSM	NGGLGHMNIALLSDLTK	611	sp|P30048-2|PRDX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:35,17-UNIMOD:188	ms_run[2]:scan=9321	57.722	2	1774.9343	1774.9343	K	Q	132	149
PSM	NIFLKDQNIFVQK	612	sp|P53004|BIEA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=8455	52.255	2	1605.8879	1605.8879	K	L	249	262
PSM	NILFVITKPDVYK	613	sp|Q9BZK3|NACP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9606	59.507	2	1548.8916	1548.8916	K	S	100	113
PSM	NILHQGQEAILQR	614	sp|Q96C86|DCPS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:267	ms_run[2]:scan=6161	38.351	2	1528.8349	1528.8349	R	Y	243	256
PSM	QAVDFLSNEGHIYSTVDDDHFK	615	sp|P15927|RFA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=8933	55.278	2	2536.1506	2536.1506	K	S	244	266
PSM	QRYEILTPNSIPK	616	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=6677	41.439	2	1557.8515	1557.8515	R	G	719	732
PSM	RAGELTEDEVER	617	sp|P62269|RS18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=2457	16.72	2	1402.6688	1402.6688	K	V	55	67
PSM	RANNNAAVAPTTCPLQPVTDPFAFSR	618	sp|O15027-2|SC16A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:4	ms_run[2]:scan=9742	60.377	3	2814.3871	2814.3871	R	Q	34	60
PSM	RFDEILEASDGIMVAR	619	sp|P14618-3|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:267,13-UNIMOD:35,16-UNIMOD:267	ms_run[2]:scan=8675	53.637	3	1856.9205	1856.9205	R	G	264	280
PSM	RFEAEPLPENTNR	620	sp|Q9BTU6|P4K2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:267,13-UNIMOD:267	ms_run[2]:scan=4117	26.471	2	1591.7858	1591.7858	R	Q	276	289
PSM	RGPCIIYNEDNGIIK	621	sp|P36578|RL4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	4-UNIMOD:4	ms_run[2]:scan=6592	40.935	2	1760.888	1760.8880	R	A	205	220
PSM	RLPTEEEWEFAAR	622	sp|Q8NBJ7-2|SUMF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:267,13-UNIMOD:267	ms_run[2]:scan=7509	46.386	2	1652.8062	1652.8062	K	G	74	87
PSM	RLPTEEEWEFAAR	623	sp|Q8NBJ7-2|SUMF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7512	46.403	2	1632.7896	1632.7896	K	G	74	87
PSM	RLQEENLVITPR	624	sp|P09327|VILI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:267,12-UNIMOD:267	ms_run[2]:scan=5576	34.871	2	1486.8371	1486.8371	K	L	609	621
PSM	RNFILDQTNVSAAAQR	625	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=6364	39.556	3	1802.9387	1802.9387	K	R	556	572
PSM	RWDQTADQTPGATPK	626	sp|O75533|SF3B1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=2968	19.769	2	1670.8012	1670.8012	R	K	199	214
PSM	SAFEEEGKETADITHALSK	627	sp|Q15042-4|RB3GP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7084	43.846	3	2061.9855	2061.9855	R	L	304	323
PSM	SAYCPYSHFPVGAALLTQEGR	628	sp|P32320|CDD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	4-UNIMOD:4,21-UNIMOD:267	ms_run[2]:scan=9861	61.142	2	2333.1138	2333.1138	K	I	28	49
PSM	SEIPTKDVPIVHTETK	629	sp|P11171-6|41_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=4743	30.059	2	1792.9571	1792.9571	K	T	450	466
PSM	SGKLVFLGLDNAGK	630	sp|Q9NR31|SAR1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7885	48.653	2	1417.7929	1417.7929	K	T	25	39
PSM	SKLESELANFGPR	631	sp|Q14683|SMC1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7422	45.876	2	1446.7467	1446.7467	K	I	735	748
PSM	SLLRQPDISCILGTGGK	632	sp|P57740-2|NU107_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	10-UNIMOD:4	ms_run[2]:scan=9392	58.174	3	1813.972	1813.9720	R	S	40	57
PSM	SNKQNLFLGSLTSR	633	sp|Q3ZCQ8-2|TIM50_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7363	45.518	2	1563.8369	1563.8369	K	L	435	449
PSM	SQEGRPVQVIGALIGK	634	sp|Q7L5N1|CSN6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9031	55.892	2	1650.9417	1650.9417	R	Q	60	76
PSM	SSPSGPSNPSNPSVEEKLEHLEK	635	sp|Q8WY22|BRI3B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=6051	37.702	2	2448.1769	2448.1769	R	Q	207	230
PSM	STGLILDSGATHTTAIPVHDGYVLQQGIVK	636	sp|O96019-2|ACL6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	30-UNIMOD:188	ms_run[2]:scan=9327	57.762	3	3096.6551	3096.6551	R	S	123	153
PSM	STLLGVLTHGELDNGR	637	sp|O00178|GTPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=10305	63.998	2	1680.8795	1680.8795	K	G	174	190
PSM	TDMDQIITSKEHLASK	638	sp|Q96TA1-2|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=5989	37.326	2	1815.9037	1815.9037	R	I	294	310
PSM	THLPGFVEQAEALK	639	sp|P30044-2|PRDX5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=8083	49.867	2	1538.8093	1538.8093	K	A	51	65
PSM	TKGHLDAELDAYMAQTDPETND	640	sp|Q9Y3Y2-4|CHTOP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=8232	50.863	2	2434.0594	2434.0594	K	-	181	203
PSM	TRDGSDYEGWCWPGSAGYPDFTNPTMR	641	sp|Q14697|GANAB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	11-UNIMOD:4	ms_run[2]:scan=11100	69.244	3	3122.2923	3122.2923	K	A	492	519
PSM	TRPVVAAGAVGLAQR	642	sp|P11310|ACADM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:267,15-UNIMOD:267	ms_run[2]:scan=4761	30.162	2	1484.869	1484.8690	K	A	280	295
PSM	TVNKHGDEIITSTTSNYETQTFSSK	643	sp|Q6P2Q9|PRP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	4-UNIMOD:188,25-UNIMOD:188	ms_run[2]:scan=5835	36.42	3	2799.3602	2799.3602	R	T	2046	2071
PSM	TVNKHGDEIITSTTSNYETQTFSSK	644	sp|Q6P2Q9|PRP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=5841	36.456	2	2787.3199	2787.3199	R	T	2046	2071
PSM	VCQASQLQGQKEESCVPVHQK	645	sp|Q92667-2|AKAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=2974	19.806	3	2439.1635	2439.1635	R	T	375	396
PSM	VDDHDSEEICLDHLCK	646	sp|Q7Z2W4-2|ZCCHV_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	10-UNIMOD:4,15-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=5692	35.541	2	1989.8504	1989.8504	R	G	504	520
PSM	VIPELNGKLTGMAFR	647	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9230	57.135	2	1644.9021	1644.9021	K	V	220	235
PSM	VISGVLQLGNIVFKK	648	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=11375	71.069	2	1613.9869	1613.9869	R	E	342	357
PSM	VISGVLQLGNIVFKK	649	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	14-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=11377	71.081	2	1626.0271	1626.0271	R	E	342	357
PSM	VLLGQDEPLIHVFAK	650	sp|Q9BT73|PSMG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	15-UNIMOD:188	ms_run[2]:scan=10615	66.006	2	1683.9655	1683.9655	K	N	66	81
PSM	VLPEFDTPGHTLSWGK	651	sp|P07686|HEXB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	16-UNIMOD:188	ms_run[2]:scan=9017	55.809	2	1788.9142	1788.9142	R	G	285	301
PSM	YFECPALQGIFTRPSK	652	sp|Q9UDT6-2|CLIP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	4-UNIMOD:4	ms_run[2]:scan=10464	65.024	2	1912.9506	1912.9506	R	L	129	145
PSM	YSGRDSLIFLVDASK	653	sp|P12956|XRCC6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9878	61.251	2	1669.8675	1669.8675	K	A	32	47
PSM	CRPDQLTGLSLLPLSEK	654	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=11805	74.01243166666667	2	1908.9936	1908.9974	R	A	3336	3353
PSM	RFDEILEASDGIMVAR	655	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=9978	61.876573333333326	2	1821.887537	1820.909084	R	G	279	295
PSM	VVCDENGSKGYGFVHFETQEAAER	656	sp|P11940|PABP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	3-UNIMOD:4,9-UNIMOD:188,24-UNIMOD:267	ms_run[1]:scan=7329	45.30604833333334	3	2745.231049	2744.247142	K	A	130	154
PSM	VVCDENGSKGYGFVHFETQEAAER	657	sp|P11940|PABP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	3-UNIMOD:4,9-UNIMOD:188,24-UNIMOD:267	ms_run[1]:scan=7340	45.373490000000004	2	2745.229270	2744.247142	K	A	130	154
PSM	HTGPGILSMANAGPNTNGSQFFICTAK	658	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	24-UNIMOD:4	ms_run[1]:scan=10295	63.931308333333334	2	2791.309890	2790.321769	K	T	92	119
PSM	HSQFLGYPITLYLEK	659	sp|Q58FF8|H90B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	15-UNIMOD:188	ms_run[1]:scan=11156	69.61302833333333	2	1813.967689	1813.971001	K	E	127	142
PSM	QLFHPEQLITGKEDAANNYAR	660	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:28	ms_run[1]:scan=9530	59.02780166666667	3	2397.1735	2397.1708	R	G	85	106
PSM	CDLHRLEEGPPVTTVLTR	661	sp|P08559|ODPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=9549	59.14666999999999	3	2075.0497	2075.0464	K	E	41	59
PSM	CDLHRLEEGPPVTTVLTR	662	sp|P08559|ODPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:385,1-UNIMOD:4,5-UNIMOD:267,18-UNIMOD:267	ms_run[1]:scan=9513	58.924490000000006	3	2095.0674	2095.0630	K	E	41	59
PSM	IHVLEAQDLIAK	663	sp|Q9BSJ8|ESYT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=7309	45.191179999999996	2	1348.771255	1348.771451	R	D	651	663
PSM	CPNLTHLNLSGNK	664	sp|P39687|AN32A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:385,1-UNIMOD:4,13-UNIMOD:188	ms_run[1]:scan=7848	48.445415000000004	2	1455.7245	1455.7231	K	I	87	100
PSM	QIENIVDKTFFHQENVR	665	sp|Q9H089|LSG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:28,8-UNIMOD:188,17-UNIMOD:267	ms_run[1]:scan=11566	72.35295	3	2115.0686	2115.0715	K	A	587	604
PSM	LLTEIHGGAGGPSGR	666	sp|Q16763|UBE2S_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=3537	23.080586666666665	2	1421.743789	1420.742276	R	A	150	165
PSM	GQAFVIFKELGSSTNALR	667	sp|P08579|RU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	8-UNIMOD:188,18-UNIMOD:267	ms_run[1]:scan=11045	68.87670333333334	2	1953.053305	1953.065459	R	Q	50	68
PSM	ACNQLGQFLQHR	668	sp|O95782-2|AP2A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:4	ms_run[2]:scan=6713	41.655	2	1470.715	1470.7150	R	E	330	342
PSM	AGNPAVAAPQSPLSPEGAHFR	669	sp|P09455-2|RET1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	21-UNIMOD:267	ms_run[2]:scan=6444	40.04	3	2083.0475	2083.0475	R	A	10	31
PSM	ALDMSYDHKPEDEVELAR	670	sp|O15355|PPM1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6263	38.97	2	2116.9735	2116.9735	K	I	359	377
PSM	APDEPQQAQVPHVWGWEVAGAPALR	671	sp|Q8IVT2|MISP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10553	65.601	3	2708.3459	2708.3459	R	L	513	538
PSM	ARPCIIPENEEIPR	672	sp|P0CW19-2|LIMS3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:267,4-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=6129	38.166	2	1712.8783	1712.8783	R	A	7	21
PSM	ASSHSSQTQGGGSVTKK	673	sp|P02545-5|LMNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=399	5.4217	2	1645.802	1645.8020	R	R	303	320
PSM	CSVPFTPIEFHYENTR	674	sp|Q9UBU9-2|NXF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=9231	57.141	2	2005.9232	2005.9232	K	A	143	159
PSM	DHTLEDEDVIQIVKK	675	sp|Q9Y295|DRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=6935	42.959	3	1792.961	1792.9610	K	-	353	368
PSM	DLIHDQDEDEEEEEGQRFYAGGSER	676	sp|Q9UNZ2-4|NSF1C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6630	41.156	2	2952.2282	2952.2282	R	S	77	102
PSM	EHAPSIIFMDEIDSIGSSR	677	sp|P62195-2|PRS8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=11622	72.738	2	2102.9943	2102.9943	R	L	232	251
PSM	ELGLREENEGVYNGSWGGR	678	sp|P49419|AL7A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6925	42.897	2	2120.9875	2120.9875	K	G	44	63
PSM	EQLEEEEEAKHNLEK	679	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=3351	22.008	2	1853.8643	1853.8643	R	Q	1343	1358
PSM	FAAKGEGQLGPAER	680	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=2839	18.988	2	1429.7314	1429.7314	K	A	236	250
PSM	FFGKDISTTLNADEAVAR	681	sp|Q92598-2|HS105_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	4-UNIMOD:188,18-UNIMOD:267	ms_run[2]:scan=8285	51.199	2	1970.008	1966.0199	K	G	357	375
PSM	FKNWDDVLTVDYTR	682	sp|Q13045-2|FLII_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9636	59.698	2	1770.8577	1770.8577	K	N	780	794
PSM	FNLLREENEGYAK	683	sp|Q8NI27|THOC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6212	38.656	2	1581.7787	1581.7787	K	L	162	175
PSM	FREALGDAQQSVR	684	sp|Q99615-2|DNJC7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=3716	24.123	2	1475.7481	1475.7481	R	L	22	35
PSM	GEMMDLQHGSLFLR	685	sp|P00338-5|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9428	58.402	2	1632.7752	1632.7752	K	T	60	74
PSM	GEMMDLQHGSLFLR	686	sp|P00338-5|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:267	ms_run[2]:scan=9426	58.392	2	1642.7835	1642.7835	K	T	60	74
PSM	GFFDPNTHENLTYR	687	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:267	ms_run[2]:scan=7195	44.504	2	1719.7881	1719.7881	K	Q	3479	3493
PSM	GGAAVDPDSGLEHSAHVLEK	688	sp|P09874|PARP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5444	34.077	2	1987.9599	1987.9599	K	G	529	549
PSM	GIGFGDIFKEGSVK	689	sp|Q9Y5K6|CD2AP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9575	59.312	2	1452.7613	1452.7613	R	L	213	227
PSM	GKLEAIITPPPAK	690	sp|O75367-2|H2AY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=5385	33.727	2	1345.8372	1345.8372	K	K	122	135
PSM	GLGGEVPGSHQGPDPYR	691	sp|Q6UW68|TM205_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	17-UNIMOD:267	ms_run[2]:scan=4485	28.573	2	1731.8204	1731.8204	R	Q	125	142
PSM	GPGGSSLLIEALSNSSHK	692	sp|Q9BSH4|TACO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9171	56.761	2	1752.9006	1752.9006	R	C	142	160
PSM	GVTIIGPATVGGIKPGCFK	693	sp|P53396-3|ACLY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	17-UNIMOD:4	ms_run[2]:scan=8801	54.439	2	1871.0339	1871.0339	K	I	346	365
PSM	GYGFVHFETQEAAER	694	sp|P11940-2|PABP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6914	42.833	3	1739.7903	1739.7903	K	A	139	154
PSM	HAEATLGSGNLR	695	sp|Q9H8S9-2|MOB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=2225	15.393	2	1224.6211	1224.6211	K	Q	31	43
PSM	HENVVNLIEICR	696	sp|P50750|CDK9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	11-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=7863	48.526	2	1504.7696	1504.7696	K	T	75	87
PSM	HGIVEDWDLMER	697	sp|P61158|ARP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8919	55.193	2	1498.6875	1498.6875	R	F	80	92
PSM	HILLAVANDEELNQLLK	698	sp|O75367-2|H2AY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	17-UNIMOD:188	ms_run[2]:scan=11093	69.195	3	1938.0882	1938.0882	R	G	80	97
PSM	HQSFVLVGETGSGK	699	sp|O43143|DHX15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5009	31.576	2	1444.731	1444.7310	R	T	153	167
PSM	HSSLAGCQIINYR	700	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=5357	33.571	2	1527.7492	1527.7492	R	T	145	158
PSM	ILFIFIDSDHTDNQR	701	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	15-UNIMOD:267	ms_run[2]:scan=10804	67.279	2	1842.914	1842.9140	K	I	286	301
PSM	ISMPGFKGEGPEVDVNLPK	702	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=9159	56.686	2	2025.0644	2025.0644	K	A	3158	3177
PSM	ITKPGSIDSNNQLFAPGGR	703	sp|Q04637-6|IF4G1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6059	37.751	3	1971.0174	1971.0174	K	L	876	895
PSM	IYGADDIELLPEAQHKAEVYTK	704	sp|P11586|C1TC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8595	53.138	3	2502.2642	2502.2642	K	Q	833	855
PSM	KACGNFGIPCELR	705	sp|P22234|PUR6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=6515	40.481	2	1520.7228	1520.7228	K	V	286	299
PSM	KASGPPVSELITK	706	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=5081	31.988	2	1337.7957	1337.7957	R	A	34	47
PSM	KIEFSLPDLEGR	707	sp|P35998-2|PRS7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9570	59.286	2	1402.7456	1402.7456	R	T	203	215
PSM	KLFGQESGPSAEK	708	sp|Q9BWH2|FUND2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=2866	19.152	2	1388.7339	1388.7339	R	Y	68	81
PSM	KLGEMWSEQSAK	709	sp|P26583|HMGB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=4619	29.352	2	1392.6708	1392.6708	K	D	128	140
PSM	KLNTETFGVSGR	710	sp|Q9BX40-2|LS14B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=4247	27.224	2	1307.6834	1307.6834	R	F	340	352
PSM	KLYGDVPFIEER	711	sp|Q9NRF8|PYRG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=7937	48.954	2	1464.7613	1464.7613	R	H	466	478
PSM	KQYPISLVLAPTR	712	sp|O00571-2|DDX3X_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8046	49.63	2	1484.8715	1484.8715	R	E	248	261
PSM	LAQANGWGVMVSHR	713	sp|P06733-2|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:267	ms_run[2]:scan=6342	39.424	2	1534.7702	1534.7702	K	S	266	280
PSM	LFDHPESPTPNPTEPLFLAQAEVYK	714	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=11233	70.124	3	2839.4069	2839.4069	R	E	968	993
PSM	LFDYFPKPYPNSEAAR	715	sp|P08574|CY1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8596	53.144	2	1913.9312	1913.9312	K	A	171	187
PSM	LGIEGLSLHNVLK	716	sp|Q9NYU2-2|UGGG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:188	ms_run[2]:scan=9792	60.697	2	1397.8338	1397.8338	R	L	403	416
PSM	LGLEALAANHQQLFTDGR	717	sp|Q9Y2Z4|SYYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9354	57.933	3	1953.0068	1953.0068	R	S	146	164
PSM	LGLLDNHSSEFNVTR	718	sp|P36776-3|LONM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=7506	46.371	3	1700.8482	1700.8482	K	N	249	264
PSM	LHNMIVDLDNVVK	719	sp|Q16891-3|MIC60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:188	ms_run[2]:scan=9123	56.466	2	1514.8222	1514.8222	K	K	299	312
PSM	LHVGNISPTCTNQELR	720	sp|Q9BQ04|RBM4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	10-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=5422	33.941	2	1847.9187	1847.9187	K	A	80	96
PSM	LIAHAGSLTNLAK	721	sp|O00567|NOP56_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:188	ms_run[2]:scan=5195	32.65	2	1313.7763	1313.7763	R	Y	308	321
PSM	LRQLAEEDLAQQR	722	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=4424	28.219	2	1568.8271	1568.8271	R	A	2261	2274
PSM	LVARPEPATGYTLEFR	723	sp|Q16658|FSCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	4-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=7364	45.524	2	1838.9794	1838.9794	R	S	202	218
PSM	LVINGNPITIFQERDPSK	724	sp|P04406|G3P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10125	62.822	2	2040.1004	2040.1004	K	I	67	85
PSM	MLITILGTVKPNANR	725	sp|P17931|LEG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:35	ms_run[2]:scan=7765	47.938	2	1655.9393	1655.9393	R	I	130	145
PSM	MLVQCMQDQEHPSIR	726	sp|O00410-2|IPO5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:35,5-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=4840	30.623	2	1896.852	1896.8520	R	T	116	131
PSM	MLVQCMQDQEHPSIR	727	sp|O00410-2|IPO5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:35,5-UNIMOD:4	ms_run[2]:scan=4839	30.617	2	1886.8437	1886.8437	R	T	116	131
PSM	NCLTNFHGMDLTR	728	sp|P61247|RS3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:4	ms_run[2]:scan=7253	44.855	2	1577.7079	1577.7079	K	D	95	108
PSM	NILFVITKPDVYK	729	sp|Q9BZK3|NACP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9597	59.451	2	1548.8916	1548.8916	K	S	100	113
PSM	NILHQGQEAILQR	730	sp|Q96C86|DCPS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6167	38.389	2	1518.8267	1518.8267	R	Y	243	256
PSM	NLRDIDEVSSLLR	731	sp|P50990|TCPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9526	59.008	2	1528.8209	1528.8209	K	T	153	166
PSM	NREPVQLETLSIR	732	sp|P62314|SMD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6947	43.032	2	1553.8526	1553.8526	K	G	49	62
PSM	NRVIGSGCNLDSAR	733	sp|P00338-5|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	8-UNIMOD:4	ms_run[2]:scan=2829	18.928	2	1517.7369	1517.7369	K	F	156	170
PSM	NSSYVHGGLDSNGKPADAVYGQK	734	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:188,23-UNIMOD:188	ms_run[2]:scan=4204	26.987	3	2375.1545	2375.1545	K	E	37	60
PSM	PNIVLFSGSSHQDLSQR	735	sp|P11908|PRPS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=7057	43.678	3	1883.949	1883.9490	M	V	2	19
PSM	RALANSLACQGK	736	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:4	ms_run[2]:scan=2073	14.593	2	1287.6718	1287.6718	K	Y	331	343
PSM	RANNNAAVAPTTCPLQPVTDPFAFSR	737	sp|O15027-2|SC16A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:267,13-UNIMOD:4,26-UNIMOD:267	ms_run[2]:scan=9751	60.434	3	2834.4037	2834.4037	R	Q	34	60
PSM	RGESLDNLDSPR	738	sp|Q8WWI1-3|LMO7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=3491	22.819	2	1357.6586	1357.6586	R	S	1173	1185
PSM	RLAPEYEAAATR	739	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:267,12-UNIMOD:267	ms_run[2]:scan=3100	20.546	2	1366.7108	1366.7108	K	L	62	74
PSM	RLPEYPQVDDLLLR	740	sp|Q9UI10-3|EI2BD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10280	63.833	2	1725.9414	1725.9414	K	R	142	156
PSM	RTTDFSDFLSIVGCTK	741	sp|Q9UHD1|CHRD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:4	ms_run[2]:scan=11557	72.287	2	1845.8931	1845.8931	R	G	46	62
PSM	RYPNVFGIGDCTNLPTSK	742	sp|Q9Y6N5|SQOR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	11-UNIMOD:4	ms_run[2]:scan=8553	52.879	2	2037.9942	2037.9942	R	T	327	345
PSM	SGKGPILMELQTYR	743	sp|P08559-3|ODPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=7992	49.289	2	1591.8392	1591.8392	R	Y	244	258
PSM	SRSGEGEVSGLMR	744	sp|Q13263-2|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:267,13-UNIMOD:267	ms_run[2]:scan=3809	24.645	2	1383.6679	1383.6680	R	K	389	402
PSM	SSPGQTPEEGAQALAEFAALHGPALR	745	sp|Q14166|TTL12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=11480	71.763	2	2604.2932	2604.2932	R	A	15	41
PSM	SYSKLLCGLLAER	746	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:4	ms_run[2]:scan=9919	61.511	2	1508.8021	1508.8021	R	L	75	88
PSM	TFVNITPAEVGVLVGKDR	747	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10776	67.099	3	1914.0575	1914.0575	K	S	39	57
PSM	TKGVDEVTIVNILTNR	748	sp|P07355-2|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:188,16-UNIMOD:267	ms_run[2]:scan=10673	66.377	2	1787.0124	1783.0242	K	S	66	82
PSM	TKPSPSQFMPLVVDYR	749	sp|Q8TCS8|PNPT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9604	59.491	2	1863.9553	1863.9553	K	Q	88	104
PSM	TLDSWRDEFLIQASPR	750	sp|P51149|RAB7A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10048	62.329	2	1932.9694	1932.9694	K	D	98	114
PSM	TNHIYVSSDDIKETGYTYILPK	751	sp|Q6P2Q9|PRP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8396	51.9	3	2556.2748	2556.2748	R	N	2087	2109
PSM	TNHIYVSSDDIKETGYTYILPK	752	sp|Q6P2Q9|PRP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	12-UNIMOD:188,22-UNIMOD:188	ms_run[2]:scan=8397	51.905	3	2568.315	2568.3150	R	N	2087	2109
PSM	TRPVVAAGAVGLAQR	753	sp|P11310|ACADM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=4752	30.112	2	1464.8525	1464.8525	K	A	280	295
PSM	TTEDEVHICHNQDGYSYPSR	754	sp|P01130-2|LDLR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:4,20-UNIMOD:267	ms_run[2]:scan=4448	28.353	3	2417.0218	2417.0218	K	Q	653	673
PSM	VDDHDSEEICLDHLCK	755	sp|Q7Z2W4-2|ZCCHV_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	10-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=5701	35.596	2	1983.8302	1983.8302	R	G	504	520
PSM	VHEYNVLLETLSR	756	sp|P30533|AMRP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9656	59.824	2	1571.8308	1571.8308	K	T	183	196
PSM	VPVVFVTNAGNILQHSK	757	sp|Q9BXW7-2|HDHD5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9348	57.894	3	1822.0101	1822.0101	R	A	53	70
PSM	VRLGDVISIQPCPDVK	758	sp|P55072|TERA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	12-UNIMOD:4	ms_run[2]:scan=8328	51.47	2	1794.9662	1794.9662	R	Y	94	110
PSM	VSFELFADKVPK	759	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=9127	56.487	2	1390.7899	1390.7899	R	T	20	32
PSM	YHDPNFVPAAFVCSK	760	sp|P49711-2|CTCF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:4	ms_run[2]:scan=7940	48.971	2	1750.8137	1750.8137	R	C	217	232
PSM	YIESPVLFLREDVGK	761	sp|Q14166|TTL12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10534	65.477	2	1763.9458	1763.9458	K	V	452	467
PSM	YNQLLRIEEELGSK	762	sp|P06733-2|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9698	60.097	2	1690.889	1690.8890	K	A	314	328
PSM	YRPASASVSALIGGR	763	sp|P46108-2|CRK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6742	41.829	2	1503.8158	1503.8158	K	-	190	205
PSM	QEYDESGPSIVHRK	764	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:28,13-UNIMOD:267,14-UNIMOD:188	ms_run[1]:scan=3863	24.946998333333333	2	1642.7896	1642.7917	K	C	360	374
PSM	QEYDESGPSIVHRK	765	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:28	ms_run[1]:scan=3860	24.926276666666666	2	1626.7608	1626.7633	K	C	360	374
PSM	HTGPGILSMANAGPNTNGSQFFICTAK	766	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	9-UNIMOD:35,24-UNIMOD:4	ms_run[1]:scan=8944	55.34984833333333	3	2807.304590	2806.316684	K	T	92	119
PSM	RGPCIIYNEDNGIIK	767	sp|P36578|RL4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	1-UNIMOD:267,4-UNIMOD:4,15-UNIMOD:188	ms_run[1]:scan=6857	42.51269833333333	2	1777.898493	1776.916352	R	A	205	220
PSM	GGPNIITLADIVKD	768	sp|P68400|CSK21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	13-UNIMOD:188	ms_run[1]:scan=11575	72.4137	2	1430.8038	1430.8071	R	P	90	104
PSM	CHAIIDEQPLIFK	769	sp|P48059-3|LIMS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:385,1-UNIMOD:4,13-UNIMOD:188	ms_run[1]:scan=10319	64.09061666666666	2	1571.8148	1571.8108	K	N	200	213
PSM	TGRFEEAAGAAPCR	770	sp|Q9Y4P3|TBL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	3-UNIMOD:267,13-UNIMOD:4,14-UNIMOD:267	ms_run[1]:scan=2717	18.235963333333334	2	1511.696312	1511.705399	K	L	323	337
PSM	TGRFEEAAGAAPCR	771	sp|Q9Y4P3|TBL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	13-UNIMOD:4	ms_run[1]:scan=2721	18.26343	2	1491.680123	1491.688861	K	L	323	337
PSM	GLVHAAGPGQDSGSQAGSPPTR	772	sp|Q96ER9|MITOK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=2643	17.781546666666667	3	2045.976250	2045.987879	R	D	271	293
PSM	QLHCCHLASLQELVDPQAPQK	773	sp|P57081|WDR4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:28,4-UNIMOD:4,5-UNIMOD:4	ms_run[1]:scan=9712	60.184851666666674	2	2454.1802	2454.1779	R	F	223	244
PSM	VGLADLHPDVFATAPR	774	sp|Q9BYD3|RM04_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=9342	57.85483833333333	2	1677.888721	1677.883855	R	L	77	93
PSM	GLCLLEQIDSFKPPQR	775	sp|Q9Y450|HBS1L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	3-UNIMOD:4	ms_run[1]:scan=11112	69.32101166666666	2	1900.984307	1899.987669	K	S	467	483
PSM	LHVGNISPTCTNKELR	776	sp|Q9BWF3|RBM4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	10-UNIMOD:4,16-UNIMOD:267	ms_run[1]:scan=5422	33.9408	2	1847.920086	1847.955135	K	A	80	96
PSM	ALQALEELRLQAEEAER	777	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9839	61.003	3	1968.0276	1968.0276	R	R	1502	1519
PSM	ALQALEELRLQAEEAER	778	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	9-UNIMOD:267,17-UNIMOD:267	ms_run[2]:scan=9847	61.054	3	1988.0442	1988.0442	R	R	1502	1519
PSM	AQPPEAGPQGLHDLGR	779	sp|A0FGR8-5|ESYT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	16-UNIMOD:267	ms_run[2]:scan=4786	30.306	2	1651.8306	1651.8306	K	S	127	143
PSM	ASGNYATVISHNPETKK	780	sp|P62917|RL8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	16-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=3129	20.71	2	1827.9518	1827.9518	R	T	129	146
PSM	ASLPTLGFTHFQPAQLTTVGK	781	sp|P30566-2|PUR8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=10801	67.255	2	2213.1845	2213.1845	R	R	150	171
PSM	AYHSFLVEPISCHAWNK	782	sp|O15143|ARC1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:1,12-UNIMOD:4	ms_run[2]:scan=9937	61.624	3	2099.9887	2099.9887	M	D	2	19
PSM	DKTSDLVEEYFEAHSSSK	783	sp|Q13416|ORC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=8984	55.599	3	2070.9382	2070.9382	R	V	234	252
PSM	DLIHDQDEDEEEEEGQRFYAGGSER	784	sp|Q9UNZ2-4|NSF1C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6633	41.178	3	2952.2282	2952.2282	R	S	77	102
PSM	EFPGFLENQKDPLAVDK	785	sp|P60903|S10AA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	10-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=9550	59.153	2	1958.0188	1958.0188	K	I	38	55
PSM	EVKPEETTCSEHCLQK	786	sp|Q9Y5J7|TIM9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	9-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=1729	12.685	2	1973.8823	1973.8823	R	Y	40	56
PSM	FCFSNEFSTFTHK	787	sp|Q9Y3B3-2|TMED7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:4	ms_run[2]:scan=9474	58.686	2	1650.7137	1650.7137	K	T	108	121
PSM	FLVPDHVNMSELIK	788	sp|Q9GZQ8|MLP3B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:188	ms_run[2]:scan=10264	63.728	2	1646.8797	1646.8797	K	I	52	66
PSM	FSHLTSLPQQLPSQQLMSK	789	sp|Q6PKG0-3|LARP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	19-UNIMOD:188	ms_run[2]:scan=8322	51.431	2	2175.1454	2175.1454	R	D	502	521
PSM	GALQAVDQLSLFRPLCK	790	sp|A1L0T0|ILVBL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	16-UNIMOD:4	ms_run[2]:scan=11428	71.416	2	1915.035	1915.0350	R	F	158	175
PSM	GGQTHLGLPVFNTVK	791	sp|P53597|SUCA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	15-UNIMOD:188	ms_run[2]:scan=8049	49.652	2	1572.872	1572.8720	K	E	91	106
PSM	GIGFGDIFKEGSVK	792	sp|Q9Y5K6|CD2AP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	9-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=9574	59.306	2	1464.8015	1464.8015	R	L	213	227
PSM	GNSLTLIDLPGHESLR	793	sp|Q9Y5M8|SRPRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=8882	54.964	2	1720.9108	1720.9108	R	L	110	126
PSM	GPGGSSLLIEALSNSSHK	794	sp|Q9BSH4|TACO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9178	56.807	3	1752.9006	1752.9006	R	C	142	160
PSM	GWLRDPSASPGDAGEQAIR	795	sp|P18206-2|VINC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6331	39.365	3	1981.9606	1981.9606	K	Q	282	301
PSM	GYGFVHFETQEAAER	796	sp|P11940-2|PABP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	15-UNIMOD:267	ms_run[2]:scan=6913	42.828	3	1749.7986	1749.7986	K	A	139	154
PSM	HGIVEDWDLMER	797	sp|P61158|ARP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:267	ms_run[2]:scan=8917	55.183	2	1508.6957	1508.6957	R	F	80	92
PSM	HLCEPGADGAETFADGVPR	798	sp|Q14839|CHD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:4	ms_run[2]:scan=6482	40.273	3	1997.8901	1997.8901	R	E	1466	1485
PSM	HSQFIGYPITLFVEK	799	sp|P07900-2|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	15-UNIMOD:188	ms_run[2]:scan=11745	73.599	2	1783.9604	1783.9604	K	E	332	347
PSM	HVPGGGNVQIQNK	800	sp|P27816-4|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:188	ms_run[2]:scan=1692	12.482	2	1352.7256	1352.7256	K	K	736	749
PSM	ILHCLGLAEEIQK	801	sp|P53004|BIEA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:4	ms_run[2]:scan=7013	43.413	2	1522.8177	1522.8177	R	Y	278	291
PSM	IRPGEQEQYESTIGFK	802	sp|P11171-6|41_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5980	37.272	2	1880.9268	1880.9268	K	L	207	223
PSM	ISGLIYEETRGVLK	803	sp|P62805|H4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=8246	50.953	2	1576.8825	1576.8825	R	V	47	61
PSM	IVAPISDSPKPPPQR	804	sp|O95336|6PGL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=4202	26.972	2	1600.8937	1600.8937	K	V	171	186
PSM	IYGADDIELLPEAQHKAEVYTK	805	sp|P11586|C1TC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	16-UNIMOD:188,22-UNIMOD:188	ms_run[2]:scan=8588	53.095	3	2514.3045	2514.3045	K	Q	833	855
PSM	KEFSPFGTITSAK	806	sp|P11940-2|PABP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6998	43.327	2	1411.7347	1411.7347	R	V	312	325
PSM	KLAPEECFSPLDLFNK	807	sp|O75319-2|DUS11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:188,7-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=11470	71.692	2	1918.9901	1918.9901	K	I	111	127
PSM	KNQDDFECVTTLEGHENEVK	808	sp|O76071|CIAO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	8-UNIMOD:4	ms_run[2]:scan=6204	38.608	2	2391.0649	2391.0649	K	S	90	110
PSM	KNVLCGNIPPDLFAR	809	sp|P23193|TCEA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	5-UNIMOD:4	ms_run[2]:scan=9307	57.631	2	1712.9032	1712.9032	R	M	208	223
PSM	KVPPSLLCEINTNAR	810	sp|Q9NWT1|PK1IP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	8-UNIMOD:4	ms_run[2]:scan=7159	44.293	2	1710.9087	1710.9087	K	L	281	296
PSM	LEGLTDEINFLR	811	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=11158	69.625	2	1418.7405	1418.7405	R	Q	214	226
PSM	LGELQGNHFTVVLR	812	sp|Q96PZ0|PUS7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:267	ms_run[2]:scan=7824	48.297	2	1591.871	1591.8710	K	N	337	351
PSM	LGLLDNHSSEFNVTR	813	sp|P36776-3|LONM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7508	46.38	2	1700.8482	1700.8482	K	N	249	264
PSM	LIQLMEEIMAEKENK	814	sp|Q92841-1|DDX17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=10664	66.32	3	1817.9267	1817.9267	K	T	327	342
PSM	LKPNLGNGADLPNYR	815	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5833	36.41	3	1640.8635	1640.8635	K	W	159	174
PSM	LLGGHNEDLPSNR	816	sp|Q9BRD0-2|BUD13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=3436	22.502	2	1420.7059	1420.7059	K	H	105	118
PSM	LNRLPAAGVGDMVMATVK	817	sp|P62829|RL23_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9511	58.913	3	1841.9856	1841.9856	R	K	49	67
PSM	LSNRPAFMPSEGK	818	sp|O43707|ACTN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=4459	28.418	2	1432.7133	1432.7133	R	M	366	379
PSM	LYFLQCETCHSR	819	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:4,9-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=6456	40.113	2	1622.7209	1622.7209	R	C	297	309
PSM	LYQYPNFAGPHAALANK	820	sp|Q9BY44-4|EIF2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	17-UNIMOD:188	ms_run[2]:scan=7025	43.485	2	1879.9676	1879.9676	R	S	139	156
PSM	MGLVDQLVEPLGPGLKPPEER	821	sp|P40939|ECHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:35	ms_run[2]:scan=10259	63.699	3	2289.2039	2289.2039	K	T	215	236
PSM	MLETKWSLLQQQK	822	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	5-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=7510	46.391	2	1643.9108	1643.9108	K	T	118	131
PSM	NCLTNFHGMDLTR	823	sp|P61247|RS3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=7247	44.819	2	1587.7161	1587.7162	K	D	95	108
PSM	NDTKEDVFVHQTAIK	824	sp|P16989-2|YBOX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=4323	27.661	2	1755.9194	1755.9194	R	K	110	125
PSM	NIHESCMSQIGWNR	825	sp|P11413|G6PD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:4	ms_run[2]:scan=5872	36.629	2	1730.7617	1730.7617	K	I	153	167
PSM	NILGGTVFREPIICK	826	sp|P48735-2|IDHP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:4	ms_run[2]:scan=9186	56.857	2	1715.9393	1715.9393	R	N	89	104
PSM	NPEVGLKPVWYSPK	827	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7349	45.429	2	1612.8613	1612.8613	K	V	536	550
PSM	NRVIGSGCNLDSAR	828	sp|P00338-5|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:267,8-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=2828	18.922	2	1537.7534	1537.7534	K	F	156	170
PSM	QAVDFLSNEGHIYSTVDDDHFK	829	sp|P15927|RFA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	22-UNIMOD:188	ms_run[2]:scan=8915	55.167	2	2542.1708	2542.1708	K	S	244	266
PSM	RLGDLQADSEESQR	830	sp|Q92614-3|MY18A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=3110	20.599	2	1602.7598	1602.7598	R	A	1410	1424
PSM	RLPEYPQVDDLLLR	831	sp|Q9UI10-3|EI2BD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:267,14-UNIMOD:267	ms_run[2]:scan=10289	63.89	2	1745.9579	1745.9579	K	R	142	156
PSM	RPISADSAIMNPASK	832	sp|Q00610-2|CLH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=4541	28.901	2	1556.7981	1556.7981	R	V	64	79
PSM	RVLQQFADNDVSR	833	sp|P51659-3|DHB4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=4395	28.06	2	1546.7852	1546.7852	R	F	525	538
PSM	SKVEETTEHLVTK	834	sp|P52732|KIF11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=2961	19.724	2	1511.8234	1511.8234	R	S	1033	1046
PSM	SLKQNINLSAPIMSR	835	sp|Q14566|MCM6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6959	43.1	2	1670.9138	1670.9138	K	F	515	530
PSM	SLLEKELESVGIR	836	sp|P55039|DRG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=10886	67.827	2	1471.8246	1471.8246	R	L	157	170
PSM	SPQVKPASTMGMGPLGK	837	sp|Q13428-8|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	5-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=5436	34.026	2	1696.9043	1696.9043	K	G	426	443
PSM	SSFDEMLPGTHFQR	838	sp|Q02218-2|ODO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:267	ms_run[2]:scan=7917	48.83	2	1660.7543	1660.7543	R	V	866	880
PSM	STHGLAILGPENPK	839	sp|Q5JRX3-3|PREP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5394	33.776	2	1432.7674	1432.7674	K	I	916	930
PSM	TGKLVFLGLDNAGK	840	sp|Q9Y6B6|SAR1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=7984	49.241	2	1443.8488	1443.8488	K	T	25	39
PSM	TGPFAEHSNQLWNISAVPSWSK	841	sp|Q15257-4|PTPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	22-UNIMOD:188	ms_run[2]:scan=10953	68.273	2	2461.2122	2461.2122	K	V	223	245
PSM	THLPGFVEQAEALK	842	sp|P30044-2|PRDX5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:188	ms_run[2]:scan=7924	48.872	2	1544.8294	1544.8294	K	A	51	65
PSM	TLDSWRDEFLIQASPR	843	sp|P51149|RAB7A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=10036	62.253	2	1952.9859	1952.9859	K	D	98	114
PSM	TQEQCVHNETKNELEK	844	sp|O60313-13|OPA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	5-UNIMOD:4,11-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=1512	11.462	2	1997.9515	1997.9515	R	M	746	762
PSM	TQEQCVHNETKNELEK	845	sp|O60313-13|OPA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	5-UNIMOD:4	ms_run[2]:scan=1514	11.472	2	1985.9113	1985.9113	R	M	746	762
PSM	TRQGVEDAFYTLVR	846	sp|P01112|RASH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9252	57.277	2	1653.8475	1653.8475	K	E	148	162
PSM	VCQASQLQGQKEESCVPVHQK	847	sp|Q92667-2|AKAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:4,11-UNIMOD:188,15-UNIMOD:4,21-UNIMOD:188	ms_run[2]:scan=2973	19.8	3	2451.2037	2451.2037	R	T	375	396
PSM	VEYSEEELKTHISK	848	sp|P12956|XRCC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	9-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=4353	27.834	2	1702.8816	1702.8816	K	G	557	571
PSM	VEYSEEELKTHISK	849	sp|P12956|XRCC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=4363	27.886	2	1690.8414	1690.8414	K	G	557	571
PSM	VGHSELVGEIIR	850	sp|P38606-2|VATA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:267	ms_run[2]:scan=6357	39.513	2	1317.728	1317.7280	R	L	12	24
PSM	VGLADLHPDVFATAPR	851	sp|Q9BYD3-2|RM04_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	16-UNIMOD:267	ms_run[2]:scan=9333	57.798	2	1687.8921	1687.8921	R	L	77	93
PSM	VLPEFDTPGHTLSWGK	852	sp|P07686|HEXB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9016	55.803	2	1782.8941	1782.8941	R	G	285	301
PSM	VTHETSAHEGQTEAPSIDEK	853	sp|P15374|UCHL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	20-UNIMOD:188	ms_run[2]:scan=1848	13.339	3	2171.0074	2171.0074	R	V	146	166
PSM	WLSTSIPEAQWHSSLAR	854	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=8985	55.606	2	1967.9854	1967.9854	R	T	712	729
PSM	TEELNREVAGHTEQLQMSR	855	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=5130	32.279625	3	2227.064567	2227.065143	R	S	275	294
PSM	HTGPGILSMANAGPNTNGSQFFICTAK	856	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	24-UNIMOD:4,27-UNIMOD:188	ms_run[1]:scan=10532	65.46438333333333	3	2798.3142	2796.3412	K	T	92	119
PSM	QWYESHYALPLGR	857	sp|P62241|RS8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:28	ms_run[1]:scan=10371	64.418245	2	1601.7648	1601.7622	R	K	111	124
PSM	KPFVYTQGQAVLNR	858	sp|Q9H4A4|AMPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	1-UNIMOD:188,14-UNIMOD:267	ms_run[1]:scan=5816	36.305701666666664	2	1635.891400	1635.906774	K	A	163	177
PSM	SHAVACVNQFIISR	859	sp|Q92973|TNPO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	6-UNIMOD:4	ms_run[1]:scan=6867	42.56563	2	1600.811620	1600.814395	R	T	200	214
PSM	QVQFHQGFGDLAVLKPSNK	860	sp|Q12965|MYO1E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:28	ms_run[1]:scan=9584	59.363434999999996	3	2095.0854	2095.0845	R	V	896	915
PSM	QVQFHQGFGDLAVLKPSNK	861	sp|Q12965|MYO1E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:28	ms_run[1]:scan=9591	59.40961333333333	2	2095.0855	2095.0845	R	V	896	915
PSM	VGAHAGEYGAEALER	862	sp|P69905|HBA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=4348	27.80891666666667	2	1528.725818	1528.727020	K	M	18	33
PSM	CSVPFTPIEFHYENTR	863	sp|Q9UBU9|NXF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:385,1-UNIMOD:4,16-UNIMOD:267	ms_run[1]:scan=11218	70.02234166666666	2	1988.8916	1988.8961	K	A	143	159
PSM	KVPCVGLSIGVER	864	sp|P12081|HARS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	4-UNIMOD:4	ms_run[1]:scan=6684	41.474988333333336	2	1413.781878	1412.780970	R	I	376	389
PSM	FAKPVYPGQTLQTEMWK	865	sp|P51659|DHB4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=8536	52.77085833333334	2	2024.018401	2023.023719	R	E	563	580
PSM	ACNQLGQFLQHR	866	sp|O95782-2|AP2A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	2-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=6711	41.64	2	1480.7233	1480.7233	R	E	330	342
PSM	AFFESHPAPSAER	867	sp|P55786-2|PSA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:267	ms_run[2]:scan=4240	27.192	2	1454.6818	1454.6818	K	T	790	803
PSM	AFTGREFDELNPSAQR	868	sp|P16615-5|AT2A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6776	42.033	2	1836.8755	1836.8755	K	D	651	667
PSM	ALIAQLPSPAIDHEQLR	869	sp|Q9UPN3|MACF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	17-UNIMOD:267	ms_run[2]:scan=8416	52.024	3	1881.0348	1881.0348	R	Q	5801	5818
PSM	APTVHGGAGGAR	870	sp|Q9C075|K1C23_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:267	ms_run[2]:scan=614	6.6915	2	1059.5449	1059.5449	R	I	31	43
PSM	AQLGLGHSYSR	871	sp|O00567|NOP56_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:267	ms_run[2]:scan=3144	20.801	2	1197.613	1197.6130	K	A	144	155
PSM	CRPDQLTGLSLLPLSEK	872	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:4	ms_run[2]:scan=10331	64.167	3	1926.0244	1926.0244	R	A	3167	3184
PSM	DAKDYADSIHAIFVETSAK	873	sp|Q9UL26|RB22A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	3-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=10014	62.11	3	2092.0516	2092.0516	R	N	132	151
PSM	DHTLEDEDVIQIVKK	874	sp|Q9Y295|DRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6953	43.064	3	1780.9207	1780.9207	K	-	353	368
PSM	DMAAFNERPIIFALSNPTSK	875	sp|P48163-2|MAOX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11485	71.798	3	2221.1201	2221.1201	K	A	318	338
PSM	DMTVPILVSKPPVFTGK	876	sp|P11182|ODB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10290	63.896	2	1828.0168	1828.0168	K	D	234	251
PSM	DREGFFTNGLTLGAK	877	sp|P35080-2|PROF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8942	55.334	2	1624.8209	1624.8209	K	K	55	70
PSM	EGDREAIVAALLTR	878	sp|Q96GQ7|DDX27_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	4-UNIMOD:267,14-UNIMOD:267	ms_run[2]:scan=9489	58.783	2	1532.8425	1532.8425	R	T	447	461
PSM	EGDREAIVAALLTR	879	sp|Q96GQ7|DDX27_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9490	58.788	2	1512.826	1512.8260	R	T	447	461
PSM	EHALLAYTLGVK	880	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:188	ms_run[2]:scan=7704	47.585	2	1319.7545	1319.7545	R	Q	135	147
PSM	EHALLAYTLGVK	881	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7542	46.58	2	1313.7343	1313.7343	R	Q	135	147
PSM	EHALLAYTLGVK	882	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7705	47.589	2	1313.7343	1313.7343	R	Q	135	147
PSM	EHAPSIIFMDEIDSIGSSR	883	sp|P62195-2|PRS8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	19-UNIMOD:267	ms_run[2]:scan=11616	72.702	3	2113.0025	2113.0025	R	L	232	251
PSM	FEHCNFNDVTTR	884	sp|P13987|CD59_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	4-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=4223	27.094	2	1548.6655	1548.6655	K	L	67	79
PSM	FISGHTSELGDFR	885	sp|Q13724-2|MOGS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:267	ms_run[2]:scan=6060	37.756	2	1474.708	1474.7080	K	F	123	136
PSM	FKDIFQEIYDK	886	sp|O75874|IDHC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9961	61.769	2	1444.7238	1444.7238	R	Q	223	234
PSM	FSGFGSGAGGKPLEGLSNGNNITSAPPFASAK	887	sp|Q9UKX7-2|NUP50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9561	59.228	3	3036.4941	3036.4941	R	A	45	77
PSM	FTISDHPQPIDPLLK	888	sp|Q86VP6-2|CAND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8767	54.206	2	1719.9196	1719.9196	K	N	823	838
PSM	GALINVPPPFLGLPR	889	sp|P26640|SYVC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	15-UNIMOD:267	ms_run[2]:scan=12221	76.912	2	1569.9271	1569.9271	R	F	619	634
PSM	GCLELIKETGVPIAGR	890	sp|P11586|C1TC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	2-UNIMOD:4	ms_run[2]:scan=8147	50.316	2	1711.9291	1711.9291	K	H	151	167
PSM	GKYFVTFPYPYMNGR	891	sp|Q9P2J5|SYLC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10051	62.347	2	1838.8814	1838.8814	K	L	44	59
PSM	GPGNPVPGPLAPLPDYMSEEKLQEK	892	sp|Q6P2Q9|PRP8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9688	60.034	3	2662.3313	2662.3313	R	A	9	34
PSM	GRQVFQQTISCPEGLR	893	sp|Q14653|IRF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	2-UNIMOD:267,11-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=6192	38.536	3	1894.9587	1894.9587	R	L	212	228
PSM	HCGDFEQQLANR	894	sp|P83436|COG7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	2-UNIMOD:4	ms_run[2]:scan=4297	27.507	2	1473.6419	1473.6419	R	I	481	493
PSM	HFEELETIMDR	895	sp|Q8TAQ2-2|SMRC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:267	ms_run[2]:scan=8095	49.947	2	1428.6583	1428.6583	R	E	936	947
PSM	HFIMQVVCEATQCPDTR	896	sp|Q14974-2|IMB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	4-UNIMOD:35,8-UNIMOD:4,13-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=7125	44.09	3	2116.9368	2116.9368	R	V	71	88
PSM	HFPIEIDSTDYVSSGPSVR	897	sp|P82673-2|RT35_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	19-UNIMOD:267	ms_run[2]:scan=8564	52.949	2	2115.0148	2115.0148	K	N	146	165
PSM	HIDLVEGDEGR	898	sp|P19367-4|HXK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=3523	23.005	2	1238.5891	1238.5891	R	M	232	243
PSM	HIDLVEGDEGR	899	sp|P19367-4|HXK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:267	ms_run[2]:scan=3525	23.015	2	1248.5974	1248.5974	R	M	232	243
PSM	HLEIIYEINQK	900	sp|P06737-2|PYGL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7032	43.53	2	1398.7507	1398.7507	R	H	366	377
PSM	HLIPAANTGESK	901	sp|P62258-2|1433E_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:188	ms_run[2]:scan=2042	14.43	2	1242.6664	1242.6664	K	V	85	97
PSM	HSGNITFDEIVNIAR	902	sp|P30050-2|RL12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	15-UNIMOD:267	ms_run[2]:scan=10090	62.588	3	1694.8616	1694.8616	K	Q	67	82
PSM	HSMNPFCEIAVEEAVR	903	sp|P38117|ETFB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	7-UNIMOD:4	ms_run[2]:scan=9501	58.852	3	1887.8608	1887.8608	K	L	36	52
PSM	HSQFIGYPITLFVEK	904	sp|P07900-2|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11763	73.72	2	1777.9403	1777.9403	K	E	332	347
PSM	HSSLAGCQIINYR	905	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	7-UNIMOD:4	ms_run[2]:scan=5353	33.547	2	1517.7409	1517.7409	R	T	145	158
PSM	HTGPNSPDTANDGFVR	906	sp|P55795|HNRH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=3179	20.995	3	1683.7601	1683.7601	K	L	99	115
PSM	HVEFLVAENER	907	sp|Q96F24-2|NRBF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:267	ms_run[2]:scan=5368	33.632	2	1351.676	1351.6760	R	L	131	142
PSM	HVEFLVAENER	908	sp|Q96F24-2|NRBF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5367	33.627	2	1341.6677	1341.6677	R	L	131	142
PSM	HVVAVVLGDVGR	909	sp|Q9BT22|ALG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6302	39.206	2	1219.7037	1219.7037	R	S	34	46
PSM	HVVEDLIAQIR	910	sp|P08473|NEP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8418	52.036	2	1291.7248	1291.7248	K	E	438	449
PSM	IEINFPAEYPFKPPK	911	sp|P68036-2|UB2L3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10225	63.481	3	1788.9451	1788.9451	R	I	21	36
PSM	IFCCHGGLSPDLQSMEQIR	912	sp|P62136|PP1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	3-UNIMOD:4,4-UNIMOD:4	ms_run[2]:scan=8863	54.846	3	2247.0235	2247.0235	K	R	169	188
PSM	IFVDIEKLPWSK	913	sp|P06737-2|PYGL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	7-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=10850	67.586	2	1485.8634	1485.8634	R	A	319	331
PSM	IGEHTPSALAIMENANVLAR	914	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:35,20-UNIMOD:267	ms_run[2]:scan=7462	46.112	3	2132.0924	2132.0924	K	Y	154	174
PSM	IGGIGTVPVGR	915	sp|Q5VTE0|EF1A3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:267	ms_run[2]:scan=5377	33.685	2	1034.6112	1034.6112	K	V	256	267
PSM	IHEDIFDIIDR	916	sp|Q9NRH3|TBG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10470	65.064	2	1384.6987	1384.6987	K	E	114	125
PSM	IREGMAALQSDPWQQELYR	917	sp|P49748-2|ACADV_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	2-UNIMOD:267,19-UNIMOD:267	ms_run[2]:scan=9337	57.825	3	2310.133	2310.1330	R	N	592	611
PSM	ITQAVLGAHDGGVFGLCALR	918	sp|O95834|EMAL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	17-UNIMOD:4,20-UNIMOD:267	ms_run[2]:scan=10011	62.092	3	2064.0814	2064.0814	R	D	285	305
PSM	KASGPPVSELITK	919	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5078	31.974	2	1325.7555	1325.7555	R	A	34	47
PSM	KATGPPVSELITK	920	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=5208	32.723	2	1351.8114	1351.8114	R	A	37	50
PSM	KGLTPSQIGVILR	921	sp|P62277|RS13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7761	47.918	2	1380.8453	1380.8453	K	D	43	56
PSM	KILNDLSSDAPGVPR	922	sp|P16220-3|CREB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6168	38.394	2	1580.8522	1580.8522	R	I	136	151
PSM	KPELWSDNFTDFVK	923	sp|Q13043|STK4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10473	65.082	2	1724.841	1724.8410	R	Q	246	260
PSM	KPLLESGTLGTK	924	sp|P22314-2|UBA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=4326	27.677	2	1242.7184	1242.7184	R	G	553	565
PSM	KQSLPATSIPTPASFK	925	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7087	43.863	2	1671.9196	1671.9196	R	F	1507	1523
PSM	LAILGIHNEVSK	926	sp|P12814-2|ACTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:188	ms_run[2]:scan=6588	40.916	2	1298.7654	1298.7654	R	I	566	578
PSM	LEGLTDEINFLR	927	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:267	ms_run[2]:scan=11164	69.665	2	1428.7488	1428.7488	R	Q	214	226
PSM	LGHPEALSAGTGSPQPPSFTYAQQR	928	sp|Q15942-2|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	25-UNIMOD:267	ms_run[2]:scan=6831	42.362	3	2606.2753	2606.2753	K	E	139	164
PSM	LGLLDNHSSEFNVTR	929	sp|P36776-3|LONM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	15-UNIMOD:267	ms_run[2]:scan=7516	46.428	2	1710.8565	1710.8565	K	N	249	264
PSM	LHGLPEQFLYGTATK	930	sp|Q02880-2|TOP2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8383	51.815	2	1673.8777	1673.8777	R	H	693	708
PSM	LKGPQITGPSLEGDLGLK	931	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8887	54.994	3	1822.02	1822.0200	K	G	370	388
PSM	LKLSEELSGGR	932	sp|P61158|ARP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=4878	30.836	2	1187.651	1187.6510	R	L	347	358
PSM	LLLASFKNEGAEPDLIR	933	sp|Q9UNK0|STX8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9430	58.412	3	1885.0309	1885.0309	R	S	92	109
PSM	LLVQHEINTLR	934	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5939	37.027	2	1334.767	1334.7670	R	A	553	564
PSM	LNHVAAGLVSPSLK	935	sp|Q05519-2|SRS11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5656	35.329	2	1404.8089	1404.8089	K	S	198	212
PSM	LRDTDTLDLSGPAR	936	sp|O60231|DHX16_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	2-UNIMOD:267,14-UNIMOD:267	ms_run[2]:scan=5116	32.194	2	1548.8011	1548.8011	R	D	47	61
PSM	LSRQEAVALLQGQR	937	sp|P46108-2|CRK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6846	42.443	2	1567.8794	1567.8794	R	H	18	32
PSM	LYQQHGAGLFDVTR	938	sp|O14773-2|TPP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6709	41.628	2	1603.8107	1603.8107	R	G	264	278
PSM	MILIQDGSQNTNVDKPLR	939	sp|Q92945|FUBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:35	ms_run[2]:scan=5538	34.641	2	2057.0575	2057.0575	K	I	267	285
PSM	MLITILGTVKPNANR	940	sp|P17931|LEG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9073	56.159	2	1639.9443	1639.9443	R	I	130	145
PSM	MRYVASYLLAALGGNSSPSAK	941	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:35,2-UNIMOD:267,21-UNIMOD:188	ms_run[2]:scan=10996	68.557	2	2187.1329	2183.1447	-	D	1	22
PSM	NAAHALPTTLGALER	942	sp|Q8NBJ5|GT251_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	15-UNIMOD:267	ms_run[2]:scan=6916	42.843	2	1543.8346	1543.8346	R	L	62	77
PSM	NASIHTLLDALER	943	sp|O00220|TR10A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10665	66.325	2	1451.7732	1451.7732	R	M	422	435
PSM	NCLTNFHGMDLTR	944	sp|P61247|RS3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	2-UNIMOD:4,9-UNIMOD:35	ms_run[2]:scan=5308	33.302	2	1593.7028	1593.7028	K	D	95	108
PSM	NFYELSPHIFALSDEAYR	945	sp|O43795-2|MYO1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11473	71.716	3	2171.0324	2171.0324	R	S	76	94
PSM	NGGLGHMNIALLSDLTK	946	sp|P30048-2|PRDX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	7-UNIMOD:35	ms_run[2]:scan=9316	57.688	3	1768.9142	1768.9142	K	Q	132	149
PSM	NHQDVAGVFALSSFLNK	947	sp|Q5VWZ2-2|LYPL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11665	73.039	2	1845.9373	1845.9373	R	A	121	138
PSM	NITRPFEDQTSLEFFSK	948	sp|Q9H7B2|RPF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9848	61.06	3	2058.0058	2058.0058	K	K	67	84
PSM	NLLHVTDTGVGMTR	949	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:35	ms_run[2]:scan=5231	32.861	2	1528.7668	1528.7668	K	E	143	157
PSM	NLRDIDEVSSLLR	950	sp|P50990|TCPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	3-UNIMOD:267,13-UNIMOD:267	ms_run[2]:scan=9522	58.982	2	1548.8375	1548.8375	K	T	153	166
PSM	NRNELAETLALLK	951	sp|Q96T23-2|RSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10397	64.587	2	1483.8358	1483.8358	R	A	163	176
PSM	NTLTNIAMRPGLEGYALPR	952	sp|P33992|MCM5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	9-UNIMOD:267,19-UNIMOD:267	ms_run[2]:scan=9535	59.06	2	2106.1159	2106.1159	R	K	177	196
PSM	NVALLSQLYHSPAR	953	sp|Q15717|ELAV1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	14-UNIMOD:267	ms_run[2]:scan=8331	51.488	2	1577.8553	1577.8553	K	R	192	206
PSM	PAQPQEHPFASSR	954	sp|Q15437|SC23B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=1976	14.061	2	1450.6953	1450.6953	R	F	218	231
PSM	PNIVLFSGSSHQDLSQR	955	sp|P11908|PRPS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	17-UNIMOD:267	ms_run[2]:scan=7059	43.689	3	1893.9572	1893.9572	M	V	2	19
PSM	QRGGAEGELQALR	956	sp|Q15149-7|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	2-UNIMOD:267,13-UNIMOD:267	ms_run[2]:scan=4390	28.028	2	1403.7384	1403.7384	R	A	1435	1448
PSM	RGDIIGVQGNPGK	957	sp|Q15046|SYK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=2711	18.201	2	1309.7102	1309.7102	R	T	178	191
PSM	RIALTDNALIAR	958	sp|P18124|RL7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6486	40.294	2	1325.7779	1325.7779	K	S	166	178
PSM	RIQLVEEELDR	959	sp|P06753-3|TPM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:267,11-UNIMOD:267	ms_run[2]:scan=6308	39.241	2	1418.7632	1418.7632	R	A	55	66
PSM	RLVSDGNINSDR	960	sp|Q01082-3|SPTB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:267,12-UNIMOD:267	ms_run[2]:scan=2025	14.334	2	1364.6911	1364.6911	R	I	1221	1233
PSM	RMGESDDSILR	961	sp|P63220|RS21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=3663	23.817	2	1277.6034	1277.6034	R	L	61	72
PSM	RPTELLSNPQFIVDGATR	962	sp|P07384|CAN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8738	54.024	3	2013.0643	2013.0643	K	T	87	105
PSM	RQDLIDEWIAK	963	sp|O95251-3|KAT7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9114	56.41	2	1385.7303	1385.7303	K	E	408	419
PSM	RSGNNNGSEPSDIIIPLR	964	sp|P52799|EFNB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7241	44.78	2	1937.9919	1937.9919	K	T	277	295
PSM	RYDLEQGLGDLLTER	965	sp|Q5VTR2|BRE1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11107	69.291	3	1776.9006	1776.9006	K	K	110	125
PSM	SCFGHPLAPQALEDVK	966	sp|Q8IXI1-2|MIRO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	2-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=7068	43.743	2	1773.8815	1773.8815	K	T	88	104
PSM	SEAEEAITSFNGHKPPGSSEPITVK	967	sp|Q15717|ELAV1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	14-UNIMOD:188,25-UNIMOD:188	ms_run[2]:scan=6731	41.765	3	2623.3168	2623.3168	R	F	158	183
PSM	SGPLFNFDVHDDVR	968	sp|Q14320|FA50A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	14-UNIMOD:267	ms_run[2]:scan=9008	55.753	2	1626.7666	1626.7666	K	L	276	290
PSM	SKGVFVQSVLPYFVATK	969	sp|Q53GQ0|DHB12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11119	69.368	2	1869.04	1869.0400	R	L	222	239
PSM	SLGTADVHFER	970	sp|Q86V81|THOC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:267	ms_run[2]:scan=4862	30.751	2	1240.6076	1240.6076	R	K	145	156
PSM	SLVQEMVGSFGKR	971	sp|O75643|U520_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9869	61.194	2	1436.7446	1436.7446	R	L	546	559
PSM	SMQNWHQLENLSNFIK	972	sp|Q99439-2|CNN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	16-UNIMOD:188	ms_run[2]:scan=11084	69.136	2	1993.9776	1993.9776	R	A	78	94
PSM	SPWSNKYDPPLEDGAMPSAR	973	sp|P47756-2|CAPZB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7379	45.615	3	2217.0161	2217.0161	R	L	73	93
PSM	SYLHIPQDVGVNLR	974	sp|O60508|PRP17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8507	52.591	2	1609.8576	1609.8576	R	S	253	267
PSM	TLNNKFASFIDK	975	sp|P13647|K2C5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7212	44.604	2	1396.7351	1396.7351	K	V	174	186
PSM	TQTVCNFTDGALVQHQEWDGKESTITR	976	sp|A8MUU1|FB5L3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	5-UNIMOD:4	ms_run[2]:scan=7640	47.184	2	3120.4571	3120.4571	R	K	49	76
PSM	TVSGVNGPLVILDHVK	977	sp|P21281|VATB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	16-UNIMOD:188	ms_run[2]:scan=9801	60.753	2	1652.9557	1652.9557	K	F	49	65
PSM	VLIAAHGNSLR	978	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:267	ms_run[2]:scan=3377	22.157	2	1159.6701	1159.6701	R	G	181	192
PSM	VPSKNQNDPLPGR	979	sp|O75534-2|CSDE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=1896	13.611	2	1420.7423	1420.7423	K	I	243	256
PSM	WLDLKDNPLDPVLAK	980	sp|Q96AG4|LRC59_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11138	69.493	2	1735.9509	1735.9509	K	V	112	127
PSM	YYRESADPLGAWLQDAR	981	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	3-UNIMOD:267,17-UNIMOD:267	ms_run[2]:scan=10643	66.186	2	2029.9761	2029.9761	R	R	1179	1196
PSM	FSMPSLKGEGPEVDVNLPK	982	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	3-UNIMOD:35,7-UNIMOD:188,19-UNIMOD:188	ms_run[1]:scan=9856	61.112406666666665	2	2072.0652	2071.0692	K	A	1134	1153
PSM	IVAERPGTNSTGPAPMAPPR	983	sp|Q13263|TIF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	5-UNIMOD:267,20-UNIMOD:267	ms_run[1]:scan=4576	29.109798333333334	3	2039.036233	2038.053282	K	A	408	428
PSM	LIQSHPESAEDLQEKCTELNQAWSSLGK	984	sp|Q13813|SPTN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	16-UNIMOD:4	ms_run[1]:scan=9262	57.340855000000005	3	3198.534213	3197.529907	R	R	1299	1327
PSM	EHALLAYTLGVK	985	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:27	ms_run[1]:scan=9890	61.32587666666667	2	1295.7251	1295.7232	R	Q	135	147
PSM	ALRLDVGNFSWGSECCTR	986	sp|P62241|RS8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:267,15-UNIMOD:4,16-UNIMOD:4,18-UNIMOD:267	ms_run[1]:scan=9779	60.61732333333333	3	2146.979996	2146.979131	R	K	57	75
PSM	QISRDYGVLLEGSGLALR	987	sp|P30048|PRDX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:28	ms_run[1]:scan=11902	74.68680833333333	2	1929.0296	1929.0315	K	G	167	185
PSM	QQGVLALRPYLQK	988	sp|P56192|SYMC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:28	ms_run[1]:scan=9467	58.641325	2	1495.8549	1495.8506	K	Q	192	205
PSM	HLEIIYEINQK	989	sp|P06737|PYGL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	11-UNIMOD:188	ms_run[1]:scan=7030	43.518816666666666	2	1404.773125	1404.770845	R	H	400	411
PSM	CPNLTHLNLSGNK	990	sp|P39687|AN32A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=7845	48.42552666666666	2	1449.7040	1449.7029	K	I	87	100
PSM	QLPSAGPDKNLVTGDHIPTPQDLPQR	991	sp|O43768|ENSA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:28	ms_run[1]:scan=8820	54.56264	3	2776.4163	2776.4139	K	K	81	107
PSM	GTADVTHDLQEMKEESR	992	sp|P11166|GTR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	12-UNIMOD:35	ms_run[1]:scan=3206	21.15365	2	1960.884833	1960.879634	R	Q	233	250
PSM	FSGFGSGAGGKPLEGLSNGNNITSAPPFASAK	993	sp|Q9UKX7|NUP50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=9726	60.27516	3	3037.483864	3036.494114	R	A	73	105
PSM	QFVPIKVEQIEAGTPGR	994	sp|Q16881|TRXR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:28	ms_run[1]:scan=10100	62.651828333333334	2	1850.9897	1850.9885	R	L	400	417
PSM	IKQLIELDYLNPGSIR	995	sp|Q9UHI6|DDX20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=10481	65.13431333333332	3	1871.048706	1871.051649	R	L	191	207
PSM	AKFEELNMDLFR	996	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10059	62.396	2	1511.7442	1511.7442	R	S	325	337
PSM	APSRQDVYGPQPQVR	997	sp|O60716|CTND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	4-UNIMOD:267,15-UNIMOD:267	ms_run[2]:scan=3086	20.463	2	1716.8811	1716.8811	R	V	250	265
PSM	ARPAEVGGMQLR	998	sp|P33316-2|DUT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:267,12-UNIMOD:267	ms_run[2]:scan=3819	24.702	2	1303.6934	1303.6934	R	F	16	28
PSM	ASAPSPNAQVACDHCLKEAAVK	999	sp|Q14258|TRI25_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:4,15-UNIMOD:4,17-UNIMOD:188,22-UNIMOD:188	ms_run[2]:scan=4029	25.935	2	2335.1452	2335.1452	R	T	96	118
PSM	ASILWLIGENCERVPK	1000	sp|O00203-3|AP3B1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:4	ms_run[2]:scan=10985	68.481	2	1883.9928	1883.9928	R	I	448	464
PSM	AVFQANQENLPILKR	1001	sp|P05023-3|AT1A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7565	46.713	2	1739.9683	1739.9683	R	A	400	415
PSM	AVTEQGHELSNEERNLLSVAYK	1002	sp|P31946-2|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	14-UNIMOD:267,22-UNIMOD:188	ms_run[2]:scan=8432	52.125	3	2502.2685	2498.2804	K	N	28	50
PSM	AYHSFLVEPISCHAWNK	1003	sp|O15143|ARC1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:1,12-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=9928	61.566	3	2106.0089	2106.0089	M	D	2	19
PSM	CGAALAGHQLIR	1004	sp|P78527-2|PRKDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:4	ms_run[2]:scan=4394	28.054	2	1265.6663	1265.6663	R	G	25	37
PSM	CSQEDHCLTSDLEDDRK	1005	sp|Q9NZU5|LMCD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=3770	24.415	3	2106.8582	2106.8582	K	I	52	69
PSM	CVSSPHFQVAER	1006	sp|Q16537-2|2A5E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=4156	26.705	2	1425.6699	1425.6699	K	A	351	363
PSM	DESLKVDEHLAK	1007	sp|P12429|ANXA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	5-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=3521	22.995	2	1394.7444	1394.7444	R	Q	165	177
PSM	DFPVESVKLTEVPVEPVLTVHPESK	1008	sp|Q9H307|PININ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10687	66.462	3	2774.4742	2774.4742	K	S	529	554
PSM	DKFPEVIINFPDPAQK	1009	sp|Q00341-2|VIGLN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10569	65.708	2	1856.9672	1856.9672	R	S	502	518
PSM	DMAAFNERPIIFALSNPTSK	1010	sp|P48163-2|MAOX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11476	71.733	2	2221.1201	2221.1201	K	A	318	338
PSM	EAEKLESEHPDQAQAILSR	1011	sp|Q01082-3|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	4-UNIMOD:188,19-UNIMOD:267	ms_run[2]:scan=4909	31.002	2	2166.0888	2162.1006	K	L	1005	1024
PSM	EGRLELQQLQAER	1012	sp|P48681|NEST_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5574	34.861	2	1568.8271	1568.8271	R	G	220	233
PSM	EGRLELQQLQAER	1013	sp|P48681|NEST_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:267,13-UNIMOD:267	ms_run[2]:scan=5578	34.882	2	1588.8436	1588.8436	R	G	220	233
PSM	EHALLAYTLGVK	1014	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:188	ms_run[2]:scan=7541	46.576	2	1319.7545	1319.7545	R	Q	135	147
PSM	ESNTVFSFLGLKPR	1015	sp|Q9UJC5|SH3L2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11240	70.172	2	1593.8515	1593.8515	K	L	87	101
PSM	FCNTVHDIVNR	1016	sp|Q9UKF6|CPSF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:4,11-UNIMOD:267	ms_run[2]:scan=4503	28.673	2	1383.6593	1383.6593	R	G	222	233
PSM	FCNTVHDIVNR	1017	sp|Q9UKF6|CPSF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:4	ms_run[2]:scan=4506	28.689	2	1373.651	1373.6510	R	G	222	233
PSM	FEHCNFNDVTTR	1018	sp|P13987|CD59_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	4-UNIMOD:4	ms_run[2]:scan=4233	27.149	2	1538.6572	1538.6572	K	L	67	79
PSM	FEHGGQDSVYWK	1019	sp|Q9UK22|FBX2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:188	ms_run[2]:scan=4740	30.038	2	1457.6671	1457.6671	R	G	269	281
PSM	FGRDEDPVCLQLDDILSK	1020	sp|Q9NX01|TXN4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	9-UNIMOD:4	ms_run[2]:scan=11073	69.064	3	2119.0256	2119.0256	R	T	30	48
PSM	FGVAPDHPEVK	1021	sp|P22570-4|ADRO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=3600	23.45	2	1194.6033	1194.6033	R	N	28	39
PSM	FICEQDHQNFLR	1022	sp|Q92598-2|HS105_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=5738	35.819	2	1615.7441	1615.7441	K	L	612	624
PSM	FKDPGLVDQLVK	1023	sp|P49591|SYSC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7545	46.593	2	1357.7606	1357.7606	R	A	27	39
PSM	FLDKALELNMLSLK	1024	sp|Q9Y617|SERC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11180	69.771	2	1633.9113	1633.9113	R	G	320	334
PSM	FLQDYFDGNLKR	1025	sp|P30101|PDIA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7983	49.236	2	1514.7518	1514.7518	R	Y	352	364
PSM	FLVPDHVNMSELIK	1026	sp|Q9GZQ8|MLP3B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10263	63.723	2	1640.8596	1640.8596	K	I	52	66
PSM	FSQMLQDKPLR	1027	sp|Q9H6F5|CCD86_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5040	31.763	2	1361.7126	1361.7126	R	T	254	265
PSM	FSSETWQNLGTLHR	1028	sp|Q96IU4|ABHEB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7616	47.035	3	1674.8114	1674.8114	R	L	43	57
PSM	FTRNEFNLESK	1029	sp|P62491-2|RB11A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=4996	31.508	2	1383.6783	1383.6783	R	S	31	42
PSM	FVDKLFEAVEEGR	1030	sp|O43395|PRPF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9507	58.892	3	1537.7777	1537.7777	R	S	62	75
PSM	GDLSRPEDADTSGPCCEHTQEK	1031	sp|Q9BZE9-4|ASPC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	15-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=2235	15.447	3	2488.0231	2488.0231	R	Q	133	155
PSM	GFFDPNTHENLTYLQLLER	1032	sp|Q15149-7|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	19-UNIMOD:267	ms_run[2]:scan=12025	75.525	3	2316.1414	2316.1414	K	C	2820	2839
PSM	GFFDPNTHENLTYR	1033	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7202	44.546	2	1709.7798	1709.7798	K	Q	3479	3493
PSM	GFFDPNTHENLTYVQLLR	1034	sp|P58107|EPIPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	18-UNIMOD:267	ms_run[2]:scan=11277	70.416	3	2173.0832	2173.0832	K	R	2385	2403
PSM	GFKDQIYDIFQK	1035	sp|P60842-2|IF4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9941	61.647	2	1500.7613	1500.7613	R	L	191	203
PSM	GFKDQIYDIFQK	1036	sp|P60842-2|IF4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=9946	61.679	2	1512.8015	1512.8015	R	L	191	203
PSM	GGVDTAAAPAGGAPPAHAPGPGR	1037	sp|Q14657|LAGE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	23-UNIMOD:267	ms_run[2]:scan=3183	21.015	3	1960.9743	1960.9743	R	D	25	48
PSM	GIFPVLCKDPVQEAWAEDVDLR	1038	sp|P14618-3|KPYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	7-UNIMOD:4	ms_run[2]:scan=12184	76.624	3	2556.2683	2556.2683	R	V	453	475
PSM	GLFIIDDKGILR	1039	sp|Q06830|PRDX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10241	63.583	2	1358.7922	1358.7922	R	Q	129	141
PSM	GQVQEVGWHDVAGWLGR	1040	sp|P17858|PFKAL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10595	65.879	3	1892.9282	1892.9282	K	G	445	462
PSM	GVDEVTIVNILTNR	1041	sp|P07355-2|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11960	75.095	2	1541.8413	1541.8413	K	S	68	82
PSM	GVEVTVGHEQEEGGKWPYAGTAEAIK	1042	sp|P0DPI2-2|GAL3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6920	42.87	3	2741.3297	2741.3297	R	A	158	184
PSM	HELLQPFNVLYEK	1043	sp|Q9UQ80|PA2G4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:188	ms_run[2]:scan=9955	61.734	2	1634.8764	1634.8764	K	E	299	312
PSM	HFEATDILVSK	1044	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:188	ms_run[2]:scan=6673	41.413	2	1264.6759	1264.6759	R	I	1175	1186
PSM	HFEELETIMDR	1045	sp|Q8TAQ2-2|SMRC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8089	49.905	2	1418.65	1418.6500	R	E	936	947
PSM	HFVALSTNTTK	1046	sp|P06744-2|G6PI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:188	ms_run[2]:scan=3092	20.5	2	1223.6606	1223.6606	K	V	253	264
PSM	HFVALSTNTTK	1047	sp|P06744-2|G6PI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=3098	20.537	2	1217.6404	1217.6404	K	V	253	264
PSM	HGESAWNLENR	1048	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:267	ms_run[2]:scan=4073	26.206	2	1321.6039	1321.6039	R	F	11	22
PSM	HGESAWNLENR	1049	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=4074	26.211	2	1311.5956	1311.5956	R	F	11	22
PSM	HGESEFNLLGK	1050	sp|O60825-2|F262_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:188	ms_run[2]:scan=6345	39.444	2	1235.6242	1235.6242	R	I	257	268
PSM	HGVPISVTGIAQVK	1051	sp|O75955|FLOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6591	40.93	2	1404.8089	1404.8089	R	I	59	73
PSM	HILLAVANDEELNQLLK	1052	sp|O75367-2|H2AY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11143	69.529	3	1932.068	1932.0680	R	G	80	97
PSM	HLDLSNVAGYK	1053	sp|Q9UNF0-2|PACN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:188	ms_run[2]:scan=5843	36.467	2	1221.6449	1221.6449	K	A	254	265
PSM	HLDLSNVAGYK	1054	sp|Q9UNF0-2|PACN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5847	36.488	2	1215.6248	1215.6248	K	A	254	265
PSM	HLGTAGTDVDLR	1055	sp|Q9Y613|FHOD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=3712	24.104	2	1253.6364	1253.6364	R	T	313	325
PSM	HLVDPIDDLFLAAK	1056	sp|Q7Z3D6-5|GLUCM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	14-UNIMOD:188	ms_run[2]:scan=11993	75.311	2	1571.8655	1571.8655	K	K	443	457
PSM	HQGVMVGMGQK	1057	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=2249	15.524	2	1170.5638	1170.5638	R	D	40	51
PSM	HSQFIGYPITLFVEK	1058	sp|P07900-2|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11621	72.732	2	1777.9403	1777.9403	K	E	332	347
PSM	HTYLPLEVCNIVAGQR	1059	sp|Q9HCK5|AGO4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	9-UNIMOD:4	ms_run[2]:scan=9615	59.564	3	1868.9567	1868.9567	K	C	326	342
PSM	HVIPMNPNTDDLFK	1060	sp|P13797-3|PLST_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	14-UNIMOD:188	ms_run[2]:scan=7688	47.484	2	1645.823	1645.8230	R	A	100	114
PSM	HVIPMNPNTNDLFNAVGDGIVLCK	1061	sp|P13796|PLSL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	23-UNIMOD:4	ms_run[2]:scan=11347	70.885	3	2637.3043	2637.3043	R	M	142	166
PSM	HVLDTLIQLAK	1062	sp|Q7Z6Z7-2|HUWE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:188	ms_run[2]:scan=9711	60.179	2	1255.7596	1255.7596	R	V	3319	3330
PSM	HVLDTLIQLAK	1063	sp|Q7Z6Z7-2|HUWE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9715	60.207	2	1249.7394	1249.7394	R	V	3319	3330
PSM	ICDQWDALGSLTHSR	1064	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=8851	54.768	3	1767.8238	1767.8238	K	R	498	513
PSM	IFCCHGGLSPDLQSMEQIR	1065	sp|P62136|PP1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:4,4-UNIMOD:4,19-UNIMOD:267	ms_run[2]:scan=8854	54.79	3	2257.0317	2257.0317	K	R	169	188
PSM	IGEHTPSALAIMENANVLAR	1066	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:35	ms_run[2]:scan=7579	46.804	2	2122.0841	2122.0841	K	Y	154	174
PSM	IGQGYLIKDGK	1067	sp|P39023|RL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	8-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=3831	24.767	2	1202.7062	1202.7062	K	L	287	298
PSM	IHVLEAQDLIAK	1068	sp|Q9BSJ8|ESYT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7318	45.24	2	1348.7715	1348.7715	R	D	651	663
PSM	IHVSDQELQSANASVDDSRLEELK	1069	sp|P22314-2|UBA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7235	44.744	3	2682.3097	2682.3097	K	A	767	791
PSM	IKLQLWDTAGQER	1070	sp|Q14964|RB39A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7507	46.376	3	1556.8311	1556.8311	R	F	62	75
PSM	IRLEETLEQLAK	1071	sp|P22059|OSBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9205	56.976	2	1441.814	1441.8140	R	Q	302	314
PSM	KATGPPVSELITK	1072	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5203	32.696	2	1339.7711	1339.7711	R	A	37	50
PSM	KFAEAFEAIPR	1073	sp|P50990|TCPQ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6944	43.011	2	1277.6768	1277.6768	K	A	440	451
PSM	KFNALFAQGNYSEAAK	1074	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=6615	41.069	3	1769.9139	1769.9139	R	V	367	383
PSM	KIIENELEGFGIR	1075	sp|Q9Y295|DRG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8582	53.058	2	1516.8249	1516.8249	K	L	159	172
PSM	KIWALEEENAK	1076	sp|O60437|PEPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=5342	33.484	2	1341.7331	1341.7331	R	V	1157	1168
PSM	KLFADAEEEQR	1077	sp|P46459-2|NSF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=3317	21.81	2	1334.6466	1334.6466	R	R	210	221
PSM	KNLDSTTVAIHDEEIYCK	1078	sp|Q16527|CSRP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	17-UNIMOD:4	ms_run[2]:scan=5497	34.392	3	2135.0205	2135.0205	R	S	42	60
PSM	KQGGLGPMNIPLVSDPK	1079	sp|Q06830|PRDX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=8479	52.41	2	1761.985	1761.9850	K	R	93	110
PSM	LAQAHPAGPPTLDPVNDLQLK	1080	sp|Q15477|SKIV2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	21-UNIMOD:188	ms_run[2]:scan=8513	52.631	3	2200.1947	2200.1947	R	D	971	992
PSM	LGDVGMAELCPGLLHPSSR	1081	sp|P13489|RINI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	10-UNIMOD:4	ms_run[2]:scan=9297	57.567	3	2007.987	2007.9870	K	L	239	258
PSM	LGGSPTSLGTWGSWIGPDHDK	1082	sp|P14314-2|GLU2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10243	63.594	3	2167.0334	2167.0334	K	F	436	457
PSM	LHNQQALSSSIEEGLR	1083	sp|Q06587|RING1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	16-UNIMOD:267	ms_run[2]:scan=6270	39.009	2	1790.915	1790.9150	R	M	131	147
PSM	LHVGNISPTCTNQELR	1084	sp|Q9BQ04|RBM4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	10-UNIMOD:4	ms_run[2]:scan=5421	33.935	2	1837.9105	1837.9105	K	A	80	96
PSM	LLAPPEAPGSAPPPAAWVIPGPTTGPK	1085	sp|Q9P1Y5|CAMP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10866	67.69	2	2588.4003	2588.4003	R	A	727	754
PSM	LLELGPKPEVAQQTR	1086	sp|P53621|COPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5788	36.128	3	1677.9414	1677.9414	R	K	1128	1143
PSM	LNELADQDFPLHPR	1087	sp|Q9C040|TRIM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	14-UNIMOD:267	ms_run[2]:scan=7449	46.038	3	1673.8401	1673.8401	K	E	281	295
PSM	LRECELSPGVNR	1088	sp|Q9BXP5-5|SRRT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	4-UNIMOD:4	ms_run[2]:scan=3254	21.442	2	1428.7143	1428.7143	R	D	450	462
PSM	LSCLPAFKDLIAK	1089	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:4,8-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=9791	60.692	2	1486.862	1486.8620	R	V	3938	3951
PSM	LSCLPAFKDLIAK	1090	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:4	ms_run[2]:scan=9781	60.63	2	1474.8218	1474.8218	R	V	3938	3951
PSM	LSFQHDPETSVLVLR	1091	sp|Q14697|GANAB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8619	53.285	2	1739.9206	1739.9206	R	K	915	930
PSM	LYFLQCETCHSR	1092	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	6-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=6468	40.186	2	1612.7126	1612.7126	R	C	297	309
PSM	MAPTPIPTRSPSDSSTASTPVAEQIER	1093	sp|Q16643|DREB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:35	ms_run[2]:scan=6023	37.535	3	2841.3815	2841.3815	R	A	328	355
PSM	MEHQLELGNLQAK	1094	sp|Q9UDT6-2|CLIP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:35	ms_run[2]:scan=5218	32.781	2	1525.7559	1525.7559	K	H	623	636
PSM	MFDYTDDPEGPVMPGSHSVER	1095	sp|Q09161|NCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:35	ms_run[2]:scan=6809	42.228	2	2380.994	2380.9940	R	F	291	312
PSM	MFNGEKINYTEGR	1096	sp|P06744-2|G6PI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:35	ms_run[2]:scan=4035	25.974	2	1573.7195	1573.7195	R	A	123	136
PSM	MGLVDQLVEPLGPGLKPPEER	1097	sp|P40939|ECHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11085	69.142	2	2273.209	2273.2090	K	T	215	236
PSM	MYSTDDGVQFHAFGR	1098	sp|Q15029-2|U5S1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:35,15-UNIMOD:267	ms_run[2]:scan=6792	42.125	2	1755.755	1755.7550	K	V	446	461
PSM	NAAHALPTTLGALER	1099	sp|Q8NBJ5|GT251_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6909	42.803	2	1533.8263	1533.8263	R	L	62	77
PSM	NCPHIVVGTPGR	1100	sp|Q13838|DX39B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=3361	22.066	2	1315.6695	1315.6695	K	I	164	176
PSM	NFINNPLAQADWAAKK	1101	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9003	55.72	2	1799.9319	1799.9319	K	L	15	31
PSM	NGGLGHMNIALLSDLTK	1102	sp|P30048-2|PRDX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11111	69.315	3	1752.9193	1752.9193	K	Q	132	149
PSM	NPPGFAFVEFEDPRDAEDAVR	1103	sp|Q16629-3|SRSF7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	14-UNIMOD:267,21-UNIMOD:267	ms_run[2]:scan=10794	67.213	2	2397.114	2397.1140	R	G	45	66
PSM	NREPVQLETLSIR	1104	sp|P62314|SMD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:267,13-UNIMOD:267	ms_run[2]:scan=6949	43.042	2	1573.8691	1573.8691	K	G	49	62
PSM	NVALLSQLYHSPAR	1105	sp|Q15717|ELAV1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8321	51.425	2	1567.8471	1567.8471	K	R	192	206
PSM	NVNIQNFHISWK	1106	sp|P12814-2|ACTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:188	ms_run[2]:scan=9303	57.607	2	1504.7882	1504.7882	K	D	163	175
PSM	NVNIQNFHISWK	1107	sp|P12814-2|ACTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9310	57.652	2	1498.7681	1498.7681	K	D	163	175
PSM	PGHLQEGFGCVVTNR	1108	sp|Q8NC51-4|PAIRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	10-UNIMOD:4	ms_run[2]:scan=5395	33.782	3	1669.7995	1669.7995	M	F	2	17
PSM	RDNELIGQTVR	1109	sp|O00267-2|SPT5H_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=3440	22.528	2	1299.6895	1299.6895	R	I	697	708
PSM	RFDVSGYPTLK	1110	sp|P13667|PDIA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6323	39.322	2	1281.6717	1281.6717	K	I	246	257
PSM	RGPFELEAFYSDPQGVPYPEAK	1111	sp|Q92598-2|HS105_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:267,22-UNIMOD:188	ms_run[2]:scan=10539	65.511	2	2512.2245	2508.2364	R	I	437	459
PSM	RIQLVEEELDR	1112	sp|P06753-3|TPM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6309	39.245	2	1398.7467	1398.7467	R	A	55	66
PSM	RIQQLTEEIGR	1113	sp|P12270|TPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=4854	30.706	2	1341.7365	1341.7365	K	L	1367	1378
PSM	RLAPEYEAAATR	1114	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=3099	20.541	2	1346.6943	1346.6943	K	L	62	74
PSM	RLDQELDFILSQQK	1115	sp|P37198|NUP62_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10597	65.891	2	1731.9155	1731.9155	K	E	388	402
PSM	RNFILDQCNVYNSGQR	1116	sp|Q1KMD3|HNRL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	8-UNIMOD:4	ms_run[2]:scan=6521	40.514	3	1982.9381	1982.9381	K	R	531	547
PSM	RNFILDQTNVSAAAQR	1117	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=6380	39.656	3	1822.9553	1822.9553	K	R	556	572
PSM	RNTLEWCLPVIDAK	1118	sp|P48444-2|COPD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	7-UNIMOD:4	ms_run[2]:scan=10215	63.417	2	1713.8872	1713.8872	R	N	347	361
PSM	RQELDAFLAQALSPK	1119	sp|Q9NZB2-4|F120A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10947	68.232	2	1685.9101	1685.9101	R	L	733	748
PSM	RVLQQFADNDVSR	1120	sp|P51659-3|DHB4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:267,13-UNIMOD:267	ms_run[2]:scan=4393	28.049	2	1566.8017	1566.8017	R	F	525	538
PSM	SAQPLPLKIEELALAK	1121	sp|Q9UKV3-5|ACINU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10693	66.503	2	1720.0135	1720.0135	R	G	525	541
PSM	SEAEEAITSFNGHKPPGSSEPITVK	1122	sp|Q15717|ELAV1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6688	41.5	3	2611.2766	2611.2766	R	F	158	183
PSM	SIGTANRPMGAGEALR	1123	sp|Q12906-5|ILF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	9-UNIMOD:35	ms_run[2]:scan=2916	19.454	2	1615.81	1615.8100	K	R	258	274
PSM	SILSPGGSCGPIKVK	1124	sp|P78347-2|GTF2I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	9-UNIMOD:4,13-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=5851	36.513	2	1510.858	1510.8580	R	T	207	222
PSM	SKESVPEFPLSPPK	1125	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6954	43.069	2	1540.8137	1540.8137	R	K	28	42
PSM	SNPFAHLAEPLDPVQPGKK	1126	sp|P21399|ACOC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:1	ms_run[2]:scan=9940	61.641	3	2086.0847	2086.0847	M	F	2	21
PSM	SPQVKPASTMGMGPLGK	1127	sp|Q13428-8|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	5-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=5425	33.958	3	1696.9043	1696.9043	K	G	426	443
PSM	SPWSNKYDPPLEDGAMPSAR	1128	sp|P47756-2|CAPZB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	16-UNIMOD:35	ms_run[2]:scan=6491	40.326	3	2233.011	2233.0110	R	L	73	93
PSM	SRLNATASLEQER	1129	sp|O76024|WFS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=3404	22.312	2	1473.7536	1473.7536	R	S	25	38
PSM	SYLHIPQDVGVNLR	1130	sp|O60508|PRP17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	14-UNIMOD:267	ms_run[2]:scan=8516	52.648	2	1619.8659	1619.8659	R	S	253	267
PSM	TGADTTAAGPLFQQRPYPSPGAVLR	1131	sp|O60828-5|PQBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	15-UNIMOD:267,25-UNIMOD:267	ms_run[2]:scan=8936	55.3	3	2590.3407	2590.3407	K	A	129	154
PSM	TGSAVAPVHPPNR	1132	sp|Q8IZL8|PELP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:267	ms_run[2]:scan=2120	14.847	2	1311.6923	1311.6923	R	S	49	62
PSM	TLNNKFASFIDK	1133	sp|P13647|K2C5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	5-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=7211	44.599	2	1408.7753	1408.7753	K	V	174	186
PSM	TLVAHYPPVQVLFEK	1134	sp|P52701-4|MSH6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	15-UNIMOD:188	ms_run[2]:scan=10073	62.483	3	1745.9812	1745.9812	R	G	282	297
PSM	TLVAHYPPVQVLFEK	1135	sp|P52701-4|MSH6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	15-UNIMOD:188	ms_run[2]:scan=10078	62.513	2	1745.9812	1745.9812	R	G	282	297
PSM	TPLHEIALSIK	1136	sp|Q08211|DHX9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:188	ms_run[2]:scan=7055	43.669	2	1226.733	1226.7330	R	L	796	807
PSM	TTEDEVHICHNQDGYSYPSR	1137	sp|P01130-2|LDLR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	9-UNIMOD:4	ms_run[2]:scan=4457	28.407	3	2407.0135	2407.0135	K	Q	653	673
PSM	VADRLGLELGK	1138	sp|P11908|PRPS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5675	35.443	2	1169.6768	1169.6768	R	V	19	30
PSM	VIGELVGHTER	1139	sp|Q8TEQ6|GEMI5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=3833	24.778	2	1208.6513	1208.6513	R	V	56	67
PSM	VLIAAHGNSLR	1140	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=3373	22.132	2	1149.6618	1149.6618	R	G	181	192
PSM	VLLGQDEPLIHVFAK	1141	sp|Q9BT73|PSMG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10622	66.053	2	1677.9454	1677.9454	K	N	66	81
PSM	VQADVPPEILNNVGALHFR	1142	sp|Q6PD62|CTR9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10766	67.028	2	2088.1116	2088.1116	K	L	445	464
PSM	VVSDRWLSCETQLPVSFR	1143	sp|O75643|U520_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	9-UNIMOD:4	ms_run[2]:scan=10169	63.119	3	2178.0892	2178.0892	R	H	1270	1288
PSM	ISNRPAFMPSEGK	1144	sp|P35609|ACTN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	4-UNIMOD:267,13-UNIMOD:188	ms_run[1]:scan=4439	28.302225	2	1448.739928	1448.741682	R	M	354	367
PSM	VGLQVVAVKAPGFGDNR	1145	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	9-UNIMOD:188,17-UNIMOD:267	ms_run[1]:scan=7829	48.331725	2	1741.984322	1741.981001	K	K	293	310
PSM	QSVENDIHGLRK	1146	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:28,11-UNIMOD:267,12-UNIMOD:188	ms_run[1]:scan=4717	29.904508333333332	2	1393.7278	1393.7280	R	V	176	188
PSM	MKQDAQVVLYR	1147	sp|P78527|PRKDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	1-UNIMOD:35,2-UNIMOD:188,11-UNIMOD:267	ms_run[1]:scan=3638	23.672116666666664	2	1382.749827	1381.735869	K	S	2763	2774
PSM	HQGVMVGMGQK	1148	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	11-UNIMOD:188	ms_run[1]:scan=2248	15.520105	2	1176.584854	1176.583912	R	D	42	53
PSM	RGPCIIYNEDNGIIK	1149	sp|P36578|RL4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	4-UNIMOD:4	ms_run[1]:scan=6858	42.51797333333333	2	1761.8692	1760.8872	R	A	205	220
PSM	QATINIGTIGHVAHGK	1150	sp|P41091|IF2G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:28	ms_run[1]:scan=6985	43.255471666666665	2	1598.8516	1598.8524	R	S	39	55
PSM	QKIHPTSVISGYR	1151	sp|P17987|TCPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:28,2-UNIMOD:188,13-UNIMOD:267	ms_run[1]:scan=5286	33.181875	2	1483.8092	1483.8113	K	L	110	123
PSM	QGGLGPMNIPLVSDPKR	1152	sp|Q06830|PRDX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:28	ms_run[1]:scan=10244	63.59985166666667	2	1760.9255	1760.9238	K	T	94	111
PSM	IKLQIWDTAGQER	1153	sp|P61026|RAB10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	2-UNIMOD:188,13-UNIMOD:267	ms_run[1]:scan=7497	46.321886666666664	2	1572.858085	1572.859489	K	F	58	71
PSM	DVACGANHTLVLDSQKR	1154	sp|Q9P258|RCC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	4-UNIMOD:4	ms_run[1]:scan=4155	26.699095	2	1883.916189	1882.931945	R	V	334	351
PSM	QLAALKQQLVASHLEK	1155	sp|Q13561|DCTN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:28,6-UNIMOD:188,16-UNIMOD:188	ms_run[1]:scan=9483	58.742578333333334	3	1771.0477	1771.0390	K	L	141	157
PSM	VIMDYESLEKANHEEVLAAGK	1156	sp|P00491|PNPH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=7604	46.958436666666664	3	2345.161399	2345.157312	K	Q	245	266
PSM	KVPQVSTPTLVEVSR	1157	sp|P02768|ALBU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=6434	39.979255	2	1638.929618	1638.930471	K	N	438	453
PSM	SGVEKDLDEVLQTHSVFVNVSK	1158	sp|Q9Y3A5|SBDS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=10522	65.39886833333334	3	2429.267938	2429.243819	R	G	41	63
PSM	QIENIVDKTFFHQENVR	1159	sp|Q9H089|LSG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:28,8-UNIMOD:188,17-UNIMOD:267	ms_run[1]:scan=11577	72.42538333333334	2	2115.0673	2115.0715	K	A	587	604
PSM	QVEEALHQLHAR	1160	sp|O00233|PSMD9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:28,12-UNIMOD:267	ms_run[1]:scan=7222	44.66123833333334	2	1422.7235	1422.7238	K	D	92	104
PSM	CFAFVHDLCDEEK	1161	sp|Q96IZ6|MET2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:385,1-UNIMOD:4,9-UNIMOD:4,13-UNIMOD:188	ms_run[1]:scan=11701	73.291375	2	1657.6812	1657.6843	R	S	233	246
PSM	QFVPIKVEQIEAGTPGR	1162	sp|Q16881|TRXR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:28,6-UNIMOD:188,17-UNIMOD:267	ms_run[1]:scan=10096	62.62273166666667	2	1867.0197	1867.0169	R	L	400	417
PSM	HSPIAPSSPSPQVLAQK	1163	sp|Q9NQS7|INCE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=4819	30.500713333333337	2	1742.921509	1742.931534	R	Y	305	322
PSM	CLANLRPLLDSGTMGTK	1164	sp|A0AVT1|UBA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:385,1-UNIMOD:4,6-UNIMOD:267,17-UNIMOD:188	ms_run[1]:scan=12066	75.80197833333334	2	1844.9423	1844.9454	R	G	581	598
PSM	AAPEASSPPASPLQHLLPGK	1165	sp|Q96TA1-2|NIBA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	20-UNIMOD:188	ms_run[2]:scan=8033	49.536	2	1973.0678	1973.0678	K	A	673	693
PSM	AFTELFQVACAKPPPLGLCDYPSSR	1166	sp|Q14166|TTL12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:4,19-UNIMOD:4	ms_run[2]:scan=11618	72.714	3	2823.3724	2823.3724	R	A	554	579
PSM	AFTGREFDELNPSAQR	1167	sp|P16615-5|AT2A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	5-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=6795	42.146	2	1856.892	1856.8920	K	D	651	667
PSM	AHSSMVGVNLPQK	1168	sp|P00558-2|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4449	28.359	2	1366.7027	1366.7027	R	A	144	157
PSM	AKGILFVGSGVSGGEEGAR	1169	sp|P52209-2|6PGD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:188,19-UNIMOD:267	ms_run[2]:scan=6623	41.117	2	1805.9607	1801.9725	K	Y	105	124
PSM	ALQALEELRLQAEEAER	1170	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9851	61.077	2	1968.0276	1968.0276	R	R	1502	1519
PSM	ANEHQGIGFLNDPR	1171	sp|Q92900-2|RENT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	14-UNIMOD:267	ms_run[2]:scan=5873	36.635	2	1576.7622	1576.7622	R	R	844	858
PSM	AQVARPGGDTIFGK	1172	sp|P49773|HINT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4825	30.539	2	1415.7521	1415.7521	K	I	8	22
PSM	ARDINAVLIDMER	1173	sp|P55265-5|DSRAD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8230	50.852	2	1514.7875	1514.7875	K	Q	32	45
PSM	ARPAEVGGMQLR	1174	sp|P33316-2|DUT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3827	24.749	2	1283.6768	1283.6768	R	F	16	28
PSM	ASAALLDKLYALGLVPTR	1175	sp|Q9NV31|IMP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=12162	76.451	2	1871.088	1871.0880	R	G	75	93
PSM	ASITPGTILIILTGR	1176	sp|Q02878|RL6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	15-UNIMOD:267	ms_run[2]:scan=13564	91.521	2	1534.9322	1534.9322	R	H	142	157
PSM	ASSEGGTAAGAGLDSLHKNSVSQISVLSGGK	1177	sp|O15143|ARC1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7348	45.423	2	2884.4526	2884.4526	K	A	309	340
PSM	ATSSGRLPLPSPALEYTLGSR	1178	sp|Q8IU81|I2BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9521	58.976	3	2172.1539	2172.1539	R	L	115	136
PSM	CGFCHVGEEENEAR	1179	sp|Q8IWS0-4|PHF6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:4,4-UNIMOD:4	ms_run[2]:scan=2991	19.91	2	1692.6621	1692.6621	K	G	211	225
PSM	CHAIIDEQPLIFK	1180	sp|P0CW19-2|LIMS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=8266	51.078	2	1588.8379	1588.8379	K	N	200	213
PSM	CSVPFTPIEFHYENTR	1181	sp|Q9UBU9-2|NXF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:4	ms_run[2]:scan=9227	57.112	2	1995.9149	1995.9149	K	A	143	159
PSM	DESLKVDEHLAK	1182	sp|P12429|ANXA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3518	22.974	2	1382.7042	1382.7042	R	Q	165	177
PSM	DFHYIVFGAPGTYNWK	1183	sp|P23229-7|ITA6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=11300	70.566	2	1913.9101	1913.9101	K	G	85	101
PSM	DGLTDVYNKIHMGSCAENTAK	1184	sp|P24752|THIL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	15-UNIMOD:4	ms_run[2]:scan=7833	48.354	3	2323.0573	2323.0573	K	K	182	203
PSM	DLEKPFLLPVEAVYSVPGR	1185	sp|P49411|EFTU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=12123	76.191	2	2128.1568	2128.1568	R	G	253	272
PSM	DLSHIGDAVVISCAKDGVK	1186	sp|P12004|PCNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:4	ms_run[2]:scan=7426	45.904	3	1983.0095	1983.0095	R	F	150	169
PSM	EHAPSIIFMDEIDSIGSSR	1187	sp|P62195-2|PRS8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	9-UNIMOD:35,19-UNIMOD:267	ms_run[2]:scan=9987	61.935	3	2128.9975	2128.9975	R	L	232	251
PSM	EPFFHGQDNYDQLVR	1188	sp|P19784|CSK22_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7769	47.961	2	1863.854	1863.8540	R	I	231	246
PSM	FADEHVPGSPFTVK	1189	sp|O75369-7|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	14-UNIMOD:188	ms_run[2]:scan=6669	41.393	2	1535.7716	1535.7716	K	I	1895	1909
PSM	FICEQDHQNFLR	1190	sp|Q92598-2|HS105_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	3-UNIMOD:4	ms_run[2]:scan=5750	35.892	2	1605.7358	1605.7358	K	L	612	624
PSM	FIDTSQFILNRLEQTQK	1191	sp|O60220|TIM8A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10818	67.373	2	2080.0953	2080.0953	R	S	70	87
PSM	FKLQDVADSFK	1192	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8772	54.235	2	1296.6714	1296.6714	R	K	2423	2434
PSM	FLDKALELNMLSLK	1193	sp|Q9Y617|SERC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	4-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=11175	69.735	2	1645.9516	1645.9516	R	G	320	334
PSM	FRQDLMNIAGTTLSSK	1194	sp|P78371-2|TCPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:267,16-UNIMOD:188	ms_run[2]:scan=8444	52.189	2	1796.9426	1792.9544	K	L	108	124
PSM	FVDKLFEAVEEGR	1195	sp|O43395|PRPF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	4-UNIMOD:188,13-UNIMOD:267	ms_run[2]:scan=9498	58.836	2	1553.8061	1549.8179	R	S	62	75
PSM	GAVEALAAALAHISGATSVDQR	1196	sp|Q9NR30-2|DDX21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=13052	84.789	3	2107.1022	2107.1022	K	S	538	560
PSM	GHYTEGAELVDSVLDVVR	1197	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=12396	78.235	2	1957.9745	1957.9745	K	K	104	122
PSM	GIHPTIISESFQK	1198	sp|P50991-2|TCPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:188	ms_run[2]:scan=6327	39.346	2	1461.7923	1461.7923	K	A	97	110
PSM	GKLEAIITPPPAK	1199	sp|O75367-2|H2AY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5351	33.536	2	1333.7969	1333.7969	K	K	122	135
PSM	GPGGSSLLIEALSNSSHK	1200	sp|Q9BSH4|TACO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	18-UNIMOD:188	ms_run[2]:scan=9161	56.697	3	1758.9208	1758.9208	R	C	142	160
PSM	GPVREGDVLTLLESER	1201	sp|P62857|RS28_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	4-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=10063	62.424	3	1788.9485	1788.9485	K	E	48	64
PSM	GTADVTHDLQEMKEESR	1202	sp|P11166|GTR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5895	36.765	3	1944.8847	1944.8847	R	Q	233	250
PSM	GTTGTQASFLQLFEGDDHKVEQLDK	1203	sp|P30566-2|PUR8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	19-UNIMOD:188,25-UNIMOD:188	ms_run[2]:scan=10914	68.016	2	2775.3754	2775.3754	K	M	200	225
PSM	GVTIIGPATVGGIKPGCFK	1204	sp|P53396-3|ACLY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	14-UNIMOD:188,17-UNIMOD:4,19-UNIMOD:188	ms_run[2]:scan=8757	54.144	2	1883.0741	1883.0741	K	I	346	365
PSM	HCGDFEQQLANR	1205	sp|P83436|COG7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=4295	27.496	2	1483.6502	1483.6502	R	I	481	493
PSM	HLIEMGYLQGGK	1206	sp|Q8NFW8-2|NEUA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6572	40.824	2	1344.686	1344.6860	R	M	223	235
PSM	HLVTGQNASSTVPAVQNLLFLCGSR	1207	sp|Q8NB37-3|GALD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	22-UNIMOD:4	ms_run[2]:scan=11276	70.409	3	2668.3755	2668.3755	R	K	159	184
PSM	HNQLPLVIEFTEQTAPK	1208	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10502	65.272	3	1964.0367	1964.0367	K	I	231	248
PSM	HQGVMVGMGQK	1209	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	8-UNIMOD:35	ms_run[2]:scan=1025	8.8512	2	1186.5587	1186.5587	R	D	40	51
PSM	HQGVMVGMGQK	1210	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	5-UNIMOD:35	ms_run[2]:scan=1511	11.458	2	1186.5587	1186.5587	R	D	40	51
PSM	HSGNITFDEIVNIAR	1211	sp|P30050-2|RL12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10093	62.605	3	1684.8533	1684.8533	K	Q	67	82
PSM	HSQPATPTPLQSR	1212	sp|Q9NR12-2|PDLI7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:267	ms_run[2]:scan=2155	15.028	2	1428.7349	1428.7349	R	T	212	225
PSM	HTGPNSPDTANDGFVR	1213	sp|P55795|HNRH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	16-UNIMOD:267	ms_run[2]:scan=3172	20.957	3	1693.7684	1693.7684	K	L	99	115
PSM	HTYLPLEVCNIVAGQR	1214	sp|Q9HCK5|AGO4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	9-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=9602	59.479	2	1878.965	1878.9650	K	C	326	342
PSM	HVIPMNPNTDDLFK	1215	sp|P13797-3|PLST_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7695	47.53	2	1639.8028	1639.8028	R	A	100	114
PSM	HVPGGGNVQIQNK	1216	sp|P27816-4|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=1694	12.491	2	1346.7055	1346.7055	K	K	736	749
PSM	IGKLNLVDLAGSENIGR	1217	sp|P52732|KIF11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9028	55.875	3	1767.9843	1767.9843	K	S	258	275
PSM	IKLQLWDTAGQER	1218	sp|Q14964|RB39A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7499	46.332	2	1556.8311	1556.8311	R	F	62	75
PSM	KGESGQSWPR	1219	sp|Q15185-3|TEBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=1638	12.173	2	1130.5469	1130.5469	R	L	79	89
PSM	KLTFLYLANDVIQNSK	1220	sp|Q9NQG5|RPR1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=11747	73.611	3	1866.0251	1866.0251	R	R	56	72
PSM	KQFGAQANVIGPWIQTK	1221	sp|P12814-2|ACTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=8356	51.645	3	1897.0613	1897.0613	R	M	633	650
PSM	KQPPVSPGTALVGSQK	1222	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3797	24.571	2	1592.8886	1592.8886	R	E	31	47
PSM	KVFDPVPVGVTK	1223	sp|Q08211|DHX9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=5966	37.192	2	1296.7844	1296.7844	R	V	697	709
PSM	KVPELMEMFLPATK	1224	sp|O43747|AP1G1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=12227	76.956	2	1632.8619	1632.8619	R	N	167	181
PSM	LAILGIHNEVSK	1225	sp|P12814-2|ACTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:188	ms_run[2]:scan=6587	40.912	3	1298.7654	1298.7654	R	I	566	578
PSM	LANVMMGPYRQDLLAK	1226	sp|P18206-2|VINC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8445	52.195	2	1818.9484	1818.9484	R	C	529	545
PSM	LEPKPQPPVAEATPR	1227	sp|Q9UHD8|SEPT9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3552	23.164	3	1628.8886	1628.8886	R	S	223	238
PSM	LEPKPQPPVAEATPR	1228	sp|Q9UHD8|SEPT9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3579	23.323	2	1628.8886	1628.8886	R	S	223	238
PSM	LFGEVTRPTNSK	1229	sp|Q9Y291|RT33_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3794	24.554	2	1347.7147	1347.7147	R	S	18	30
PSM	LGDVGMAELCPGLLHPSSR	1230	sp|P13489|RINI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	6-UNIMOD:35,10-UNIMOD:4,19-UNIMOD:267	ms_run[2]:scan=7655	47.279	3	2033.9902	2033.9902	K	L	239	258
PSM	LGVIEDHSNR	1231	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=2105	14.772	2	1138.5731	1138.5731	K	T	494	504
PSM	LHNELQSGSLR	1232	sp|Q5JTH9-2|RRP12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=2963	19.741	2	1252.6524	1252.6524	K	L	58	69
PSM	LLVQHEINTLR	1233	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:267	ms_run[2]:scan=5936	37.007	2	1344.7753	1344.7753	R	A	553	564
PSM	LMDLLGEGLKR	1234	sp|P54136-2|SYRC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8172	50.488	2	1243.6958	1243.6958	R	S	390	401
PSM	LNHVAAGLVSPSLK	1235	sp|Q05519-2|SRS11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	14-UNIMOD:188	ms_run[2]:scan=5652	35.304	2	1410.829	1410.8290	K	S	198	212
PSM	LRDLEDSLAR	1236	sp|P02545-5|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4932	31.124	2	1186.6306	1186.6306	K	E	221	231
PSM	LRECELSPGVNR	1237	sp|Q9BXP5-5|SRRT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:267,4-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=3260	21.477	2	1448.7309	1448.7309	R	D	450	462
PSM	LRGPSGGGEEPALSQYQR	1238	sp|Q99567|NUP88_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4592	29.201	3	1900.9391	1900.9391	R	L	83	101
PSM	LRGPSGGGEEPALSQYQR	1239	sp|Q99567|NUP88_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:267,18-UNIMOD:267	ms_run[2]:scan=4621	29.362	3	1920.9557	1920.9557	R	L	83	101
PSM	LSDQFHDILIR	1240	sp|O75340-2|PDCD6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7763	47.928	2	1355.7197	1355.7197	R	K	124	135
PSM	LSDQFHDILIR	1241	sp|O75340-2|PDCD6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:267	ms_run[2]:scan=7774	47.987	2	1365.728	1365.7280	R	K	124	135
PSM	LVARPEPATGYTLEFR	1242	sp|Q16658|FSCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7361	45.507	2	1818.9628	1818.9628	R	S	202	218
PSM	LVEVNGENVEKETHQQVVSR	1243	sp|O14745|NHRF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4989	31.464	4	2293.1662	2293.1662	R	I	59	79
PSM	MHSPQTSAMLFTVDNEAGK	1244	sp|P49588|SYAC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:35	ms_run[2]:scan=6931	42.935	3	2078.9401	2078.9401	K	I	880	899
PSM	MREDYDSVEQDGDEPGPQR	1245	sp|Q9Y5S9-2|RBM8A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:35	ms_run[2]:scan=3365	22.085	2	2237.9131	2237.9131	R	S	49	68
PSM	NFQETIHQLEGR	1246	sp|Q9Y4K3|TRAF6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:267	ms_run[2]:scan=7646	47.225	2	1480.7298	1480.7298	R	L	294	306
PSM	NGGHFVISIK	1247	sp|P22087|FBRL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:188	ms_run[2]:scan=5452	34.126	2	1076.6074	1076.6074	R	A	256	266
PSM	NHQDVAGVFALSSFLNK	1248	sp|Q5VWZ2-2|LYPL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	17-UNIMOD:188	ms_run[2]:scan=11670	73.077	2	1851.9575	1851.9575	R	A	121	138
PSM	NILQLHDLTTGALLK	1249	sp|P48147|PPCE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	15-UNIMOD:188	ms_run[2]:scan=10489	65.185	2	1654.9713	1654.9713	K	T	359	374
PSM	NKETLGSEAVSSNVIDYGHASK	1250	sp|Q14966-2|ZN638_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5668	35.4	3	2305.1186	2305.1186	R	Y	195	217
PSM	NKLAELEEALQK	1251	sp|P13647|K2C5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=8077	49.83	2	1396.7965	1396.7965	R	A	430	442
PSM	NLLHSLQSSGIGSK	1252	sp|Q92616|GCN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6664	41.362	2	1439.7732	1439.7732	K	A	88	102
PSM	NNISILKEDPFLFCR	1253	sp|Q6ZN28|MACC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	14-UNIMOD:4	ms_run[2]:scan=11003	68.6	2	1864.9506	1864.9506	R	E	91	106
PSM	NVDPFHIYFCNLK	1254	sp|Q7L0Y3|TM10C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=10830	67.456	2	1671.8175	1671.8175	R	I	237	250
PSM	NVESGEEELASKLDHYK	1255	sp|Q96HS1-2|PGAM5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=7232	44.722	2	1958.9624	1958.9624	R	A	77	94
PSM	NVNVQNFHISWK	1256	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:188	ms_run[2]:scan=8441	52.176	2	1490.7726	1490.7726	K	D	182	194
PSM	NVNVQNFHISWK	1257	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8443	52.184	2	1484.7524	1484.7524	K	D	182	194
PSM	PRDPTPSFYDLWAQEDPNAVLGR	1258	sp|Q14137-2|BOP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:267,23-UNIMOD:267	ms_run[2]:scan=11804	74.006	3	2663.2883	2663.2883	R	H	161	184
PSM	QKYFLVGAGAIGCELLK	1259	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:4	ms_run[2]:scan=10864	67.678	2	1866.0073	1866.0073	K	N	429	446
PSM	QLILVGDHCQLGPVVMCK	1260	sp|Q92900-2|RENT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	9-UNIMOD:4,17-UNIMOD:4,18-UNIMOD:188	ms_run[2]:scan=9042	55.965	3	2072.0676	2072.0676	K	K	656	674
PSM	QSVFPFESGKPFK	1261	sp|P17931|LEG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8221	50.797	2	1496.7664	1496.7664	R	I	187	200
PSM	RAAQLCGAGMAAVVDR	1262	sp|P52789|HXK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	6-UNIMOD:4	ms_run[2]:scan=5711	35.658	2	1644.8188	1644.8188	R	I	829	845
PSM	RIALTDNALIAR	1263	sp|P18124|RL7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:267,12-UNIMOD:267	ms_run[2]:scan=6483	40.278	2	1345.7945	1345.7945	K	S	166	178
PSM	RIMPEDIIINCSK	1264	sp|P11387|TOP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:4	ms_run[2]:scan=7203	44.552	2	1587.8113	1587.8113	R	D	376	389
PSM	RIQQLTEEIGR	1265	sp|P12270|TPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:267,11-UNIMOD:267	ms_run[2]:scan=4852	30.695	2	1361.753	1361.7530	K	L	1367	1378
PSM	RISGLIYEETR	1266	sp|P62805|H4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:267,11-UNIMOD:267	ms_run[2]:scan=5301	33.265	2	1355.7312	1355.7312	K	G	46	57
PSM	RLAEDEAFQR	1267	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3126	20.693	2	1233.6102	1233.6102	R	R	1836	1846
PSM	RLPEYPQVDDLLLR	1268	sp|Q9UI10-3|EI2BD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:267,14-UNIMOD:267	ms_run[2]:scan=10262	63.717	3	1745.9579	1745.9579	K	R	142	156
PSM	RLTVSSLQESGLK	1269	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5472	34.238	2	1416.7936	1416.7936	R	V	2326	2339
PSM	RPELEDSTLR	1270	sp|Q15149-7|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:267,10-UNIMOD:267	ms_run[2]:scan=3161	20.898	2	1234.6421	1234.6421	R	Y	482	492
PSM	RQLDSIVGER	1271	sp|P13647|K2C5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:267,10-UNIMOD:267	ms_run[2]:scan=3737	24.246	2	1191.6475	1191.6475	R	G	228	238
PSM	SDTEHSTNEVGTLCHK	1272	sp|Q8N573-3|OXR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	14-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=1778	12.95	3	1819.8102	1819.8102	R	T	329	345
PSM	SHAVACVNQFIISR	1273	sp|Q92973-3|TNPO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	6-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=6870	42.58	3	1610.8227	1610.8227	R	T	150	164
PSM	SLDMDSIIAEVK	1274	sp|P05787|K2C8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:188	ms_run[2]:scan=10855	67.62	2	1325.6844	1325.6844	R	A	253	265
PSM	SLEELRLEDYQANR	1275	sp|P52948-6|NUP98_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	6-UNIMOD:267,14-UNIMOD:267	ms_run[2]:scan=6897	42.733	2	1754.8702	1754.8702	K	K	199	213
PSM	SPWSNKYDPPLEDGAMPSAR	1276	sp|P47756-2|CAPZB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	16-UNIMOD:35	ms_run[2]:scan=6504	40.406	2	2233.011	2233.0110	R	L	73	93
PSM	SQGKPIELTPLPLLK	1277	sp|Q16537-2|2A5E_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9822	60.891	2	1632.9814	1632.9814	R	D	38	53
PSM	SRAEAESMYQIK	1278	sp|P05787|K2C8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3696	24.015	2	1411.6766	1411.6766	R	Y	274	286
PSM	SRLGDLYEEEMR	1279	sp|P08670|VIME_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:267,12-UNIMOD:267	ms_run[2]:scan=6852	42.48	2	1516.7095	1516.7095	K	E	144	156
PSM	STGLILDSGATHTTAIPVHDGYVLQQGIVK	1280	sp|O96019-2|ACL6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	30-UNIMOD:188	ms_run[2]:scan=9338	57.83	2	3096.6551	3096.6551	R	S	123	153
PSM	TKNALDPMSVLLAR	1281	sp|P42785|PCP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10342	64.235	2	1527.8443	1527.8443	R	S	461	475
PSM	TLGECGFTSQTARPQAPATVGLAFR	1282	sp|Q15370|ELOB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	5-UNIMOD:4,13-UNIMOD:267,25-UNIMOD:267	ms_run[2]:scan=8641	53.425	2	2655.3342	2655.3342	K	A	56	81
PSM	TSPPGPAPGPGLALEPPPGLASWR	1283	sp|A8MXV4|NUD19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	24-UNIMOD:267	ms_run[2]:scan=11243	70.189	2	2331.2251	2331.2251	R	D	145	169
PSM	VGLQVVAVKAPGFGDNR	1284	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7812	48.225	3	1725.9526	1725.9526	K	K	293	310
PSM	VHIDIGADGR	1285	sp|P31942-6|HNRH3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3848	24.862	2	1051.5411	1051.5411	R	A	86	96
PSM	VLGPAACRNPDIFTEVANCCIR	1286	sp|Q7Z6Z7-2|HUWE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	7-UNIMOD:4,19-UNIMOD:4,20-UNIMOD:4	ms_run[2]:scan=9463	58.619	3	2532.2036	2532.2036	R	I	1873	1895
PSM	VLGPAACRNPDIFTEVANCCIR	1287	sp|Q7Z6Z7-2|HUWE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	7-UNIMOD:4,8-UNIMOD:267,19-UNIMOD:4,20-UNIMOD:4,22-UNIMOD:267	ms_run[2]:scan=9471	58.669	3	2552.2201	2552.2201	R	I	1873	1895
PSM	VLQATVVAVGSGSK	1288	sp|P61604|CH10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5136	32.313	2	1314.7507	1314.7507	K	G	41	55
PSM	VLSRPNAQELPSMYQR	1289	sp|Q99623-2|PHB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:35	ms_run[2]:scan=4790	30.333	3	1903.9574	1903.9574	R	L	108	124
PSM	VTPTRTEIIILATR	1290	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	5-UNIMOD:267,14-UNIMOD:267	ms_run[2]:scan=7523	46.468	2	1602.9572	1602.9572	R	T	41	55
PSM	YCFPNYVGRPK	1291	sp|P61163|ACTZ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:4	ms_run[2]:scan=6005	37.427	2	1399.6707	1399.6707	K	H	33	44
PSM	YFLNHIDQTTTWQDPR	1292	sp|P46937-4|YAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	16-UNIMOD:267	ms_run[2]:scan=8042	49.602	2	2043.9678	2043.9678	R	K	10	26
PSM	YQEALHLGSQLLR	1293	sp|O00231|PSD11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:267	ms_run[2]:scan=7788	48.075	2	1536.8288	1536.8288	R	E	143	156
PSM	YVRPGGGYQPTFTLVQK	1294	sp|P18283|GPX2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7086	43.857	2	1910.005	1910.0050	K	C	88	105
PSM	MSLPDVDLDLKGPK	1295	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:35,11-UNIMOD:188,14-UNIMOD:188	ms_run[1]:scan=7483	46.23567	2	1556.831990	1554.836604	K	M	1067	1081
PSM	KDAEAWFTSR	1296	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:188,10-UNIMOD:267	ms_run[1]:scan=5868	36.61143	2	1225.608309	1225.606234	R	T	265	275
PSM	KDAEAWFTSR	1297	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=5869	36.61564	2	1209.580683	1209.577836	R	T	265	275
PSM	HQGVMVGMGQK	1298	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=2529	17.134861666666666	2	1171.549741	1170.563783	R	D	42	53
PSM	GKLEAIITPPPAK	1299	sp|O75367|H2AY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=5487	34.33076666666667	2	1333.796224	1333.796937	K	K	122	135
PSM	HTGPGILSMANAGPNTNGSQFFICTAK	1300	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	24-UNIMOD:4,27-UNIMOD:188	ms_run[1]:scan=10147	62.97152833333333	2	2797.329262	2796.341898	K	T	92	119
PSM	VIPELNGKLTGMAFR	1301	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	8-UNIMOD:188,15-UNIMOD:267	ms_run[1]:scan=9663	59.87060666666667	2	1661.911759	1660.930546	K	V	220	235
PSM	VIPELNGKLTGMAFR	1302	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0		ms_run[1]:scan=9520	58.97031833333333	2	1645.8872	1644.9012	K	V	220	235
PSM	LFQECCPHSTDR	1303	sp|P61978|HNRPK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	5-UNIMOD:4,6-UNIMOD:4	ms_run[1]:scan=2638	17.74771833333333	2	1548.636116	1548.644947	K	V	180	192
PSM	GGPNIITLADIVKD	1304	sp|P68400|CSK21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0		ms_run[1]:scan=11587	72.499305	2	1424.7845	1424.7870	R	P	90	104
PSM	CQHAAEIITDLLR	1305	sp|Q96AE4|FUBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=12752	81.29256666666666	2	1521.7586	1521.7604	R	S	332	345
PSM	QSVFPFESGKPFK	1306	sp|P17931|LEG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:28	ms_run[1]:scan=10067	62.444375	2	1479.7422	1479.7393	R	I	187	200
PSM	QWYESHYALPLGR	1307	sp|P62241|RS8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:28,13-UNIMOD:267	ms_run[1]:scan=10373	64.43446	2	1611.7752	1611.7704	R	K	111	124
PSM	MGLVDQLVEPLGPGLKPPEER	1308	sp|P40939|ECHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	16-UNIMOD:188,21-UNIMOD:267	ms_run[1]:scan=11058	68.96633666666666	3	2290.234274	2289.237352	K	T	215	236
PSM	CDLHRLEEGPPVTTVLTR	1309	sp|P08559|ODPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:385,1-UNIMOD:4,5-UNIMOD:267,18-UNIMOD:267	ms_run[1]:scan=9478	58.70946166666667	2	2095.0674	2095.0630	K	E	41	59
PSM	QQGVLALRPYLQK	1310	sp|P56192|SYMC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:28,8-UNIMOD:267,13-UNIMOD:188	ms_run[1]:scan=9466	58.63574166666666	2	1511.8813	1511.8790	K	Q	192	205
PSM	GIPLATGDTSPEPELLPGAPLPPPKEVINGNIK	1311	sp|O75821|EIF3G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	25-UNIMOD:188,33-UNIMOD:188	ms_run[1]:scan=10745	66.87516833333333	3	3343.838872	3342.847767	K	T	33	66
PSM	LGLSTLGELKQNLSR	1312	sp|O43399|TPD54_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=9453	58.55798000000001	2	1628.928286	1627.925720	R	S	81	96
PSM	AFNFGNGLQMLGQKPK	1313	sp|O95573|ACSL3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=9680	59.981094999999996	2	1748.901253	1748.903210	R	T	144	160
PSM	QVASHVGLHSASIPGILALDLCPSDTNK	1314	sp|Q9UMS4|PRP19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:28,22-UNIMOD:4	ms_run[1]:scan=11696	73.25437833333334	3	2882.4538	2882.4591	R	I	209	237
PSM	KVPGVTAIELGEETCTFR	1315	sp|P51116|FXR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:188,15-UNIMOD:4,18-UNIMOD:267	ms_run[1]:scan=8551	52.86778	3	2024.022427	2022.042675	R	I	256	274
PSM	PLDDGVGNQLGALVHQR	1316	sp|Q96I24|FUBP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=8453	52.24451	3	1788.954688	1787.927845	R	T	59	76
PSM	YGLFKEENPYAR	1317	sp|P53801|PTTG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=6375	39.62256666666667	2	1485.727165	1485.725229	K	F	165	177
PSM	CFAFVHDLCDEEK	1318	sp|Q96IZ6|MET2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:385,1-UNIMOD:4,9-UNIMOD:4	ms_run[1]:scan=11692	73.23028833333333	2	1651.6609	1651.6642	R	S	233	246
PSM	HGDVITIIDR	1319	sp|P46013|KI67_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=5700	35.591359999999995	2	1137.616517	1137.614222	K	S	84	94
PSM	LHQVYFDAPTCR	1320	sp|P08247|SYPH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	11-UNIMOD:4	ms_run[1]:scan=5252	32.98331833333334	2	1506.714282	1505.708533	R	G	77	89
PSM	CLANLRPLLDSGTMGTK	1321	sp|A0AVT1|UBA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=12065	75.795965	2	1828.9150	1828.9170	R	G	581	598
PSM	RMHLNGSNVQVLHR	1322	sp|Q07954|LRP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=11498	71.8813	2	1659.858930	1659.873976	R	T	3085	3099
PSM	LHLQGQTMQDPFGEK	1323	sp|Q9H832|UBE2Z_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	15-UNIMOD:188	ms_run[1]:scan=6895	42.722878333333334	2	1734.853604	1733.850234	R	R	290	305
PSM	VIQQSLEQEEAEHKATK	1324	sp|O75116|ROCK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=3042	20.202605	2	1967.996110	1966.995984	K	A	696	713
PSM	FSMPGFKGEGPEVDVNLPK	1325	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:35,19-UNIMOD:188	ms_run[1]:scan=9856	61.112406666666665	2	2072.065492	2069.023507	K	A	2251	2270
PSM	ACQSIYPLHDVFVR	1326	sp|P61247|RS3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:4	ms_run[2]:scan=8744	54.059	2	1703.8454	1703.8454	K	K	200	214
PSM	AGLNCSTENMPIKINLIAPPR	1327	sp|P05198|IF2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	5-UNIMOD:4	ms_run[2]:scan=9911	61.46	3	2308.2032	2308.2032	R	Y	214	235
PSM	AHSSMVGVNLPQK	1328	sp|P00558-2|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:188	ms_run[2]:scan=4452	28.375	2	1372.7228	1372.7228	R	A	144	157
PSM	ALPGQLKPFETLLSQNQGGK	1329	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10457	64.982	3	2125.1532	2125.1532	K	T	122	142
PSM	APGQLALFSVSDKTGLVEFAR	1330	sp|P31939|PUR9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11570	72.376	3	2205.1794	2205.1794	M	N	2	23
PSM	APSRQDVYGPQPQVR	1331	sp|O60716|CTND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=3084	20.452	2	1696.8645	1696.8645	R	V	250	265
PSM	AQLGLGHSYSR	1332	sp|O00567|NOP56_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=3146	20.809	2	1187.6047	1187.6047	K	A	144	155
PSM	ASAALAALEKLFSGPNAANNK	1333	sp|Q96SI9-2|STRBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:188,21-UNIMOD:188	ms_run[2]:scan=12664	80.537	3	2069.1308	2069.1308	K	K	550	571
PSM	ASGNYATVISHNPETKK	1334	sp|P62917|RL8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=3136	20.753	2	1815.9115	1815.9115	R	T	129	146
PSM	ASITPGTILIILTGR	1335	sp|Q02878|RL6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=13559	91.488	2	1524.9239	1524.9239	R	H	142	157
PSM	AVPLIHQEGNR	1336	sp|O00170|AIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=2927	19.524	2	1232.6626	1232.6626	K	L	178	189
PSM	DFINFISDKEWK	1337	sp|Q9H3N1|TMX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11120	69.374	2	1540.7562	1540.7562	K	S	122	134
PSM	DKWLAPDGLIFPDR	1338	sp|Q99873-2|ANM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10613	65.995	2	1641.8515	1641.8515	R	A	158	172
PSM	DLEKPFLLPVEAVYSVPGR	1339	sp|P49411|EFTU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	4-UNIMOD:188,19-UNIMOD:267	ms_run[2]:scan=12133	76.255	2	2144.1852	2140.1971	R	G	253	272
PSM	DLGGIVLANACGPCIGQWDRK	1340	sp|Q99798|ACON_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=10360	64.347	2	2299.1202	2299.1202	R	D	438	459
PSM	DPENFPFVVLGNKIDLENR	1341	sp|P51149|RAB7A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11968	75.148	3	2215.1273	2215.1273	R	Q	114	133
PSM	ELKIDIIPNPQER	1342	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7929	48.904	2	1563.8621	1563.8621	K	T	70	83
PSM	ELVTQQLPHLLK	1343	sp|Q99584|S10AD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:188	ms_run[2]:scan=8236	50.892	2	1423.8494	1423.8494	K	D	40	52
PSM	ENPSATLEDLEKPGVDEEPQHVLLR	1344	sp|Q92900-2|RENT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8963	55.467	3	2814.4036	2814.4036	K	Y	271	296
PSM	ENSGAAEKPVTIHATPEGTSEACR	1345	sp|Q9Y6M1-5|IF2B2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	23-UNIMOD:4	ms_run[2]:scan=3096	20.521	3	2511.166	2511.1660	K	M	170	194
PSM	EVKPEETTCSEHCLQK	1346	sp|Q9Y5J7|TIM9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	3-UNIMOD:188,9-UNIMOD:4,13-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=1725	12.66	2	1985.9225	1985.9225	R	Y	40	56
PSM	FADEHVPGSPFTVK	1347	sp|O75369-7|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6681	41.459	2	1529.7514	1529.7514	K	I	1895	1909
PSM	FAQHGTFEYEYSQR	1348	sp|P23246-2|SFPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5087	32.022	3	1761.7747	1761.7747	R	W	480	494
PSM	FHPEPYGLEDDQR	1349	sp|O60716|CTND1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:267	ms_run[2]:scan=5113	32.177	2	1611.7193	1611.7193	R	S	275	288
PSM	FKDIFQEIYDK	1350	sp|O75874|IDHC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=9958	61.751	2	1456.7641	1456.7641	R	Q	223	234
PSM	FLNAENAQKFK	1351	sp|P43487-2|RANG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4381	27.981	2	1308.6826	1308.6826	R	T	142	153
PSM	FLNDTTKPVGLLLSER	1352	sp|Q9P287-4|BCCIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9418	58.342	3	1801.9938	1801.9938	K	F	168	184
PSM	FSMPGFKAEGPEVDVNLPK	1353	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	3-UNIMOD:35,7-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=7815	48.242	3	2089.0593	2089.0593	K	A	885	904
PSM	FTISDHPQPIDPLLK	1354	sp|Q86VP6-2|CAND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	15-UNIMOD:188	ms_run[2]:scan=8768	54.212	2	1725.9397	1725.9397	K	N	823	838
PSM	GAVEALAAALAHISGATSVDQR	1355	sp|Q9NR30-2|DDX21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	22-UNIMOD:267	ms_run[2]:scan=13053	84.795	3	2117.1104	2117.1104	K	S	538	560
PSM	GGPNIITLADIVKDPVSR	1356	sp|P68400|CSK21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:188,18-UNIMOD:267	ms_run[2]:scan=11383	71.122	2	1880.0702	1876.0821	R	T	90	108
PSM	GHQAFDVGQPR	1357	sp|P11717|MPRI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:267	ms_run[2]:scan=2707	18.174	2	1220.5926	1220.5926	R	D	239	250
PSM	GLGTDEDSLIEIICSR	1358	sp|P07355-2|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	14-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=12028	75.543	2	1786.8646	1786.8646	K	T	138	154
PSM	GLHQSIEEFR	1359	sp|Q15149-7|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4765	30.182	2	1214.6044	1214.6044	R	A	528	538
PSM	GPLLYCARPPQDLK	1360	sp|Q8N1G4|LRC47_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	6-UNIMOD:4	ms_run[2]:scan=6297	39.175	2	1626.8552	1626.8552	K	I	385	399
PSM	GRPYDYNGPR	1361	sp|P13667|PDIA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:267,10-UNIMOD:267	ms_run[2]:scan=2348	16.108	2	1213.5743	1213.5743	K	E	261	271
PSM	GVDEVTIVNILTNR	1362	sp|P07355-2|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11976	75.202	3	1541.8413	1541.8413	K	S	68	82
PSM	GVGISVLEMSHR	1363	sp|Q9Y617|SERC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:267	ms_run[2]:scan=7044	43.602	2	1293.6739	1293.6739	K	S	34	46
PSM	GVGISVLEMSHR	1364	sp|Q9Y617|SERC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7048	43.626	2	1283.6656	1283.6656	K	S	34	46
PSM	HGDVITIIDR	1365	sp|P46013-2|KI67_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5666	35.389	2	1137.6142	1137.6142	K	S	84	94
PSM	HGGICDCQTSR	1366	sp|Q10713|MPPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	5-UNIMOD:4,7-UNIMOD:4,11-UNIMOD:267	ms_run[2]:scan=771	7.5197	2	1299.5324	1299.5324	K	D	136	147
PSM	HGGTIPIVPTAEFQDR	1367	sp|P00367-2|DHE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	16-UNIMOD:267	ms_run[2]:scan=7467	46.141	2	1746.8929	1746.8929	K	I	314	330
PSM	HGSGAFYSPELLEALTLR	1368	sp|Q96EK9|KTI12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=12242	77.064	2	1960.0054	1960.0054	K	F	198	216
PSM	HLCEPGADGAETFADGVPR	1369	sp|Q14839|CHD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	3-UNIMOD:4,19-UNIMOD:267	ms_run[2]:scan=6481	40.268	3	2007.8984	2007.8984	R	E	1466	1485
PSM	HNLQDFINIK	1370	sp|P46821|MAP1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:188	ms_run[2]:scan=7877	48.607	2	1246.6765	1246.6765	R	L	204	214
PSM	HNVQTLDIISR	1371	sp|Q06203|PUR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5389	33.746	2	1294.6993	1294.6993	R	S	261	272
PSM	HNVQTLDIISR	1372	sp|Q06203|PUR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:267	ms_run[2]:scan=5393	33.771	2	1304.7076	1304.7076	R	S	261	272
PSM	HQAFEAELSANQSR	1373	sp|Q13813-3|SPTN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	14-UNIMOD:267	ms_run[2]:scan=4237	27.17	2	1596.752	1596.7520	K	I	614	628
PSM	HQGVMVGMGQK	1374	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	5-UNIMOD:35,8-UNIMOD:35	ms_run[2]:scan=741	7.3655	2	1202.5536	1202.5536	R	D	40	51
PSM	HSGPNSADSANDGFVR	1375	sp|P52597|HNRPF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=2294	15.791	3	1629.7132	1629.7132	K	L	99	115
PSM	HSMNPFCEIAVEEAVR	1376	sp|P38117|ETFB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	7-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=9508	58.897	3	1897.869	1897.8690	K	L	36	52
PSM	HSNVNLTIFTAR	1377	sp|Q9NRW3|ABC3C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:267	ms_run[2]:scan=7127	44.106	2	1381.7342	1381.7342	R	L	111	123
PSM	HSTLDFMLGAK	1378	sp|P52788-2|SPSY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7734	47.76	2	1218.6067	1218.6067	R	A	6	17
PSM	HVFGESDELIGQK	1379	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5592	34.968	3	1457.7151	1457.7151	R	V	138	151
PSM	HVVPNEVVVQR	1380	sp|P06396-2|GELS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=3391	22.233	2	1274.7095	1274.7095	K	L	127	138
PSM	IADRLGLELGK	1381	sp|P60891|PRPS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6310	39.25	2	1183.6925	1183.6925	K	V	19	30
PSM	IAKPLSSLTPLIAAAK	1382	sp|Q13153|PAK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9448	58.524	2	1592.9865	1592.9865	K	E	523	539
PSM	IEINFPAEYPFKPPK	1383	sp|P68036-2|UB2L3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10226	63.487	2	1788.9451	1788.9451	R	I	21	36
PSM	IFHELTQTDK	1384	sp|P11586|C1TC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=3416	22.383	2	1230.6245	1230.6245	R	A	464	474
PSM	IFHELTQTDK	1385	sp|P11586|C1TC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:188	ms_run[2]:scan=3422	22.421	2	1236.6446	1236.6446	R	A	464	474
PSM	IFQGNVHNFEK	1386	sp|Q96DI7|SNR40_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:188	ms_run[2]:scan=4388	28.019	2	1337.6824	1337.6824	K	N	276	287
PSM	IFQGNVHNFEK	1387	sp|Q96DI7|SNR40_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4387	28.014	2	1331.6622	1331.6622	K	N	276	287
PSM	IGEHTPSALAIMENANVLAR	1388	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:35	ms_run[2]:scan=7455	46.073	3	2122.0841	2122.0841	K	Y	154	174
PSM	IGEHTPSALAIMENANVLAR	1389	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	20-UNIMOD:267	ms_run[2]:scan=10640	66.169	3	2116.0974	2116.0974	K	Y	154	174
PSM	IHAVGAPSVCSSCGQSYYR	1390	sp|Q6DD87|ZN787_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:4,13-UNIMOD:4,19-UNIMOD:267	ms_run[2]:scan=4951	31.234	3	2107.9443	2107.9443	K	A	338	357
PSM	IHDIVLVGGSTR	1391	sp|P34931|HS71L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5181	32.569	2	1265.7092	1265.7092	K	I	333	345
PSM	IIEDLRAQIFANTVDNAR	1392	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9494	58.809	3	2058.0858	2058.0858	K	I	132	150
PSM	IIFVVGGPGSGKGTQCEK	1393	sp|P00568|KAD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	16-UNIMOD:4	ms_run[2]:scan=5901	36.798	2	1832.9455	1832.9455	K	I	10	28
PSM	IKNCLNPQFSK	1394	sp|O75131|CPNE3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	4-UNIMOD:4	ms_run[2]:scan=3651	23.746	2	1347.6969	1347.6969	R	T	51	62
PSM	ILQNEPLPERLEVNGR	1395	sp|O95793-2|STAU1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=6813	42.256	2	1896.0332	1896.0332	R	E	78	94
PSM	ILQNEPLPERLEVNGR	1396	sp|O95793-2|STAU1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6815	42.266	2	1876.0167	1876.0167	R	E	78	94
PSM	IRIDSLSAQLSQLQK	1397	sp|P02545-5|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:267,15-UNIMOD:188	ms_run[2]:scan=9024	55.853	3	1714.9912	1711.0031	R	Q	198	213
PSM	IVLRLECVEPNCR	1398	sp|Q969Q0|RL36L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	4-UNIMOD:267,7-UNIMOD:4,12-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=7010	43.399	2	1676.8605	1676.8605	K	S	66	79
PSM	KFLDGNELTLADCNLLPK	1399	sp|O00299|CLIC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:4	ms_run[2]:scan=10504	65.282	3	2060.0612	2060.0612	R	L	166	184
PSM	KILDPNTGEPAPVLSSPPPADVSTFLAFPSPEK	1400	sp|P46060|RAGP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11865	74.425	3	3417.7708	3417.7708	R	L	413	446
PSM	KLDELYGTWR	1401	sp|P36578|RL4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6832	42.367	2	1279.6561	1279.6561	R	K	259	269
PSM	KPASFMTSICDER	1402	sp|P53396-3|ACLY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:4	ms_run[2]:scan=6009	37.45	2	1540.7014	1540.7014	R	G	565	578
PSM	LAGDKANYWWLR	1403	sp|P31939|PUR9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8893	55.032	2	1491.7623	1491.7623	R	H	457	469
PSM	LAIHNPNLPTTLPVNSQNIQPVR	1404	sp|Q13887-2|KLF5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	23-UNIMOD:267	ms_run[2]:scan=8538	52.783	3	2545.4004	2545.4004	K	Y	184	207
PSM	LGDHQSPATPAFK	1405	sp|Q8TEQ6|GEMI5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=3396	22.264	2	1367.6834	1367.6834	K	S	1262	1275
PSM	LGLLDNHSSEFNVTR	1406	sp|P36776-3|LONM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	15-UNIMOD:267	ms_run[2]:scan=7505	46.366	3	1710.8565	1710.8565	K	N	249	264
PSM	LGLSTLGELKQNLSR	1407	sp|O43399-6|TPD54_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9427	58.397	3	1627.9257	1627.9257	R	S	58	73
PSM	LGVIEDHSNR	1408	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:267	ms_run[2]:scan=2107	14.78	2	1148.5814	1148.5814	K	T	494	504
PSM	LHNQVNGTEWSWK	1409	sp|O14980|XPO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:188	ms_run[2]:scan=6285	39.102	2	1603.7839	1603.7839	K	N	480	493
PSM	LHVGNISPTCTNK	1410	sp|Q9BWF3-3|RBM4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=3596	23.429	2	1445.7392	1445.7392	K	E	80	93
PSM	LIAHAGSLTNLAK	1411	sp|O00567|NOP56_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5199	32.671	2	1307.7561	1307.7561	R	Y	308	321
PSM	LKDLEALLNSK	1412	sp|P02545-5|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8014	49.419	2	1242.7184	1242.7184	R	E	35	46
PSM	LKGPQITGPSLEGDLGLK	1413	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=8859	54.818	3	1834.0603	1834.0603	K	G	370	388
PSM	LKVPEWVDTVK	1414	sp|P39019|RS19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7842	48.41	2	1312.7391	1312.7391	K	L	28	39
PSM	LLQLDKEFQLFQGVTR	1415	sp|Q9UET6-2|TRM7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11923	74.837	3	1934.0625	1934.0625	K	A	29	45
PSM	LNKASINMLR	1416	sp|P18124|RL7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4749	30.091	2	1158.6543	1158.6543	K	I	125	135
PSM	LNRLPAAGVGDMVMATVK	1417	sp|P62829|RL23_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	3-UNIMOD:267,18-UNIMOD:188	ms_run[2]:scan=9509	58.902	3	1858.014	1854.0258	R	K	49	67
PSM	LPEHCIEYVR	1418	sp|Q8TBC4|UBA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	5-UNIMOD:4,10-UNIMOD:267	ms_run[2]:scan=4333	27.718	2	1324.6473	1324.6473	R	M	245	255
PSM	LQAEIEGLKGQR	1419	sp|P05787|K2C8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4330	27.705	2	1340.7412	1340.7412	R	A	317	329
PSM	LRQENMELAER	1420	sp|P40222|TXLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:267,11-UNIMOD:267	ms_run[2]:scan=3266	21.508	2	1407.7043	1407.7043	K	L	298	309
PSM	LSFQHDPETSVLVLR	1421	sp|Q14697|GANAB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	15-UNIMOD:267	ms_run[2]:scan=8630	53.357	3	1749.9289	1749.9289	R	K	915	930
PSM	LTGMAFRVPTANVSVVDLTCR	1422	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	4-UNIMOD:35,20-UNIMOD:4	ms_run[2]:scan=9642	59.738	3	2322.1824	2322.1824	K	L	228	249
PSM	LVARPEPATGYTLEFR	1423	sp|Q16658|FSCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	4-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=7370	45.562	3	1838.9794	1838.9794	R	S	202	218
PSM	MGHAGAIIAGGK	1424	sp|P53597|SUCA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:35,12-UNIMOD:188	ms_run[2]:scan=1377	10.733	2	1103.5853	1103.5853	R	G	297	309
PSM	MGLVDQLVEPLGPGLKPPEER	1425	sp|P40939|ECHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11021	68.718	3	2273.209	2273.2090	K	T	215	236
PSM	MKLDYILGLK	1426	sp|P46781|RS9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:188,10-UNIMOD:188	ms_run[2]:scan=9626	59.634	2	1204.7292	1204.7292	K	I	92	102
PSM	MLQADPNKVSAR	1427	sp|Q9Y3I0|RTCB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:35	ms_run[2]:scan=1805	13.103	2	1344.682	1344.6820	R	A	199	211
PSM	MMANGILKVPAINVNDSVTK	1428	sp|P23526-2|SAHH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:35,8-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=8712	53.861	3	2142.158	2142.1580	K	S	139	159
PSM	MREDYDSVEQDGDEPGPQR	1429	sp|Q9Y5S9-2|RBM8A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:35	ms_run[2]:scan=3363	22.076	3	2237.9131	2237.9131	R	S	49	68
PSM	MRYVASYLLAALGGNSSPSAK	1430	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:35	ms_run[2]:scan=10982	68.462	3	2171.1045	2171.1045	-	D	1	22
PSM	MVNHFIAEFK	1431	sp|P11142-2|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:35	ms_run[2]:scan=6210	38.646	2	1250.6118	1250.6118	R	R	237	247
PSM	NASIHTLLDALER	1432	sp|O00220|TR10A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:267	ms_run[2]:scan=10657	66.275	2	1461.7815	1461.7815	R	M	422	435
PSM	NCLTNFHGMDLTR	1433	sp|P61247|RS3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:4,9-UNIMOD:35,13-UNIMOD:267	ms_run[2]:scan=5305	33.286	2	1603.7111	1603.7111	K	D	95	108
PSM	NGRVEIIANDQGNR	1434	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	3-UNIMOD:267,14-UNIMOD:267	ms_run[2]:scan=2555	17.278	2	1574.8028	1574.8028	K	I	47	61
PSM	NGRVEIIANDQGNR	1435	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=2558	17.294	2	1554.7863	1554.7863	K	I	47	61
PSM	NLGVVVAPHTLK	1436	sp|Q9BYD2|RM09_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:188	ms_run[2]:scan=5361	33.592	2	1252.7599	1252.7599	K	L	196	208
PSM	NLLSVAYKNVIGAR	1437	sp|P62258-2|1433E_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10069	62.456	2	1516.8726	1516.8726	R	R	21	35
PSM	NNRPSEGPLQTR	1438	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	3-UNIMOD:267,12-UNIMOD:267	ms_run[2]:scan=1585	11.874	2	1387.7071	1387.7071	K	L	572	584
PSM	NNRPSEGPLQTR	1439	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=1587	11.885	2	1367.6906	1367.6906	K	L	572	584
PSM	NRVIGSGCNLDSAR	1440	sp|P00338-5|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	8-UNIMOD:4	ms_run[2]:scan=2830	18.934	3	1517.7369	1517.7369	K	F	156	170
PSM	NRYQLEIPENFTTR	1441	sp|P52701-4|MSH6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:267,14-UNIMOD:267	ms_run[2]:scan=7957	49.072	2	1799.9069	1799.9069	R	N	673	687
PSM	NSDLKPYIIFIAPPSQER	1442	sp|Q8N3R9-2|MPP5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10344	64.246	2	2087.1051	2087.1051	R	L	553	571
PSM	NSVSNFLHSLER	1443	sp|Q13085-3|ACACA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:267	ms_run[2]:scan=9925	61.544	2	1411.7083	1411.7083	R	G	568	580
PSM	NYDPALHPFEVPR	1444	sp|Q9NV06|DCA13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:267	ms_run[2]:scan=7434	45.953	2	1563.7709	1563.7709	R	E	27	40
PSM	NYDPALHPFEVPR	1445	sp|Q9NV06|DCA13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7446	46.023	2	1553.7627	1553.7627	R	E	27	40
PSM	QASIQHIQNAIDTEKSQQALVQK	1446	sp|P24539|AT5F1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	15-UNIMOD:188,23-UNIMOD:188	ms_run[2]:scan=6356	39.506	3	2589.3913	2589.3913	K	R	140	163
PSM	QSVFPFESGKPFK	1447	sp|P17931|LEG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8066	49.76	2	1496.7664	1496.7664	R	I	187	200
PSM	RAPDQAAEIGSR	1448	sp|Q3ZCQ8-2|TIM50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=1473	11.259	2	1269.6426	1269.6426	R	G	135	147
PSM	RDDGTGQLLLPLSDAR	1449	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8406	51.962	2	1725.901	1725.9010	R	K	3834	3850
PSM	RGDTYELQVR	1450	sp|Q9H0U3|MAGT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:267,10-UNIMOD:267	ms_run[2]:scan=3661	23.806	2	1255.6424	1255.6424	K	G	150	160
PSM	RGESLDNLDSPR	1451	sp|Q8WWI1-3|LMO7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=3461	22.651	2	1357.6586	1357.6586	R	S	1173	1185
PSM	RGFFICDQPYEPVSPYSCK	1452	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	6-UNIMOD:4,18-UNIMOD:4	ms_run[2]:scan=8864	54.851	3	2349.0558	2349.0558	R	E	675	694
PSM	RGSDIIIVGR	1453	sp|P11172-4|UMPS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:267,10-UNIMOD:267	ms_run[2]:scan=4391	28.034	2	1104.6518	1104.6518	K	G	167	177
PSM	RLAEDEAFQR	1454	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:267,10-UNIMOD:267	ms_run[2]:scan=3119	20.653	2	1253.6267	1253.6267	R	R	1836	1846
PSM	RVDALNDEIR	1455	sp|Q9UQE7|SMC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:267,10-UNIMOD:267	ms_run[2]:scan=3704	24.059	2	1219.6424	1219.6424	K	Q	796	806
PSM	RVDALNDEIR	1456	sp|Q9UQE7|SMC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=3705	24.064	2	1199.6258	1199.6258	K	Q	796	806
PSM	RYDSNSGGER	1457	sp|P62191|PRS4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:267,10-UNIMOD:267	ms_run[2]:scan=477	5.9062	2	1159.5121	1159.5121	K	E	294	304
PSM	SCFGHPLAPQALEDVK	1458	sp|Q8IXI1-2|MIRO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=7066	43.732	3	1773.8815	1773.8815	K	T	88	104
PSM	SEAEEAITSFNGHKPPGSSEPITVK	1459	sp|Q15717|ELAV1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6646	41.251	3	2611.2766	2611.2766	R	F	158	183
PSM	SEAEEAITSFNGHKPPGSSEPITVK	1460	sp|Q15717|ELAV1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	14-UNIMOD:188,25-UNIMOD:188	ms_run[2]:scan=6652	41.289	3	2623.3168	2623.3168	R	F	158	183
PSM	SEASLHPVLMSEAPWNTR	1461	sp|O96019-2|ACL6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8953	55.406	3	2023.9786	2023.9786	K	A	71	89
PSM	SEFERLECLQR	1462	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	5-UNIMOD:267,8-UNIMOD:4,11-UNIMOD:267	ms_run[2]:scan=6245	38.862	2	1485.7149	1485.7149	R	I	354	365
PSM	SEFERLECLQR	1463	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	8-UNIMOD:4	ms_run[2]:scan=6254	38.916	2	1465.6984	1465.6984	R	I	354	365
PSM	SILSPGGSCGPIKVK	1464	sp|P78347-2|GTF2I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	9-UNIMOD:4	ms_run[2]:scan=5852	36.518	2	1498.8177	1498.8177	R	T	207	222
PSM	SIPSMVDGLKPGQR	1465	sp|P11388|TOP2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6547	40.671	2	1483.7817	1483.7817	R	K	714	728
PSM	SKESVPEFPLSPPK	1466	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=7061	43.7	2	1552.854	1552.8540	R	K	28	42
PSM	SKINVNEIFYDLVR	1467	sp|P61224-2|RAP1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=12319	77.644	2	1708.9148	1708.9148	K	Q	103	117
PSM	SKVEETTEHLVTK	1468	sp|P52732|KIF11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=2951	19.665	2	1499.7831	1499.7831	R	S	1033	1046
PSM	SLGTADVHFER	1469	sp|Q86V81|THOC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4861	30.746	2	1230.5993	1230.5993	R	K	145	156
PSM	SRNTDEMVELR	1470	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:267,11-UNIMOD:267	ms_run[2]:scan=3890	25.103	2	1368.6571	1368.6571	R	I	36	47
PSM	SRNTDEMVELR	1471	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=3891	25.108	2	1348.6405	1348.6405	R	I	36	47
PSM	TDMDQIITSKEHLASK	1472	sp|Q96TA1-2|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=5994	37.36	2	1827.9439	1827.9439	R	I	294	310
PSM	TGKLVFLGLDNAGK	1473	sp|Q9Y6B6|SAR1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7985	49.246	2	1431.8086	1431.8086	K	T	25	39
PSM	TIAFAHDSTR	1474	sp|Q15397|PUM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:267	ms_run[2]:scan=2370	16.234	2	1127.5599	1127.5599	K	V	172	182
PSM	TIQAHEGFVR	1475	sp|Q9NV06|DCA13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=3031	20.141	2	1156.5989	1156.5989	R	G	104	114
PSM	TLAGDVHIVR	1476	sp|Q9UBQ0|VPS29_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4708	29.852	2	1079.6087	1079.6087	K	G	51	61
PSM	TQRPADVIFATVR	1477	sp|P33993|MCM7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7491	46.285	2	1472.81	1472.8100	R	E	654	667
PSM	TSPPGPAPGPGLALEPPPGLASWR	1478	sp|A8MXV4|NUD19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11201	69.908	2	2321.2168	2321.2168	R	D	145	169
PSM	TVAMHEVFLCR	1479	sp|Q9UNH7-2|SNX6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:4	ms_run[2]:scan=6360	39.53	2	1361.6584	1361.6584	K	V	24	35
PSM	TVETRDGQVINETSQHHDDLE	1480	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	5-UNIMOD:267	ms_run[2]:scan=4601	29.253	3	2432.1079	2432.1079	K	-	446	467
PSM	VAYVSFGPHAGK	1481	sp|P50914|RL14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:188	ms_run[2]:scan=4901	30.958	2	1237.6551	1237.6551	R	L	12	24
PSM	VAYVSFGPHAGK	1482	sp|P50914|RL14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4910	31.008	2	1231.635	1231.6350	R	L	12	24
PSM	VGHSELVGEIIR	1483	sp|P38606-2|VATA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6367	39.574	2	1307.7197	1307.7197	R	L	12	24
PSM	VGNPWDPNVLYGPLHTK	1484	sp|P49419|AL7A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	17-UNIMOD:188	ms_run[2]:scan=9838	60.996	2	1911.9939	1911.9939	R	Q	359	376
PSM	VGRPSNIGQAQPIIDQLAEEAR	1485	sp|Q9UHX1-4|PUF60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9773	60.576	2	2361.2401	2361.2401	K	A	142	164
PSM	VGRPSNIGQAQPIIDQLAEEAR	1486	sp|Q9UHX1-4|PUF60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	3-UNIMOD:267,22-UNIMOD:267	ms_run[2]:scan=9750	60.428	3	2381.2566	2381.2566	K	A	142	164
PSM	VIGELVGHTER	1487	sp|Q8TEQ6|GEMI5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:267	ms_run[2]:scan=3824	24.729	2	1218.6596	1218.6596	R	V	56	67
PSM	VLEALLPLKGLEER	1488	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10685	66.451	2	1578.9345	1578.9345	R	V	2383	2397
PSM	VLGPAACRNPDIFTEVANCCIR	1489	sp|Q7Z6Z7-2|HUWE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	7-UNIMOD:4,19-UNIMOD:4,20-UNIMOD:4	ms_run[2]:scan=9475	58.692	2	2532.2036	2532.2036	R	I	1873	1895
PSM	VRQQAADLISR	1490	sp|O75533|SF3B1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:267,11-UNIMOD:267	ms_run[2]:scan=3035	20.167	2	1275.7162	1275.7162	K	T	947	958
PSM	VSFELFADKVPK	1491	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9132	56.517	2	1378.7497	1378.7497	R	T	20	32
PSM	VVSDRWLSCETQLPVSFR	1492	sp|O75643|U520_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	9-UNIMOD:4	ms_run[2]:scan=10182	63.2	2	2178.0892	2178.0892	R	H	1270	1288
PSM	WLDLKDNPLDPVLAK	1493	sp|Q96AG4|LRC59_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	5-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=11145	69.541	2	1747.9911	1747.9911	K	V	112	127
PSM	YLHDESGLNR	1494	sp|Q15019|SEPT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:267	ms_run[2]:scan=2051	14.48	2	1212.5763	1212.5763	R	R	129	139
PSM	YNQLLRIEEELGSK	1495	sp|P06733-2|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9697	60.091	3	1690.889	1690.8890	K	A	314	328
PSM	QRYEILTPNSIPK	1496	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28	ms_run[1]:scan=8141	50.27694	2	1540.8226	1540.8244	R	G	719	732
PSM	RFDEILEASDGIMVAR	1497	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:267,16-UNIMOD:267	ms_run[1]:scan=9883	61.285251666666674	3	1840.931897	1840.925622	R	G	279	295
PSM	RVLDELTLAR	1498	sp|P02533|K1C14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:267,10-UNIMOD:267	ms_run[1]:scan=6569	40.807946666666666	2	1204.706168	1204.704259	R	A	223	233
PSM	TEELNREVAGHTEQLQMSR	1499	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=5808	36.25313666666666	3	2228.048400	2227.065143	R	S	275	294
PSM	SRLEQEIATYR	1500	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=5753	35.91473166666667	2	1364.705099	1364.704828	K	S	371	382
PSM	SRLEQEIATYR	1501	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=5582	34.90936333333334	2	1364.705099	1364.704828	K	S	371	382
PSM	GKLEAIITPPPAK	1502	sp|O75367|H2AY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=5524	34.554735	2	1333.796224	1333.796937	K	K	122	135
PSM	HTGPNSPDTANDGFVR	1503	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	16-UNIMOD:267	ms_run[1]:scan=2993	19.921956666666667	3	1695.767334	1693.768380	K	L	99	115
PSM	QLILVGDHCQLGPVVMCKK	1504	sp|Q92900|RENT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28,9-UNIMOD:4,17-UNIMOD:4	ms_run[1]:scan=9995	61.98716166666667	3	2177.1140	2177.1154	K	A	667	686
PSM	QSVFPFESGKPFK	1505	sp|P17931|LEG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28,10-UNIMOD:188,13-UNIMOD:188	ms_run[1]:scan=10068	62.449918333333336	2	1491.7820	1491.7796	R	I	187	200
PSM	HVSPAGAAVGIPLSEDEAK	1506	sp|P31939|PUR9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	19-UNIMOD:188	ms_run[1]:scan=6144	38.24854833333333	2	1852.955667	1852.962621	K	V	267	286
PSM	QMVIDVLHPGK	1507	sp|P62847|RS24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=7094	43.90761333333334	2	1235.667167	1235.669628	K	A	22	33
PSM	GGVDTAAAPAGGAPPAHAPGPGR	1508	sp|Q14657|LAGE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	23-UNIMOD:267	ms_run[1]:scan=3236	21.331508333333336	3	1960.974193	1960.974291	R	D	25	48
PSM	RFEAEPLPENTNR	1509	sp|Q9BTU6|P4K2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=4127	26.530515	2	1571.770226	1571.769219	R	Q	276	289
PSM	QIENIVDKTFFHQENVR	1510	sp|Q9H089|LSG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28	ms_run[1]:scan=11561	72.31664666666667	3	2099.0407	2099.0431	K	A	587	604
PSM	PLRPQVVTDDDGQAPEAK	1511	sp|Q9HDC9|APMAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=4007	25.791418333333333	3	1934.964213	1934.969770	R	D	12	30
PSM	MRLEQEIATYR	1512	sp|Q8N1A0|KT222_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	2-UNIMOD:267	ms_run[1]:scan=6201	38.590983333333334	2	1418.715537	1418.721553	K	H	130	141
PSM	QVEEALHQLHAR	1513	sp|O00233|PSMD9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28	ms_run[1]:scan=7233	44.727918333333335	2	1412.7163	1412.7155	K	D	92	104
PSM	CSVPFTPIEFHYENTR	1514	sp|Q9UBU9|NXF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=11209	69.96181666666666	2	1978.8832	1978.8878	K	A	143	159
PSM	QGTPLIAFSLLPHEQK	1515	sp|Q2NL82|TSR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28	ms_run[1]:scan=12534	79.42551333333333	2	1760.9442	1760.9456	R	M	575	591
PSM	RSPGTGAGLAEK	1516	sp|P08034|CXB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=993	8.684278333333333	2	1142.608073	1142.604386	R	S	265	277
PSM	QSGEPFLQDGSCINVAPHLHK	1517	sp|Q7LBC6|KDM3B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28,12-UNIMOD:4,21-UNIMOD:188	ms_run[1]:scan=8429	52.103496666666665	2	2322.1176	2322.1153	K	C	893	914
PSM	LREILEQQQQER	1518	sp|Q9NRM2|ZN277_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=3446	22.558555	2	1568.820797	1568.827068	R	N	155	167
PSM	TTITMAHLLAAR	1519	sp|Q52LJ0|FA98B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=7514	46.41809833333333	2	1298.700024	1297.717641	K	E	264	276
PSM	VLPEFDTPGHTLSWGK	1520	sp|P07686|HEXB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	16-UNIMOD:188	ms_run[1]:scan=9058	56.064176666666675	2	1788.919339	1788.914214	R	G	285	301
PSM	CDLYLLEEGPPVTTVLTR	1521	sp|P29803|ODPAT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:4	ms_run[1]:scan=9491	58.79316	3	2078.111026	2075.060893	K	A	39	57
PSM	AAAAKPNNLSLVVHGPGDLR	1522	sp|Q00796|DHSO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:1	ms_run[2]:scan=7619	47.056	3	2041.1069	2041.1069	M	L	2	22
PSM	AAEAHVDAHYYEQNEQPTGTCAACITGDNR	1523	sp|P55263-3|ADK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	21-UNIMOD:4,24-UNIMOD:4	ms_run[2]:scan=5243	32.928	4	3348.416	3348.4160	K	S	120	150
PSM	ACWVLHYFCEVK	1524	sp|O95373|IPO7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:4,9-UNIMOD:4,12-UNIMOD:188	ms_run[2]:scan=10317	64.074	2	1616.7575	1616.7575	R	F	476	488
PSM	AFFESHPAPSAER	1525	sp|P55786-2|PSA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=4241	27.196	2	1444.6735	1444.6735	K	T	790	803
PSM	AFHNEAQVNPER	1526	sp|P17987|TCPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=1948	13.897	2	1410.664	1410.6640	R	K	469	481
PSM	AFTGREFDELNPSAQR	1527	sp|P16615-5|AT2A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6772	42.005	3	1836.8755	1836.8755	K	D	651	667
PSM	AGVAFFHLQDYDQAR	1528	sp|Q8N5M4|TTC9C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9067	56.121	2	1736.8271	1736.8271	R	H	114	129
PSM	ALRLDVGNFSWGSECCTR	1529	sp|P62241|RS8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	15-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=9777	60.605	3	2126.9626	2126.9626	R	K	57	75
PSM	APFDLFENKK	1530	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7489	46.274	2	1207.6237	1207.6237	R	K	339	349
PSM	AQEALSHTEQSKSELSSR	1531	sp|O75146-2|HIP1R_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=1946	13.885	3	1986.9607	1986.9607	R	L	531	549
PSM	AQPPEAGPQGLHDLGR	1532	sp|A0FGR8-5|ESYT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=4784	30.295	2	1641.8223	1641.8223	K	S	127	143
PSM	AREAAIWELEER	1533	sp|Q9H2G2-2|SLK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:267,12-UNIMOD:267	ms_run[2]:scan=7161	44.305	2	1491.7585	1491.7585	R	H	972	984
PSM	CPPGVVPACHNSK	1534	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:4,9-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=1383	10.763	2	1427.6745	1427.6745	R	D	634	647
PSM	CSVPFTPIEFHYENTR	1535	sp|Q9UBU9-2|NXF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:4	ms_run[2]:scan=9216	57.044	3	1995.9149	1995.9149	K	A	143	159
PSM	CVSSPHFQVAER	1536	sp|Q16537-2|2A5E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:4	ms_run[2]:scan=4171	26.799	2	1415.6616	1415.6616	K	A	351	363
PSM	DIPVVHQLLTR	1537	sp|P30419-2|NMT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:267	ms_run[2]:scan=9109	56.377	2	1299.7538	1299.7538	K	Y	265	276
PSM	DLEIKIPVVVR	1538	sp|Q9P2R7-2|SUCB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9724	60.264	2	1279.7864	1279.7864	K	L	375	386
PSM	ELVTQQLPHLLK	1539	sp|Q99584|S10AD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8240	50.915	2	1417.8293	1417.8293	K	D	40	52
PSM	EQSGTIYLQHADEEREK	1540	sp|P37198|NUP62_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=3555	23.18	2	2031.9498	2031.9498	K	T	416	433
PSM	FAGDKGYLTK	1541	sp|P60903|S10AA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	5-UNIMOD:188,10-UNIMOD:188	ms_run[2]:scan=3026	20.118	2	1110.6112	1110.6112	K	E	19	29
PSM	FCFTPHTEEGCLSER	1542	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=6338	39.403	3	1868.7822	1868.7822	K	A	1117	1132
PSM	FGRVDVAVNCAGIAVASK	1543	sp|Q99714-2|HCD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:4	ms_run[2]:scan=7139	44.177	3	1832.9567	1832.9567	K	T	82	100
PSM	FKAEAPLPSPK	1544	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=4334	27.723	2	1195.7004	1195.7004	K	L	5102	5113
PSM	FKNWDDVLTVDYTR	1545	sp|Q13045-2|FLII_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9621	59.6	3	1770.8577	1770.8577	K	N	780	794
PSM	FMADCPHTIGVEFGTR	1546	sp|P61106|RAB14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	5-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=7445	46.017	3	1846.837	1846.8370	K	I	36	52
PSM	GAEILEVLHSLPAVR	1547	sp|Q15008-3|PSMD6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11858	74.382	2	1602.9093	1602.9093	K	Q	204	219
PSM	GGPNIITLADIVKDPVSR	1548	sp|P68400|CSK21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11376	71.075	3	1864.0418	1864.0418	R	T	90	108
PSM	GGPPFAFVEFEDPRDAEDAVYGR	1549	sp|Q07955-3|SRSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	14-UNIMOD:267,23-UNIMOD:267	ms_run[2]:scan=11678	73.131	3	2560.1774	2560.1774	R	D	52	75
PSM	GGQTHLGLPVFNTVK	1550	sp|P53597|SUCA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8045	49.624	2	1566.8518	1566.8518	K	E	91	106
PSM	GIHPTIISESFQK	1551	sp|P50991-2|TCPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6335	39.389	2	1455.7722	1455.7722	K	A	97	110
PSM	GKFSEGEATLR	1552	sp|P47897-2|SYQ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2878	19.222	2	1193.6041	1193.6041	K	M	382	393
PSM	GLIVYQLENQPSEFRR	1553	sp|P78406|RAE1L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8597	53.15	2	1948.0167	1948.0167	R	I	191	207
PSM	GNDVAFHFNPR	1554	sp|P17931|LEG3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5480	34.286	2	1272.6	1272.6000	R	F	152	163
PSM	GPVREGDVLTLLESER	1555	sp|P62857|RS28_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10054	62.37	3	1768.9319	1768.9319	K	E	48	64
PSM	GTTGTQASFLQLFEGDDHKVEQLDK	1556	sp|P30566-2|PUR8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10896	67.892	2	2763.3352	2763.3352	K	M	200	225
PSM	GVDEVTIVNILTNR	1557	sp|P07355-2|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	14-UNIMOD:267	ms_run[2]:scan=11966	75.136	3	1551.8496	1551.8496	K	S	68	82
PSM	GWDQEPAREQAGGGWR	1558	sp|Q86X29-6|LSR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	8-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=5015	31.612	2	1818.8301	1818.8301	R	A	314	330
PSM	HCPYLDTINR	1559	sp|Q53GS9-3|SNUT2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:4,10-UNIMOD:267	ms_run[2]:scan=4352	27.829	2	1297.6113	1297.6113	R	S	104	114
PSM	HEPLVLFCESCDTLTCR	1560	sp|Q13263-2|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	8-UNIMOD:4,11-UNIMOD:4,16-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=8909	55.133	3	2145.9521	2145.9521	K	D	132	149
PSM	HFIMQVVCEATQCPDTR	1561	sp|Q14974-2|IMB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	8-UNIMOD:4,13-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=8379	51.792	3	2100.9419	2100.9419	R	V	71	88
PSM	HGDLPDIQIK	1562	sp|P78527-2|PRKDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:188	ms_run[2]:scan=5888	36.724	2	1140.6235	1140.6235	R	H	2777	2787
PSM	HGDLPDIQIK	1563	sp|P78527-2|PRKDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5912	36.869	2	1134.6033	1134.6033	R	H	2777	2787
PSM	HGGEDYVFSLLTGYCEPPTGVSLR	1564	sp|P08574|CY1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	15-UNIMOD:4,24-UNIMOD:267	ms_run[2]:scan=12441	78.664	3	2663.2565	2663.2565	R	E	205	229
PSM	HGQALGELAEQLEQAR	1565	sp|Q7Z406|MYH14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	16-UNIMOD:267	ms_run[2]:scan=8883	54.97	2	1758.8888	1758.8888	R	R	1218	1234
PSM	HIYYITGETK	1566	sp|P07900-2|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:188	ms_run[2]:scan=3883	25.061	2	1229.6388	1229.6388	K	D	612	622
PSM	HLYVVVDGSR	1567	sp|Q6P1K8|T2H2L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=4094	26.326	2	1143.6037	1143.6037	R	T	60	70
PSM	HNQLPLVIEFTEQTAPK	1568	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10351	64.292	3	1964.0367	1964.0367	K	I	231	248
PSM	HPQPGAVELAAK	1569	sp|P27708|PYR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:188	ms_run[2]:scan=2526	17.122	2	1222.6765	1222.6765	R	H	2025	2037
PSM	HSQFIGYPITLFVEK	1570	sp|P07900-2|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	15-UNIMOD:188	ms_run[2]:scan=11736	73.537	3	1783.9604	1783.9604	K	E	332	347
PSM	HSTLDFMLGAK	1571	sp|P52788-2|SPSY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	7-UNIMOD:35,11-UNIMOD:188	ms_run[2]:scan=6094	37.957	2	1240.6217	1240.6217	R	A	6	17
PSM	HSTLDFMLGAK	1572	sp|P52788-2|SPSY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:188	ms_run[2]:scan=7728	47.725	2	1224.6268	1224.6268	R	A	6	17
PSM	HTGPITCLQFNPK	1573	sp|Q6UXN9|WDR82_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	7-UNIMOD:4	ms_run[2]:scan=6191	38.53	2	1511.7555	1511.7555	K	F	281	294
PSM	IGDLQAFQGHGAGNLAGLK	1574	sp|P08195-2|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	19-UNIMOD:188	ms_run[2]:scan=7892	48.693	3	1871.9949	1871.9949	R	G	126	145
PSM	IGQGYLIKDGK	1575	sp|P39023|RL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=3839	24.811	2	1190.6659	1190.6659	K	L	287	298
PSM	ISMPDIDFNLKGPK	1576	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=9654	59.813	2	1585.8577	1585.8577	K	V	4385	4399
PSM	ISMPDLDLHLK	1577	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:188	ms_run[2]:scan=9446	58.513	2	1286.7	1286.7000	K	S	2386	2397
PSM	ISMPGFKGEGPDVDVNLPK	1578	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	7-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=9080	56.201	3	2011.0487	2011.0487	K	A	2774	2793
PSM	ITDSAGHILYSKEDATK	1579	sp|P49755|TMEDA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=3707	24.074	3	1859.9668	1859.9668	K	G	76	93
PSM	IVLRLECVEPNCR	1580	sp|Q969Q0|RL36L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	7-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=7002	43.352	2	1656.844	1656.8440	K	S	66	79
PSM	IVSQLLTLMDGLKQR	1581	sp|P55072|TERA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=12050	75.693	2	1713.9811	1713.9811	R	A	324	339
PSM	KLENSPLGEALR	1582	sp|Q9NX40-3|OCAD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5505	34.442	2	1325.7303	1325.7303	K	S	104	116
PSM	KQGGLGPMNIPLVSDPK	1583	sp|Q06830|PRDX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8532	52.749	3	1749.9447	1749.9447	K	R	93	110
PSM	KQPPVSPGTALVGSQK	1584	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=3812	24.661	2	1604.9289	1604.9289	R	E	31	47
PSM	LAQGLTHLGK	1585	sp|Q13200|PSMD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:188	ms_run[2]:scan=3490	22.815	2	1042.6231	1042.6231	R	G	764	774
PSM	LAQGLTHLGK	1586	sp|Q13200|PSMD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=3494	22.84	2	1036.6029	1036.6029	R	G	764	774
PSM	LDYFLLSHSLLPALCDSK	1587	sp|P27695|APEX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	15-UNIMOD:4,18-UNIMOD:188	ms_run[2]:scan=12753	81.298	2	2097.0912	2097.0912	R	I	282	300
PSM	LFNLSKEDDVR	1588	sp|P62753|RS6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5761	35.961	2	1334.683	1334.6830	K	Q	144	155
PSM	LGIHEDSQNR	1589	sp|P07900-2|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:267	ms_run[2]:scan=1251	10.025	2	1177.5715	1177.5715	K	K	569	579
PSM	LGIHEDSQNR	1590	sp|P07900-2|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=1253	10.033	2	1167.5632	1167.5632	K	K	569	579
PSM	LGIHEDSTNR	1591	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=1421	10.979	2	1140.5523	1140.5523	K	R	439	449
PSM	LGIHEDSTNR	1592	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:267	ms_run[2]:scan=1422	10.983	2	1150.5606	1150.5606	K	R	439	449
PSM	LHNAIEGGTQLSR	1593	sp|O60832-2|DKC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=3145	20.805	3	1394.7266	1394.7266	R	A	159	172
PSM	LHNMIVDLDNVVK	1594	sp|Q16891-3|MIC60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	13-UNIMOD:188	ms_run[2]:scan=9125	56.476	3	1514.8222	1514.8222	K	K	299	312
PSM	LHYNEGLNIK	1595	sp|Q6NXS1|IPP2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:188	ms_run[2]:scan=4672	29.655	2	1205.65	1205.6500	K	L	146	156
PSM	LKEAELLEPLMPAIR	1596	sp|P53618|COPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:188,15-UNIMOD:267	ms_run[2]:scan=10859	67.647	2	1738.0034	1734.0152	K	A	127	142
PSM	LKIDFGEAAR	1597	sp|P08754|GNAI3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6146	38.264	2	1118.6084	1118.6084	R	A	91	101
PSM	LKVLATAFDTTLGGR	1598	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8812	54.513	3	1561.8828	1561.8828	K	K	220	235
PSM	LLDSVPPTAISHFK	1599	sp|Q9NR30-2|DDX21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7417	45.848	2	1523.8348	1523.8348	R	Q	514	528
PSM	LLDVDNRVVLPIEAPIR	1600	sp|P00403|COX2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	7-UNIMOD:267,17-UNIMOD:267	ms_run[2]:scan=10529	65.446	3	1951.1369	1951.1369	R	M	135	152
PSM	LLDVVHPAAK	1601	sp|Q99832-3|TCPH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=4144	26.633	2	1061.6233	1061.6233	K	T	24	34
PSM	LLEVQGSRPGK	1602	sp|P62136|PP1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2379	16.281	2	1182.6721	1182.6721	R	N	16	27
PSM	LRLECADLLETR	1603	sp|Q6PI48|SYDM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:267,5-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=7560	46.684	2	1507.7931	1507.7932	K	G	455	467
PSM	LRPAAAPLEELTMGTSCLPDTFTK	1604	sp|Q12789-3|TF3C1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	17-UNIMOD:4	ms_run[2]:scan=11358	70.959	3	2618.3084	2618.3084	R	L	1688	1712
PSM	LRQLAEEDLAQQR	1605	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:267,13-UNIMOD:267	ms_run[2]:scan=4420	28.199	3	1588.8436	1588.8436	R	A	2261	2274
PSM	LTGMAFRVPTANVSVVDLTCR	1606	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	7-UNIMOD:267,20-UNIMOD:4,21-UNIMOD:267	ms_run[2]:scan=10646	66.208	3	2326.204	2326.2040	K	L	228	249
PSM	MFDYTDDPEGPVMPGSHSVER	1607	sp|Q09161|NCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:35,21-UNIMOD:267	ms_run[2]:scan=6780	42.053	3	2391.0023	2391.0023	R	F	291	312
PSM	MGIVGPEFKDK	1608	sp|Q15149-7|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	9-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=5310	33.318	2	1231.6674	1231.6674	R	L	3961	3972
PSM	MGLGHEQGFGAPCLK	1609	sp|Q9UGI8-2|TES_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:35,13-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=5560	34.774	2	1622.7641	1622.7641	-	C	1	16
PSM	MKLDYILGLK	1610	sp|P46781|RS9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9627	59.639	2	1192.689	1192.6890	K	I	92	102
PSM	MLAVHFDKPGGPENLYVK	1611	sp|Q53FA7-2|QORX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:1	ms_run[2]:scan=10004	62.046	3	2056.0452	2056.0452	-	E	1	19
PSM	MQHNLEQQIQAR	1612	sp|Q13813-3|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:267	ms_run[2]:scan=3676	23.896	2	1504.7444	1504.7444	R	N	2284	2296
PSM	MQHNLEQQIQAR	1613	sp|Q13813-3|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=3678	23.907	2	1494.7361	1494.7361	R	N	2284	2296
PSM	MQQHFEFEYQTK	1614	sp|P08243-3|ASNS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:35,12-UNIMOD:188	ms_run[2]:scan=5269	33.086	2	1636.7287	1636.7287	-	V	1	13
PSM	MREEVITLIR	1615	sp|P46940|IQGA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:35,2-UNIMOD:267,10-UNIMOD:267	ms_run[2]:scan=6259	38.944	2	1294.7182	1294.7182	K	S	892	902
PSM	MVNHFIAEFK	1616	sp|P11142-2|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:188	ms_run[2]:scan=6902	42.766	2	1240.637	1240.6370	R	R	237	247
PSM	MVNHFIAEFK	1617	sp|P11142-2|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6903	42.77	2	1234.6169	1234.6169	R	R	237	247
PSM	NCPHVVVGTPGR	1618	sp|O00148|DX39A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=2377	16.272	2	1301.6538	1301.6538	K	I	163	175
PSM	NEVSFVIHNLPVLAK	1619	sp|P49903-3|SPS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	15-UNIMOD:188	ms_run[2]:scan=11256	70.272	2	1684.9608	1684.9608	R	M	217	232
PSM	NFYQEHPDLAR	1620	sp|P17844-2|DDX5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=4662	29.6	2	1388.6473	1388.6473	K	R	57	68
PSM	NPEVGLKPVWYSPK	1621	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	7-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=7383	45.637	2	1624.9016	1624.9016	K	V	536	550
PSM	NTLTNIAMRPGLEGYALPR	1622	sp|P33992|MCM5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9516	58.946	2	2086.0993	2086.0993	R	K	177	196
PSM	QLLNCLHVVTLYNR	1623	sp|P11216|PYGB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	5-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=9298	57.573	2	1751.938	1751.9380	R	I	577	591
PSM	QRGDQLVPFSTK	1624	sp|Q9BTV4|TMM43_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5332	33.429	2	1374.7256	1374.7256	R	S	267	279
PSM	RAEFTVETR	1625	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:267,9-UNIMOD:267	ms_run[2]:scan=2564	17.33	2	1127.5838	1127.5838	K	S	301	310
PSM	RAPDQAAEIGSR	1626	sp|Q3ZCQ8-2|TIM50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:267,12-UNIMOD:267	ms_run[2]:scan=1469	11.239	2	1289.6591	1289.6591	R	G	135	147
PSM	REAPVDVLTQIGR	1627	sp|Q9BVC6|TM109_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7648	47.236	2	1452.8049	1452.8049	K	S	47	60
PSM	RGDINLLMLGDPGTAK	1628	sp|P33992|MCM5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	8-UNIMOD:35	ms_run[2]:scan=7962	49.101	2	1685.8771	1685.8771	R	S	372	388
PSM	RGDINLLMLGDPGTAK	1629	sp|P33992|MCM5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8979	55.571	2	1669.8821	1669.8821	R	S	372	388
PSM	RGPCIIYNEDNGIIK	1630	sp|P36578|RL4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	4-UNIMOD:4	ms_run[2]:scan=6596	40.96	3	1760.888	1760.8880	R	A	205	220
PSM	RISGLIYEETR	1631	sp|P62805|H4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5284	33.173	2	1335.7147	1335.7147	K	G	46	57
PSM	RLQTSSVLVSGLR	1632	sp|P22314-2|UBA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:267,13-UNIMOD:267	ms_run[2]:scan=6193	38.541	2	1434.8421	1434.8421	K	G	29	42
PSM	RPDQQLQGEGK	1633	sp|Q8NC51-4|PAIRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=803	7.6871	2	1254.6317	1254.6317	R	I	112	123
PSM	RPTEICADPQFIIGGATR	1634	sp|P17655|CAN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:267,6-UNIMOD:4,18-UNIMOD:267	ms_run[2]:scan=7955	49.061	3	2021.0267	2021.0267	K	T	77	95
PSM	RQLDSIVGER	1635	sp|P13647|K2C5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:267	ms_run[2]:scan=3780	24.471	2	1181.6392	1181.6392	R	G	228	238
PSM	RQLETLGQEK	1636	sp|P05787|K2C8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=1970	14.03	2	1200.6463	1200.6463	R	L	149	159
PSM	RWYPEEYEFAPK	1637	sp|Q9Y3B8-2|ORN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7419	45.859	2	1613.7514	1613.7514	R	K	140	152
PSM	SAQPLPLKIEELALAK	1638	sp|Q9UKV3-5|ACINU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	8-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=10689	66.474	2	1732.0537	1732.0537	R	G	525	541
PSM	SIFYVPDMKPSMFDVSR	1639	sp|Q12931-2|TRAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11401	71.238	3	2017.9642	2017.9642	R	E	288	305
PSM	SIGTANRPMGAGEALR	1640	sp|Q12906-5|ILF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=4109	26.42	2	1599.8151	1599.8151	K	R	258	274
PSM	SKFENEEFFR	1641	sp|Q13951|PEBB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6083	37.892	2	1331.6146	1331.6146	R	K	10	20
PSM	SKGVFVQSVLPYFVATK	1642	sp|Q53GQ0|DHB12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11116	69.35	3	1869.04	1869.0400	R	L	222	239
PSM	SLLDQLKDVFSK	1643	sp|Q14CX7-2|NAA25_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	7-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=12652	80.446	2	1403.8063	1403.8063	K	C	807	819
PSM	SQLLSYIDRLAPR	1644	sp|P33993|MCM7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10436	64.843	2	1530.8518	1530.8518	K	S	388	401
PSM	SRSGEGEVSGLMR	1645	sp|Q13263-2|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=3810	24.651	2	1363.6514	1363.6514	R	K	389	402
PSM	SSFDEMLPGTHFQR	1646	sp|Q02218-2|ODO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7925	48.878	2	1650.746	1650.7460	R	V	866	880
PSM	SSFFIEPQKPVFPETR	1647	sp|Q96JM3|CHAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9099	56.314	3	1907.9781	1907.9781	K	K	482	498
PSM	STGLILDSGATHTTAIPVHDGYVLQQGIVK	1648	sp|O96019-2|ACL6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	30-UNIMOD:188	ms_run[2]:scan=9336	57.82	4	3096.6551	3096.6551	R	S	123	153
PSM	SVFALTNGIYPHK	1649	sp|Q02878|RL6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	13-UNIMOD:188	ms_run[2]:scan=8369	51.73	2	1451.7868	1451.7868	R	L	273	286
PSM	SYSKLLCGLLAER	1650	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	4-UNIMOD:188,7-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=9920	61.515	2	1524.8305	1520.8424	R	L	75	88
PSM	TFGETHPFTK	1651	sp|P09960-3|LKHA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=3703	24.055	2	1163.5611	1163.5611	K	L	332	342
PSM	TGPFAEHSNQLWNISAVPSWSK	1652	sp|Q15257-4|PTPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10937	68.167	2	2455.1921	2455.1921	K	V	223	245
PSM	TGSAVAPVHPPNR	1653	sp|Q8IZL8|PELP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2119	14.842	2	1301.684	1301.6840	R	S	49	62
PSM	THSDQFLVAFK	1654	sp|P36542-2|ATPG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7292	45.091	2	1291.6561	1291.6561	R	E	144	155
PSM	TINVYPNFRPTPK	1655	sp|O95168-2|NDUB4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6299	39.19	2	1545.8304	1545.8304	R	N	73	86
PSM	TKDGQILPVPNVVVR	1656	sp|Q9P258|RCC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7857	48.495	2	1633.9515	1633.9515	K	D	319	334
PSM	TKGVDEVTIVNILTNR	1657	sp|P07355-2|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10677	66.398	3	1770.984	1770.9840	K	S	66	82
PSM	TLEGELHDLR	1658	sp|P02545-5|LMNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:267	ms_run[2]:scan=6248	38.877	2	1191.6123	1191.6123	R	G	58	68
PSM	TLNQQLTNHIR	1659	sp|P50570-3|DYN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=4263	27.311	2	1336.7211	1336.7211	K	E	280	291
PSM	TLNQQLTNHIR	1660	sp|P50570-3|DYN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:267	ms_run[2]:scan=4274	27.37	2	1346.7294	1346.7294	K	E	280	291
PSM	TLVAHYPPVQVLFEK	1661	sp|P52701-4|MSH6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10079	62.519	2	1739.961	1739.9610	R	G	282	297
PSM	TQDECILHFLR	1662	sp|Q8TAQ2-2|SMRC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	5-UNIMOD:4,11-UNIMOD:267	ms_run[2]:scan=9076	56.175	2	1440.7059	1440.7059	R	L	662	673
PSM	TQDECILHFLR	1663	sp|Q8TAQ2-2|SMRC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	5-UNIMOD:4	ms_run[2]:scan=9079	56.195	2	1430.6976	1430.6976	R	L	662	673
PSM	TQEQCVHNETKNELEK	1664	sp|O60313-13|OPA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	5-UNIMOD:4,11-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=1520	11.508	3	1997.9515	1997.9515	R	M	746	762
PSM	TQNDVDIADVAYYFEK	1665	sp|P16422|EPCAM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	16-UNIMOD:188	ms_run[2]:scan=11884	74.563	2	1895.8885	1895.8885	K	D	203	219
PSM	VAIVKPGVPMEIVLNK	1666	sp|Q9Y4L1|HYOU1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9116	56.421	3	1706.0164	1706.0164	K	E	47	63
PSM	VRVELSTGMPR	1667	sp|Q16629-3|SRSF7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:267,11-UNIMOD:267	ms_run[2]:scan=5062	31.886	2	1263.6872	1263.6872	R	R	77	88
PSM	VTIAQGGVLPNIQAVLLPKK	1668	sp|Q99878|H2A1J_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11564	72.335	2	2058.2565	2058.2565	K	T	101	121
PSM	VWDLFPEADKVR	1669	sp|Q99613-2|EIF3C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9899	61.382	2	1473.7616	1473.7616	K	T	755	767
PSM	VYFQSPPGAAGEGPGGADDEGPVRR	1670	sp|Q96C90|PP14B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5880	36.674	2	2485.1622	2485.1622	R	Q	28	53
PSM	YFAGWADKIQGK	1671	sp|P47895|AL1A3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	8-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=6956	43.085	2	1394.7385	1394.7385	R	T	143	155
PSM	YFLNHIDQTTTWQDPR	1672	sp|P46937-4|YAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8061	49.726	2	2033.9595	2033.9595	R	K	10	26
PSM	YGGSVGSQPPPVAPEPGPVPSSPSQEPPTKR	1673	sp|Q04323|UBXN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5496	34.386	2	3082.536	3082.5360	K	E	179	210
PSM	YNEQHVPGSPFTAR	1674	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	14-UNIMOD:267	ms_run[2]:scan=4870	30.79	3	1611.7669	1611.7669	K	V	1930	1944
PSM	QLREYQELMNVK	1675	sp|P05787|K2C8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28,3-UNIMOD:267,12-UNIMOD:188	ms_run[1]:scan=9699	60.103046666666664	2	1549.7982	1548.7932	R	L	370	382
PSM	QLYVLGHEAMKR	1676	sp|P22314|UBA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28,11-UNIMOD:188,12-UNIMOD:267	ms_run[1]:scan=7343	45.39619166666667	2	1442.7651	1442.7670	R	L	58	70
PSM	QSVENDIHGLRK	1677	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28	ms_run[1]:scan=4725	29.950625	2	1377.6994	1377.6996	R	V	176	188
PSM	QGSGSSQPMEVQEGYGFGSGDDPYSSAEPHVSGVKR	1678	sp|Q13263|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28,35-UNIMOD:188,36-UNIMOD:267	ms_run[1]:scan=7745	47.82329333333333	3	3711.6363	3711.6349	K	S	435	471
PSM	TEELNREVAGHTEQLQMSR	1679	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=5133	32.295595	2	2227.067892	2227.065143	R	S	275	294
PSM	SRLEQEIATYR	1680	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	2-UNIMOD:267,11-UNIMOD:267	ms_run[1]:scan=5591	34.963926666666666	2	1384.720449	1384.721366	K	S	371	382
PSM	VADRLGLELGK	1681	sp|P11908|PRPS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	4-UNIMOD:267,11-UNIMOD:188	ms_run[1]:scan=5677	35.454346666666666	2	1185.707463	1185.705220	R	V	19	30
PSM	LVNHFVEEFK	1682	sp|P0DMV8|HS71A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=6539	40.62727666666667	2	1261.655611	1260.650273	R	R	237	247
PSM	SGYLAGDKLLPQR	1683	sp|P26038|MOES_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=6243	38.84621	2	1416.779383	1416.772514	K	V	144	157
PSM	CHAIIDEQPLIFK	1684	sp|P48059-3|LIMS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=10339	64.21787833333333	2	1565.8152	1565.7902	K	N	200	213
PSM	SVTLGYLFSQGHLTR	1685	sp|P55265|DSRAD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=9993	61.975546666666666	3	1678.887534	1677.883855	K	A	1064	1079
PSM	VRVELSTGMPR	1686	sp|Q16629|SRSF7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=5064	31.895055	2	1243.670268	1243.670691	R	R	77	88
PSM	SGHELGMTPLQELSLR	1687	sp|Q9Y6D5|BIG2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	16-UNIMOD:267	ms_run[1]:scan=9454	58.56356166666667	3	1778.922678	1776.906788	R	K	545	561
PSM	QLPSAGPDKNLVTGDHIPTPQDLPQR	1688	sp|O43768|ENSA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28,9-UNIMOD:188,26-UNIMOD:267	ms_run[1]:scan=8821	54.568828333333336	3	2792.4446	2792.4423	K	K	81	107
PSM	RLPTEEEWEFAAR	1689	sp|Q8NBJ7|SUMF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=7528	46.49474166666667	2	1632.789608	1632.789620	K	G	162	175
PSM	QDFVQHFSQIVR	1690	sp|P14324|FPPS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28,12-UNIMOD:267	ms_run[1]:scan=10507	65.30034666666667	2	1495.7476	1495.7442	K	V	81	93
PSM	INREQFWEQAK	1691	sp|Q16643|DREB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:267,11-UNIMOD:188	ms_run[1]:scan=5184	32.587415	2	1464.725273	1463.749210	R	K	175	186
PSM	LGGSPFGPAGTGKTESVK	1692	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	13-UNIMOD:188,18-UNIMOD:188	ms_run[1]:scan=4649	29.521656666666665	2	1700.915045	1700.913608	R	A	1900	1918
PSM	ASTPDWVSEGPQPGLRR	1693	sp|Q8IVT2|MISP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	16-UNIMOD:267,17-UNIMOD:267	ms_run[1]:scan=6274	39.036591666666666	2	1872.942051	1871.939298	R	A	375	392
PSM	LLLASFKNEGAEPDLIR	1694	sp|Q9UNK0|STX8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	7-UNIMOD:188,17-UNIMOD:267	ms_run[1]:scan=9436	58.45083	3	1902.078501	1901.059311	R	S	92	109
PSM	VQADVPPEILNNVGALHFR	1695	sp|Q6PD62|CTR9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	19-UNIMOD:267	ms_run[1]:scan=10773	67.07594166666667	2	2099.118287	2098.119892	K	L	445	464
PSM	LFGERDAGALGGAEDSLLASPAGTR	1696	sp|P78367|NKX32_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=3528	23.03113666666667	3	2430.186126	2430.213916	R	T	54	79
PSM	AAAGGLAMLTSMRPTLCSR	1697	sp|Q9H3U1-3|UN45A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	13-UNIMOD:267,17-UNIMOD:4,19-UNIMOD:267	ms_run[2]:scan=9926	61.549	3	1982.9967	1982.9967	R	I	115	134
PSM	AGLVGPEFHEK	1698	sp|Q15149-7|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4432	28.262	2	1182.6033	1182.6033	R	L	3052	3063
PSM	AGVLAHLEEER	1699	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5331	33.425	2	1222.6306	1222.6306	R	D	765	776
PSM	AIDLFTDAIKLNPR	1700	sp|Q8IZP2|ST134_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10586	65.821	3	1585.8828	1585.8828	K	L	129	143
PSM	ALDMSYDHKPEDEVELAR	1701	sp|O15355|PPM1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6255	38.921	3	2116.9735	2116.9735	K	I	359	377
PSM	ALIEVLQPLIAEHQAR	1702	sp|P23381-2|SYWC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	16-UNIMOD:267	ms_run[2]:scan=11008	68.635	3	1810.034	1810.0340	K	R	392	408
PSM	ALIEVLQPLIAEHQAR	1703	sp|P23381-2|SYWC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11015	68.681	3	1800.0258	1800.0258	K	R	392	408
PSM	ALVSHNGSLINVGSLLQR	1704	sp|Q8N163-2|CCAR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	18-UNIMOD:267	ms_run[2]:scan=9787	60.669	3	1887.0566	1887.0566	K	A	801	819
PSM	ASPNTPPGRVDENGPELLPR	1705	sp|Q92616|GCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6041	37.643	3	2115.0709	2115.0709	R	V	1018	1038
PSM	AVTEQGHELSNEERNLLSVAYK	1706	sp|P31946-2|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	14-UNIMOD:267,22-UNIMOD:188	ms_run[2]:scan=8434	52.134	2	2502.2685	2498.2804	K	N	28	50
PSM	CPNLTHLNLSGNK	1707	sp|P39687|AN32A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=5265	33.064	2	1472.7501	1472.7501	K	I	87	100
PSM	CQHAAEIITDLLR	1708	sp|Q96AE4|FUBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:4	ms_run[2]:scan=10178	63.177	3	1538.7875	1538.7875	R	S	332	345
PSM	CQHAAEIITDLLR	1709	sp|Q96AE4|FUBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=10179	63.183	3	1548.7958	1548.7958	R	S	332	345
PSM	CQNEQLQTAVTQQVSQIQQHKDQYNLLK	1710	sp|O60763|USO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:4	ms_run[2]:scan=9629	59.65	3	3369.6736	3369.6736	K	I	678	706
PSM	CSVPFTPIEFHYENTR	1711	sp|Q9UBU9-2|NXF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=9215	57.038	3	2005.9232	2005.9232	K	A	143	159
PSM	DALLVGVPAGSNPFREPR	1712	sp|P50151|GBG10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	15-UNIMOD:267,18-UNIMOD:267	ms_run[2]:scan=9174	56.779	2	1914.0226	1914.0226	K	S	46	64
PSM	EAEKLESEHPDQAQAILSR	1713	sp|Q01082-3|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4920	31.06	3	2150.0604	2150.0604	K	L	1005	1024
PSM	EETPGQRPAVTETHQLAELNEK	1714	sp|Q9UQ35-3|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4981	31.414	3	2476.2194	2476.2194	K	K	13	35
PSM	FANYIDKVR	1715	sp|P08670|VIME_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4916	31.042	2	1124.5978	1124.5978	R	F	114	123
PSM	FGVAPDHPEVK	1716	sp|P22570-4|ADRO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:188	ms_run[2]:scan=3607	23.491	2	1200.6235	1200.6235	R	N	28	39
PSM	FGVEQDRMDK	1717	sp|Q14247-3|SRC8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2947	19.643	2	1223.5605	1223.5605	K	S	88	98
PSM	FGVQTDRQDK	1718	sp|Q14247-3|SRC8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=1413	10.933	2	1192.5836	1192.5836	K	C	236	246
PSM	FLIVAHDDGR	1719	sp|Q16658|FSCN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4693	29.768	2	1141.588	1141.5880	R	W	91	101
PSM	FLNAENAQKFK	1720	sp|P43487-2|RANG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=4372	27.934	2	1320.7229	1320.7229	R	T	142	153
PSM	FTGLSKEELLK	1721	sp|P08195-2|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	6-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=6257	38.933	2	1275.7477	1275.7477	K	V	60	71
PSM	FTGLSKEELLK	1722	sp|P08195-2|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6258	38.938	2	1263.7075	1263.7075	K	V	60	71
PSM	GAFGKPQGTVAR	1723	sp|Q96L21|RL10L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=1833	13.254	2	1187.6411	1187.6411	R	V	117	129
PSM	GGGHVAQIYAIR	1724	sp|P62249|RS16_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4519	28.773	2	1240.6677	1240.6677	K	Q	74	86
PSM	GGPPFAFVEFEDPRDAEDAVYGR	1725	sp|Q07955-3|SRSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11539	72.161	3	2540.1608	2540.1608	R	D	52	75
PSM	GGPPFAFVEFEDPRDAEDAVYGR	1726	sp|Q07955-3|SRSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11686	73.187	3	2540.1608	2540.1608	R	D	52	75
PSM	GIEELFLDLCKR	1727	sp|Q9UL25|RAB21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:4	ms_run[2]:scan=11997	75.339	2	1491.7755	1491.7756	K	M	168	180
PSM	GIHPTIISESFQK	1728	sp|P50991-2|TCPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6362	39.546	3	1455.7722	1455.7722	K	A	97	110
PSM	GLGTDEDSLIEIICSR	1729	sp|P07355-2|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	14-UNIMOD:4	ms_run[2]:scan=12044	75.651	2	1776.8564	1776.8564	K	T	138	154
PSM	GLKTVFDEAIR	1730	sp|P63000|RAC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7461	46.108	2	1247.6874	1247.6874	R	A	164	175
PSM	GLVDKIMVDR	1731	sp|Q15149-7|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6716	41.672	2	1144.6274	1144.6274	K	I	4307	4317
PSM	GNAMVEEGHFAAEDVKAK	1732	sp|Q13813-3|SPTN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	16-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=4772	30.224	3	1913.9344	1913.9344	K	L	847	865
PSM	GNQLQEFAAMLMPHQK	1733	sp|Q9BT78-2|CSN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	16-UNIMOD:188	ms_run[2]:scan=12514	79.265	2	1847.9118	1847.9118	R	A	275	291
PSM	GTADVTHDLQEMKEESR	1734	sp|P11166|GTR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:35,13-UNIMOD:188,17-UNIMOD:267	ms_run[2]:scan=3197	21.099	2	1976.908	1972.9199	R	Q	233	250
PSM	GVCHIPMAEPFCPK	1735	sp|Q13126-7|MTAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=6977	43.209	2	1641.7466	1641.7466	R	T	134	148
PSM	HFIMQVVCEATQCPDTR	1736	sp|Q14974-2|IMB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	8-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=8335	51.515	3	2090.9336	2090.9336	R	V	71	88
PSM	HIYYITGETK	1737	sp|P07900-2|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=3886	25.076	2	1223.6186	1223.6186	K	D	612	622
PSM	HLAQVGDSMDR	1738	sp|P55957|BID_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:267	ms_run[2]:scan=2262	15.593	2	1237.5749	1237.5749	R	S	89	100
PSM	HLVSPEALDLLDK	1739	sp|P19784|CSK22_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	13-UNIMOD:188	ms_run[2]:scan=8958	55.435	2	1454.8076	1454.8076	R	L	292	305
PSM	HPDIEAQER	1740	sp|P48449|ERG7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:267	ms_run[2]:scan=1114	9.324	2	1103.5235	1103.5235	R	G	664	673
PSM	HPDIEAQER	1741	sp|P48449|ERG7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=1125	9.3811	2	1093.5152	1093.5152	R	G	664	673
PSM	HQGVMVGMGQK	1742	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:188	ms_run[2]:scan=2617	17.623	2	1176.5839	1176.5839	R	D	40	51
PSM	HSFGPLDYESLQQELALK	1743	sp|O94925-3|GLSK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	18-UNIMOD:188	ms_run[2]:scan=11217	70.016	3	2080.0572	2080.0572	R	E	551	569
PSM	HSQFLGYPITLYLEK	1744	sp|Q58FF8|H90B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11152	69.589	3	1807.9509	1807.9509	K	E	127	142
PSM	HSTLDFMLGAK	1745	sp|P52788-2|SPSY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	7-UNIMOD:35	ms_run[2]:scan=6087	37.914	2	1234.6016	1234.6016	R	A	6	17
PSM	HTYLPLEVCNIVAGQR	1746	sp|Q9HCK5|AGO4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=9611	59.536	3	1878.965	1878.9650	K	C	326	342
PSM	HTYLPLEVCNIVAGQR	1747	sp|Q9HCK5|AGO4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=9624	59.622	3	1878.965	1878.9650	K	C	326	342
PSM	HVTQEFVSR	1748	sp|P16144-4|ITB4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:267	ms_run[2]:scan=1979	14.08	2	1111.565	1111.5650	R	T	1718	1727
PSM	HVTQEFVSR	1749	sp|P16144-4|ITB4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=1981	14.088	2	1101.5567	1101.5567	R	T	1718	1727
PSM	HVVPNEVVVQR	1750	sp|P06396-2|GELS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:267	ms_run[2]:scan=3382	22.18	2	1284.7178	1284.7178	K	L	127	138
PSM	ICHQIEYYFGDFNLPR	1751	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=11108	69.297	3	2080.9704	2080.9705	K	D	17	33
PSM	ICHQIEYYFGDFNLPR	1752	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:4	ms_run[2]:scan=11109	69.303	3	2070.9622	2070.9622	K	D	17	33
PSM	IEINFPAEYPFKPPK	1753	sp|P68036-2|UB2L3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=10230	63.511	2	1800.9853	1800.9853	R	I	21	36
PSM	IGEHTPSALAIMENANVLAR	1754	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	20-UNIMOD:267	ms_run[2]:scan=10785	67.156	3	2116.0974	2116.0974	K	Y	154	174
PSM	IGEHTPSALAIMENANVLAR	1755	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10786	67.161	3	2106.0892	2106.0892	K	Y	154	174
PSM	IHNADVTLR	1756	sp|Q9Y295|DRG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:267	ms_run[2]:scan=2159	15.05	2	1047.5701	1047.5701	K	S	214	223
PSM	IHPTSVISGYR	1757	sp|P17987|TCPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4575	29.105	2	1228.6564	1228.6564	K	L	112	123
PSM	IIDPLPPIDHSEIDYPPFEK	1758	sp|Q86XP3-2|DDX42_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10951	68.261	3	2334.1784	2334.1784	K	N	77	97
PSM	IIDPLPPIDHSEIDYPPFEK	1759	sp|Q86XP3-2|DDX42_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10967	68.363	2	2334.1784	2334.1784	K	N	77	97
PSM	IKIGDPLLEDTR	1760	sp|P49189-2|AL9A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7453	46.063	2	1368.7613	1368.7613	R	M	245	257
PSM	ILHCLGLAEEIQK	1761	sp|P53004|BIEA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	4-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=7007	43.379	3	1528.8379	1528.8379	R	Y	278	291
PSM	IREGMAALQSDPWQQELYR	1762	sp|P49748-2|ACADV_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9319	57.71	3	2290.1165	2290.1165	R	N	592	611
PSM	IRSNAEDTLR	1763	sp|Q15149-7|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:267,10-UNIMOD:267	ms_run[2]:scan=1493	11.367	2	1193.6267	1193.6267	R	S	1919	1929
PSM	IRTDENGLCPACR	1764	sp|O95628-5|CNOT4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=2843	19.011	2	1560.7137	1560.7137	R	K	45	58
PSM	ISMPDVNLNLKGPK	1765	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=8112	50.08	2	1536.8737	1536.8737	K	V	2184	2198
PSM	ITQDIFQQLLKR	1766	sp|P56192|SYMC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10428	64.79	2	1501.8617	1501.8617	K	G	365	377
PSM	KGPPLGGGEGEAESADTMPFVMLTR	1767	sp|Q9HAU5|RENT2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10710	66.622	3	2546.2145	2546.2145	R	K	1152	1177
PSM	KLGEMWSEQSAK	1768	sp|P26583|HMGB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	5-UNIMOD:35	ms_run[2]:scan=3077	20.409	2	1408.6657	1408.6657	K	D	128	140
PSM	KLPGFPTQDDEVMMLTER	1769	sp|Q9H0S4|DDX47_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10187	63.234	3	2106.0126	2106.0126	K	V	385	403
PSM	KLSVACFYGGTPYGGQFER	1770	sp|Q9NR30-2|DDX21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:188,6-UNIMOD:4,19-UNIMOD:267	ms_run[2]:scan=8667	53.586	2	2152.0383	2148.0501	K	M	218	237
PSM	KLTFLYLANDVIQNSK	1771	sp|Q9NQG5|RPR1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=11746	73.605	3	1878.0654	1878.0654	R	R	56	72
PSM	KPELWSDNFTDFVK	1772	sp|Q13043|STK4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10460	65	3	1724.841	1724.8410	R	Q	246	260
PSM	LAQAHPAGPPTLDPVNDLQLK	1773	sp|Q15477|SKIV2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=8499	52.538	3	2194.1746	2194.1746	R	D	971	992
PSM	LFDYFPKPYPNSEAAR	1774	sp|P08574|CY1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=8568	52.976	3	1913.9312	1913.9312	K	A	171	187
PSM	LGIEGLSLHNVLK	1775	sp|Q9NYU2-2|UGGG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9799	60.742	2	1391.8136	1391.8136	R	L	403	416
PSM	LHPELSGPGVAAK	1776	sp|Q6DD87|ZN787_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	13-UNIMOD:188	ms_run[2]:scan=3752	24.319	2	1280.7184	1280.7184	R	V	199	212
PSM	LHVGNISPTCTNK	1777	sp|Q9BWF3-3|RBM4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:4	ms_run[2]:scan=3595	23.423	2	1439.7191	1439.7191	K	E	80	93
PSM	LKDLEALLNSK	1778	sp|P02545-5|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=8007	49.381	2	1254.7586	1254.7586	R	E	35	46
PSM	LKEAELLEPLMPAIR	1779	sp|P53618|COPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10856	67.625	3	1721.975	1721.9750	K	A	127	142
PSM	LKEGDTIIVPGVEGPIVTQIR	1780	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9991	61.964	3	2233.2682	2233.2682	R	G	882	903
PSM	LKELIFQETAR	1781	sp|P27361-2|MK03_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6383	39.672	2	1346.7558	1346.7558	R	F	316	327
PSM	LKVPEWVDTVK	1782	sp|P39019|RS19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=7851	48.46	3	1324.7793	1324.7793	K	L	28	39
PSM	LLELLPGKVLNGEK	1783	sp|Q8N684-2|CPSF7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	8-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=9137	56.543	2	1533.9533	1533.9533	K	V	141	155
PSM	LLHPSPDLVSQEATLSEAR	1784	sp|Q8IY22-3|CMIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7602	46.948	3	2062.0695	2062.0695	R	L	220	239
PSM	LLLETHLPSK	1785	sp|O00567|NOP56_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:188	ms_run[2]:scan=6080	37.871	2	1155.6959	1155.6959	R	K	78	88
PSM	LLSRPQDVLEGVVLSPSLEAR	1786	sp|Q5T9A4|ATD3B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11128	69.427	3	2277.2692	2277.2692	R	V	307	328
PSM	LQDREWLTELFQQSK	1787	sp|P78344-2|IF4G2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11345	70.868	2	1919.9741	1919.9741	K	V	646	661
PSM	LQLPVWEYKDR	1788	sp|O43143|DHX15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=8261	51.049	2	1445.7667	1445.7667	R	F	135	146
PSM	LRDLEDSLAR	1789	sp|P02545-5|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:267,10-UNIMOD:267	ms_run[2]:scan=4923	31.079	2	1206.6471	1206.6471	K	E	221	231
PSM	LREAIAELER	1790	sp|Q15149-7|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:267,10-UNIMOD:267	ms_run[2]:scan=4928	31.1	2	1218.6835	1218.6835	R	E	2416	2426
PSM	LRQLAEEDLAQQR	1791	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4434	28.271	3	1568.8271	1568.8271	R	A	2261	2274
PSM	LVEVNGENVEKETHQQVVSR	1792	sp|O14745|NHRF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4987	31.453	3	2293.1662	2293.1662	R	I	59	79
PSM	LYQQHGAGLFDVTR	1793	sp|O14773-2|TPP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6707	41.617	3	1603.8107	1603.8107	R	G	264	278
PSM	MEGSGEQPGPQPQHPGDHR	1794	sp|Q9UJA5-3|TRM6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:1	ms_run[2]:scan=2607	17.562	3	2081.8973	2081.8973	-	I	1	20
PSM	MLAPEGALNIHEK	1795	sp|Q00169|PIPNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:35,13-UNIMOD:188	ms_run[2]:scan=5099	32.09	2	1443.7487	1443.7487	R	A	74	87
PSM	MRYVASYLLAALGGNSSPSAK	1796	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11781	73.844	3	2155.1096	2155.1096	-	D	1	22
PSM	MVVPGLDGAQIPRDPSQQELPR	1797	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:35,13-UNIMOD:267,22-UNIMOD:267	ms_run[2]:scan=7585	46.843	3	2438.2491	2438.2491	K	L	1159	1181
PSM	NCPHVVVGTPGR	1798	sp|O00148|DX39A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=2408	16.445	3	1301.6538	1301.6538	K	I	163	175
PSM	NCPHVVVGTPGR	1799	sp|O00148|DX39A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:4	ms_run[2]:scan=2390	16.344	2	1291.6455	1291.6455	K	I	163	175
PSM	NFFTRYDYEEVEAEGANK	1800	sp|P36871-2|PGM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	5-UNIMOD:267,18-UNIMOD:188	ms_run[2]:scan=8029	49.513	2	2196.9935	2193.0053	R	M	441	459
PSM	NFYQEHPDLAR	1801	sp|P17844-2|DDX5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:267	ms_run[2]:scan=4663	29.605	2	1398.6556	1398.6556	K	R	57	68
PSM	NGHVGISFVPK	1802	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:188	ms_run[2]:scan=5202	32.691	2	1159.6445	1159.6445	R	E	1996	2007
PSM	NGLSLAALKK	1803	sp|P16401|H15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5315	33.344	2	1013.6233	1013.6233	R	A	58	68
PSM	NKLQQLPADFGR	1804	sp|Q96AG4|LRC59_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5870	36.62	2	1385.7415	1385.7415	K	L	72	84
PSM	NLGVVVAPHTLK	1805	sp|Q9BYD2|RM09_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5359	33.582	2	1246.7398	1246.7398	K	L	196	208
PSM	NLRDIDEVSSLLR	1806	sp|P50990|TCPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:267,13-UNIMOD:267	ms_run[2]:scan=9534	59.056	3	1548.8375	1548.8375	K	T	153	166
PSM	NLRDIDEVSSLLR	1807	sp|P50990|TCPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9528	59.017	3	1528.8209	1528.8209	K	T	153	166
PSM	NRLEEVSPNLVR	1808	sp|P28331-3|NDUS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5227	32.834	2	1424.7736	1424.7736	R	Y	533	545
PSM	NRLENDGATALAEAFR	1809	sp|P46060|RAGP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=8685	53.697	3	1746.8649	1746.8649	R	V	190	206
PSM	NVDPFHIYFCNLK	1810	sp|Q7L0Y3|TM10C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:4	ms_run[2]:scan=10847	67.568	2	1665.7973	1665.7973	R	I	237	250
PSM	NVIDKLAQFVAR	1811	sp|Q8IWX8|CHERP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10984	68.475	2	1372.7827	1372.7827	R	N	14	26
PSM	QFVPIKVEQIEAGTPGR	1812	sp|Q16881-7|TRXR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7696	47.535	3	1868.0156	1868.0156	R	L	212	229
PSM	QGSGSSQPMEVQEGYGFGSGDDPYSSAEPHVSGVKR	1813	sp|Q13263-2|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:35	ms_run[2]:scan=6517	40.491	4	3728.6285	3728.6285	K	S	353	389
PSM	QKLNPADAPNPVVFVATK	1814	sp|O94776-2|MTA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7799	48.143	2	1908.0469	1908.0469	R	D	421	439
PSM	QLEMILNKPGLK	1815	sp|Q04828|AK1C1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6803	42.196	2	1382.7956	1382.7956	R	Y	172	184
PSM	QLREQVNDLFSR	1816	sp|P78347-2|GTF2I_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:267,12-UNIMOD:267	ms_run[2]:scan=6877	42.62	2	1523.7959	1523.7959	R	K	826	838
PSM	QLSEVFIQLPSRK	1817	sp|P51531-2|SMCA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=8244	50.942	2	1543.8722	1543.8722	R	E	1404	1417
PSM	QWYESHYALPLGR	1818	sp|P62241|RS8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	13-UNIMOD:267	ms_run[2]:scan=8178	50.527	2	1628.7975	1628.7975	R	K	111	124
PSM	RAGDLLEDSPK	1819	sp|P51858-2|HDGF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=3499	22.864	2	1199.6146	1199.6146	R	R	150	161
PSM	RALELEQER	1820	sp|P26038|MOES_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:267,9-UNIMOD:267	ms_run[2]:scan=2439	16.617	2	1162.6209	1162.6209	R	K	371	380
PSM	REELITNWEQIR	1821	sp|Q13813-3|SPTN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:267,12-UNIMOD:267	ms_run[2]:scan=7969	49.146	2	1605.8378	1605.8378	K	T	336	348
PSM	RGFFICDQPYEPVSPYSCK	1822	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:267,6-UNIMOD:4,18-UNIMOD:4,19-UNIMOD:188	ms_run[2]:scan=8873	54.906	2	2365.0842	2361.0961	R	E	675	694
PSM	RINMVEELEK	1823	sp|Q15046|SYK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5913	36.874	2	1259.6544	1259.6544	R	A	393	403
PSM	RIPYAPSGEIPK	1824	sp|O60701-3|UGDH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5167	32.495	2	1326.7296	1326.7296	K	F	373	385
PSM	RLEESLCPR	1825	sp|Q96LD4|TRI47_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:267,7-UNIMOD:4,9-UNIMOD:267	ms_run[2]:scan=2869	19.169	2	1178.5981	1178.5981	R	H	176	185
PSM	RLEESLCPR	1826	sp|Q96LD4|TRI47_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	7-UNIMOD:4	ms_run[2]:scan=2871	19.18	2	1158.5815	1158.5815	R	H	176	185
PSM	RLPEYPQVDDLLLR	1827	sp|Q9UI10-3|EI2BD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10275	63.798	3	1725.9414	1725.9414	K	R	142	156
PSM	RLTVMSLQESGLK	1828	sp|O75369-7|FLNB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:267,13-UNIMOD:188	ms_run[2]:scan=6904	42.775	2	1476.8305	1472.8424	R	V	2109	2122
PSM	RLVEVDSSR	1829	sp|Q03252|LMNB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=1773	12.926	2	1059.5673	1059.5673	R	Q	240	249
PSM	RMGESDDSILR	1830	sp|P63220|RS21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:267,11-UNIMOD:267	ms_run[2]:scan=3656	23.777	2	1297.6199	1297.6199	R	L	61	72
PSM	RVLVTGAGK	1831	sp|Q7Z4W1|DCXR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=1159	9.5542	2	899.55525	899.5553	R	G	9	18
PSM	RVTLELGGK	1832	sp|P05091|ALDH2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=3739	24.255	2	971.57638	971.5764	K	S	281	290
PSM	RYDSNSGGER	1833	sp|P62191|PRS4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=479	5.9173	2	1139.4956	1139.4956	K	E	294	304
PSM	SGPLFNFDVHDDVR	1834	sp|Q14320|FA50A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9002	55.715	2	1616.7583	1616.7583	K	L	276	290
PSM	SIGTANRPMGAGEALR	1835	sp|Q12906-5|ILF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	7-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=4116	26.465	2	1619.8317	1619.8317	K	R	258	274
PSM	SKFDNLYGCR	1836	sp|P23526-2|SAHH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:4	ms_run[2]:scan=4258	27.289	2	1258.5765	1258.5765	K	E	159	169
PSM	SKLTFSCLGGSDNFK	1837	sp|Q15185-3|TEBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	7-UNIMOD:4	ms_run[2]:scan=7076	43.794	3	1659.7927	1659.7927	K	H	34	49
PSM	SKLTFSCLGGSDNFK	1838	sp|Q15185-3|TEBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	7-UNIMOD:4	ms_run[2]:scan=7077	43.8	2	1659.7927	1659.7927	K	H	34	49
PSM	SLHDALCVIR	1839	sp|P48643-2|TCPE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	7-UNIMOD:4	ms_run[2]:scan=6075	37.848	2	1182.6179	1182.6179	R	N	308	318
PSM	SLREDQQSFTGSR	1840	sp|Q9GZY6-2|NTAL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2904	19.38	2	1509.7172	1509.7172	R	T	44	57
PSM	SLREDQQSFTGSR	1841	sp|Q9GZY6-2|NTAL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:267,13-UNIMOD:267	ms_run[2]:scan=2906	19.391	2	1529.7337	1529.7337	R	T	44	57
PSM	SLWSSLCLGPAPAPPGPVSPEGR	1842	sp|Q9BRR6-6|ADPGK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	7-UNIMOD:4,23-UNIMOD:267	ms_run[2]:scan=11429	71.422	3	2341.1764	2341.1764	R	L	34	57
PSM	SRPTSFADELAAR	1843	sp|Q9Y4E1-5|WAC2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5731	35.775	2	1419.7106	1419.7106	R	I	284	297
PSM	SSSSKQEQDLLHK	1844	sp|Q9BQG0|MBB1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=1605	11.983	2	1485.7423	1485.7423	R	T	862	875
PSM	SSTATHPPGPAVQLNK	1845	sp|Q14684-2|RRP1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=3303	21.723	2	1603.8318	1603.8318	K	T	643	659
PSM	STGLILDSGATHTTAIPVHDGYVLQQGIVK	1846	sp|O96019-2|ACL6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9341	57.849	2	3090.635	3090.6350	R	S	123	153
PSM	SVHAWEISDQLLQIR	1847	sp|Q9Y5L0-5|TNPO3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10769	67.047	2	1793.9424	1793.9424	R	Q	40	55
PSM	TDGKVFQFLNAK	1848	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	4-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=7657	47.289	2	1378.7648	1378.7648	R	C	24	36
PSM	TDGKVFQFLNAK	1849	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7664	47.334	2	1366.7245	1366.7245	R	C	24	36
PSM	THNSSLEYNIFEGMECR	1850	sp|Q16555|DPYL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	16-UNIMOD:4	ms_run[2]:scan=9716	60.212	3	2085.8884	2085.8884	K	G	424	441
PSM	THVADFAPEVAWVTR	1851	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9696	60.086	3	1697.8526	1697.8526	K	S	1092	1107
PSM	TIDDLKNQILNLTTDNANILLQIDNAR	1852	sp|P13645|K1C10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=13500	90.808	3	3051.62	3051.6200	K	L	202	229
PSM	TIQAHEGFVR	1853	sp|Q9NV06|DCA13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:267	ms_run[2]:scan=3029	20.131	2	1166.6072	1166.6072	R	G	104	114
PSM	TISHVIIGLK	1854	sp|Q9Y265-2|RUVB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:188	ms_run[2]:scan=5763	35.971	2	1085.6904	1085.6904	K	T	153	163
PSM	TLVAHYPPVQVLFEK	1855	sp|P52701-4|MSH6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10087	62.566	3	1739.961	1739.9610	R	G	282	297
PSM	TQEQCVHNETKNELEK	1856	sp|O60313-13|OPA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	5-UNIMOD:4	ms_run[2]:scan=1522	11.518	3	1985.9113	1985.9113	R	M	746	762
PSM	TSPPGPAPGPGLALEPPPGLASWR	1857	sp|A8MXV4|NUD19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11214	69.998	3	2321.2168	2321.2168	R	D	145	169
PSM	TVATPLNQVANPNSAIFGGARPR	1858	sp|Q15056-2|IF4H_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	21-UNIMOD:267,23-UNIMOD:267	ms_run[2]:scan=8534	52.759	2	2370.2671	2370.2671	R	E	197	220
PSM	TVIKEGEEQLQTQHQK	1859	sp|P30876|RPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	4-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=3285	21.616	3	1907.0151	1907.0151	K	T	131	147
PSM	TVIKEGEEQLQTQHQK	1860	sp|P30876|RPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=3287	21.632	3	1894.9749	1894.9749	K	T	131	147
PSM	VGLADLHPDVFATAPR	1861	sp|Q9BYD3-2|RM04_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	16-UNIMOD:267	ms_run[2]:scan=9329	57.774	3	1687.8921	1687.8921	R	L	77	93
PSM	VGRPSNIGQAQPIIDQLAEEAR	1862	sp|Q9UHX1-4|PUF60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9733	60.32	3	2361.2401	2361.2401	K	A	142	164
PSM	VHIDIGADGR	1863	sp|P31942-6|HNRH3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:267	ms_run[2]:scan=3854	24.9	2	1061.5493	1061.5493	R	A	86	96
PSM	VLDLDLFRVDK	1864	sp|P49591|SYSC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10454	64.959	2	1331.7449	1331.7449	M	G	2	13
PSM	VLDSGAPIKIPVGPETLGR	1865	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:188,19-UNIMOD:267	ms_run[2]:scan=8935	55.295	2	1934.1172	1930.1290	K	I	125	144
PSM	VLEALLPLKGLEER	1866	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10683	66.439	3	1578.9345	1578.9345	R	V	2383	2397
PSM	VLLGQDEPLIHVFAK	1867	sp|Q9BT73|PSMG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	15-UNIMOD:188	ms_run[2]:scan=10608	65.961	3	1683.9655	1683.9655	K	N	66	81
PSM	VLSIQSHVIR	1868	sp|O00764|PDXK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:267	ms_run[2]:scan=4948	31.213	2	1160.6905	1160.6905	R	G	7	17
PSM	VLSRPNAQELPSMYQR	1869	sp|Q99623-2|PHB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	4-UNIMOD:267,13-UNIMOD:35,16-UNIMOD:267	ms_run[2]:scan=4789	30.327	3	1923.974	1923.9740	R	L	108	124
PSM	VNDFLAEIFKK	1870	sp|Q14008-2|CKAP5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11369	71.029	3	1322.7234	1322.7234	K	I	1769	1780
PSM	VNRLSVLGAITSVQQR	1871	sp|P62495-2|ERF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=8869	54.879	3	1740.0006	1740.0006	R	L	33	49
PSM	VRELISDNQYR	1872	sp|P25205|MCM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:267,11-UNIMOD:267	ms_run[2]:scan=3850	24.873	2	1411.7323	1411.7323	K	L	36	47
PSM	VTNSTELQHQLDKTK	1873	sp|Q15075|EEA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=3226	21.276	2	1740.9006	1740.9006	K	Q	473	488
PSM	VTPTRTEIIILATR	1874	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7525	46.479	2	1582.9406	1582.9406	R	T	41	55
PSM	YATTGKCELENCQPFVVETLHGK	1875	sp|Q06203|PUR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	7-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=7393	45.698	2	2680.2625	2680.2625	R	I	94	117
PSM	YHTEIVFAR	1876	sp|P05023-3|AT1A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:267	ms_run[2]:scan=5175	32.542	2	1144.5905	1144.5905	K	T	653	662
PSM	YKDNPFSLGESFGSR	1877	sp|Q8N6H7-3|ARFG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:188,15-UNIMOD:267	ms_run[2]:scan=8409	51.98	2	1718.8235	1714.8354	K	W	89	104
PSM	YLHDESGLNR	1878	sp|Q15019|SEPT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2062	14.535	2	1202.568	1202.5680	R	R	129	139
PSM	YLQLAEELIRPER	1879	sp|Q14566|MCM6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:267,13-UNIMOD:267	ms_run[2]:scan=9741	60.372	2	1648.9051	1648.9051	K	N	46	59
PSM	RVLDELTLAR	1880	sp|P02533|K1C14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=6578	40.862265	2	1184.689171	1184.687721	R	A	223	233
PSM	SGLKANEPTHFTVDCTEAGEGDVSVGIK	1881	sp|O75369|FLNB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:188,15-UNIMOD:4,28-UNIMOD:188	ms_run[1]:scan=6882	42.64771833333334	2	2929.413253	2929.416625	R	C	755	783
PSM	LIKGEAGQNLLEMMACDR	1882	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	16-UNIMOD:4	ms_run[1]:scan=10103	62.66896166666667	3	2047.982531	2047.985302	K	L	333	351
PSM	SIHDALCVIR	1883	sp|P50991|TCPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	7-UNIMOD:4,10-UNIMOD:267	ms_run[1]:scan=6330	39.35982	2	1192.628808	1192.626196	R	C	404	414
PSM	SIHDALCVIR	1884	sp|P50991|TCPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	7-UNIMOD:4,10-UNIMOD:267	ms_run[1]:scan=6074	37.84405666666667	2	1192.628264	1192.626196	R	C	404	414
PSM	AVFVDLEPTVIDEVR	1885	sp|Q71U36|TBA1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	15-UNIMOD:267	ms_run[1]:scan=11273	70.386285	2	1711.904598	1710.906771	R	T	65	80
PSM	NLRDIDEVSSLLR	1886	sp|P50990|TCPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:267,13-UNIMOD:267	ms_run[1]:scan=9597	59.450696666666666	2	1548.839896	1548.837458	K	T	153	166
PSM	GIVEFASKPAAR	1887	sp|P23246|SFPQ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	8-UNIMOD:188,12-UNIMOD:267	ms_run[1]:scan=4612	29.313946666666666	2	1260.707733	1260.716119	K	K	414	426
PSM	IFVDIEKLPWSK	1888	sp|P06737|PYGL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	7-UNIMOD:188,12-UNIMOD:188	ms_run[1]:scan=10879	67.78121833333333	2	1485.8657	1485.8629	R	A	353	365
PSM	GIPLATGDTSPEPELLPGAPLPPPKEVINGNIK	1889	sp|O75821|EIF3G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=10708	66.61006166666667	3	3331.799546	3330.807509	K	T	33	66
PSM	QMVIDVLHPGK	1890	sp|P62847|RS24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:28,11-UNIMOD:188	ms_run[1]:scan=9657	59.830123333333326	2	1224.6658	1224.6627	K	A	22	33
PSM	LGVLHPDVITK	1891	sp|Q9NSD9|SYFB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	11-UNIMOD:188	ms_run[1]:scan=5633	35.19965833333333	2	1196.724759	1196.722438	K	F	561	572
PSM	TKDGQILPVPNVVVR	1892	sp|Q9P258|RCC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=7747	47.83573333333333	2	1633.951862	1633.951541	K	D	319	334
PSM	GLVHAAGPGQDSGSQAGSPPTR	1893	sp|Q96ER9|MITOK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	22-UNIMOD:267	ms_run[1]:scan=2637	17.74159	3	2055.983656	2055.996148	R	D	271	293
PSM	QHLSSVVFIK	1894	sp|O43324|MCA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:28	ms_run[1]:scan=8295	51.264221666666664	2	1139.6349	1139.6334	R	N	157	167
PSM	LLPLVSDEVFIRDVAK	1895	sp|P11216|PYGB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=11718	73.40742833333333	2	1814.036459	1813.034936	K	V	522	538
PSM	KLFDTLNEDLFQK	1896	sp|P48723|HSP13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:188,13-UNIMOD:188	ms_run[1]:scan=10039	62.27185333333333	3	1621.887850	1621.875432	R	I	368	381
PSM	SLLRQPDISCILGTGGK	1897	sp|P57740|NU107_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:267,10-UNIMOD:4,17-UNIMOD:188	ms_run[1]:scan=9383	58.11731999999999	3	1830.001546	1830.000416	R	S	69	86
PSM	EGPHYTPPIPNYQPPEGR	1898	sp|Q9NQ50|RM40_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	18-UNIMOD:267	ms_run[1]:scan=6503	40.39978333333333	2	2057.976344	2057.983458	K	Y	174	192
PSM	MKIVDVIGEK	1899	sp|P13861|KAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:35,2-UNIMOD:188,10-UNIMOD:188	ms_run[1]:scan=4406	28.11705	2	1158.672763	1158.672104	R	I	271	281
PSM	RLQDSFASETNLDFR	1900	sp|Q92621|NU205_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=7843	48.414698333333334	2	1798.843443	1797.864576	R	S	1935	1950
PSM	FSGFGSGAGGKPLEGLSNGNNITSAPPFASAK	1901	sp|Q9UKX7|NUP50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	11-UNIMOD:188,32-UNIMOD:188	ms_run[1]:scan=9734	60.326190000000004	3	3049.522000	3048.534372	R	A	73	105
PSM	CKELGITALHIK	1902	sp|P62263|RS14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:188,12-UNIMOD:188	ms_run[1]:scan=7960	49.089420000000004	2	1376.7885	1376.7883	R	L	85	97
PSM	NRNELAETLALLK	1903	sp|Q96T23|RSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	2-UNIMOD:267,13-UNIMOD:188	ms_run[1]:scan=10409	64.66891666666666	3	1501.864114	1499.864240	R	A	194	207
PSM	FACNGTVIEHPEYGEVIQLQGDQRK	1904	sp|O60739|EIF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:4	ms_run[1]:scan=7987	49.257455	3	2887.372666	2887.392292	K	N	67	92
PSM	RNEFLGELQK	1905	sp|Q9NVA2|SEP11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:267,10-UNIMOD:188	ms_run[1]:scan=5544	34.675311666666666	2	1248.679890	1248.679734	K	K	327	337
PSM	QEIQHLFREPEK	1906	sp|P04844|RPN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:28	ms_run[1]:scan=6988	43.27131166666666	2	1535.7739	1535.7727	K	R	524	536
PSM	HIDLVEGDEGR	1907	sp|P19367|HXK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	11-UNIMOD:267	ms_run[1]:scan=3548	23.14449666666667	2	1248.597272	1248.597398	R	M	244	255
PSM	NVESGEEELASKLDHYK	1908	sp|Q96HS1|PGAM5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	12-UNIMOD:188,17-UNIMOD:188	ms_run[1]:scan=7281	45.02449	2	1958.961531	1958.962409	R	A	77	94
PSM	GRYFLNEGEEGPDQDALYEK	1909	sp|P51828|ADCY7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	2-UNIMOD:267,20-UNIMOD:188	ms_run[1]:scan=7553	46.64116	2	2345.120248	2345.078268	K	Y	5	25
PSM	NGNHVANSPVSIMVVQSEIGDARR	1910	sp|O75369|FLNB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	23-UNIMOD:267,24-UNIMOD:267	ms_run[1]:scan=9170	56.754891666666666	2	2570.275619	2569.293406	K	A	1981	2005
PSM	VVCDENGSKGYGFVHFETQEAAER	1911	sp|P11940|PABP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:4	ms_run[1]:scan=7334	45.34012833333333	4	2729.203581	2728.218744	K	A	130	154