MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000208 -- new
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220618\20220618002634800212^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\111222_HL13.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220618\20220618002634800212^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\111222_HL13.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Acetyl (Protein N-term),Label:13C(6) (K),Label:13C(6)15N(4) (R),Oxidation (M)
MTD	software[1]-setting	maxMissedCleavages=1
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=40
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Label:13C(6) (K),Label:13C(6)15N(4) (R),Acetyl (Protein N-term)
MTD	software[2]-setting	TOL(-)=20
MTD	software[2]-setting	TOL(+)=20
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=1000
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=1
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Acetyl (Protein N-term),Label:13C(6) (K),Label:13C(6)15N(4) (R),Oxidation (M)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=1
MTD	software[3]-setting	peptide_mass_tolerance=20
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:1, Acetyl,]
MTD	variable_mod[1]-site	N-term
MTD	variable_mod[1]-position	Protein N-term
MTD	variable_mod[2]	[UNIMOD, UNIMOD:188, Label:13C(6),]
MTD	variable_mod[2]-site	K
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:267, Label:13C(6)15N(4),]
MTD	variable_mod[3]-site	R
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[4]-site	M
MTD	variable_mod[4]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|Q8IZL8|PELP1_HUMAN	Proline-, glutamic acid- and leucine-rich protein 1 OS=Homo sapiens OX=9606 GN=PELP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	null	98-UNIMOD:267,574-UNIMOD:267	0.05	51.0	4	2	1
PRT	sp|P61247|RS3A_HUMAN	40S ribosomal protein S3a OS=Homo sapiens OX=9606 GN=RPS3A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	null		0.09	49.0	2	1	0
PRT	sp|Q9UHJ6|SHPK_HUMAN	Sedoheptulokinase OS=Homo sapiens OX=9606 GN=SHPK PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	null	239-UNIMOD:267	0.05	49.0	1	1	1
PRT	sp|Q92922|SMRC1_HUMAN	SWI/SNF complex subunit SMARCC1 OS=Homo sapiens OX=9606 GN=SMARCC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null		0.02	48.0	1	1	1
PRT	sp|Q92614-3|MY18A_HUMAN	Isoform 3 of Unconventional myosin-XVIIIa OS=Homo sapiens OX=9606 GN=MYO18A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null		0.01	47.0	1	1	1
PRT	sp|Q8N183|NDUF2_HUMAN	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 2 OS=Homo sapiens OX=9606 GN=NDUFAF2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	140-UNIMOD:188,152-UNIMOD:188	0.14	46.0	2	1	0
PRT	sp|P62937|PPIA_HUMAN	Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	46.0	null	115-UNIMOD:4,118-UNIMOD:188,100-UNIMOD:35,28-UNIMOD:188,31-UNIMOD:188	0.34	46.0	21	3	1
PRT	sp|P27635|RL10_HUMAN	60S ribosomal protein L10 OS=Homo sapiens OX=9606 GN=RPL10 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	49-UNIMOD:4,52-UNIMOD:35	0.14	45.0	2	1	0
PRT	sp|P09211|GSTP1_HUMAN	Glutathione S-transferase P OS=Homo sapiens OX=9606 GN=GSTP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	128-UNIMOD:188,141-UNIMOD:188	0.10	45.0	6	1	0
PRT	sp|Q9BQA1|MEP50_HUMAN	Methylosome protein 50 OS=Homo sapiens OX=9606 GN=WDR77 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	120-UNIMOD:4,121-UNIMOD:188,145-UNIMOD:188	0.08	45.0	4	1	0
PRT	sp|P07437|TBB5_HUMAN	Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	121-UNIMOD:267	0.11	45.0	3	2	1
PRT	sp|O95373|IPO7_HUMAN	Importin-7 OS=Homo sapiens OX=9606 GN=IPO7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	724-UNIMOD:188,736-UNIMOD:4,740-UNIMOD:188	0.02	45.0	4	1	0
PRT	sp|P50990|TCPQ_HUMAN	T-complex protein 1 subunit theta OS=Homo sapiens OX=9606 GN=CCT8 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	155-UNIMOD:267,165-UNIMOD:267,31-UNIMOD:267	0.12	45.0	6	4	2
PRT	sp|P05783|K1C18_HUMAN	Keratin, type I cytoskeletal 18 OS=Homo sapiens OX=9606 GN=KRT18 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	45.0	null	222-UNIMOD:188,241-UNIMOD:188,176-UNIMOD:28,186-UNIMOD:267,187-UNIMOD:188	0.09	45.0	5	2	0
PRT	sp|Q02790|FKBP4_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Homo sapiens OX=9606 GN=FKBP4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	103-UNIMOD:4,107-UNIMOD:4,108-UNIMOD:188,121-UNIMOD:188	0.05	45.0	4	1	0
PRT	sp|P62318-2|SMD3_HUMAN	Isoform 2 of Small nuclear ribonucleoprotein Sm D3 OS=Homo sapiens OX=9606 GN=SNRPD3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	20-UNIMOD:4,29-UNIMOD:267	0.18	45.0	3	1	0
PRT	sp|P62241|RS8_HUMAN	40S ribosomal protein S8 OS=Homo sapiens OX=9606 GN=RPS8 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	59-UNIMOD:267,71-UNIMOD:4,72-UNIMOD:4,74-UNIMOD:267	0.09	44.0	3	1	0
PRT	sp|P12268|IMDH2_HUMAN	Inosine-5'-monophosphate dehydrogenase 2 OS=Homo sapiens OX=9606 GN=IMPDH2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	44.0	null	375-UNIMOD:188,511-UNIMOD:188,450-UNIMOD:188,455-UNIMOD:188,140-UNIMOD:4,149-UNIMOD:267	0.14	44.0	9	4	0
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	44.0	null	173-UNIMOD:267,178-UNIMOD:4	0.13	44.0	3	2	1
PRT	sp|P00367-2|DHE3_HUMAN	Isoform 2 of Glutamate dehydrogenase 1, mitochondrial OS=Homo sapiens OX=9606 GN=GLUD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	329-UNIMOD:267,336-UNIMOD:188,349-UNIMOD:267	0.15	44.0	7	3	1
PRT	sp|P13861-2|KAP2_HUMAN	Isoform 2 of cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.06	44.0	2	1	0
PRT	sp|Q9UBT2-2|SAE2_HUMAN	Isoform 2 of SUMO-activating enzyme subunit 2 OS=Homo sapiens OX=9606 GN=UBA2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	181-UNIMOD:188,212-UNIMOD:188,62-UNIMOD:4,65-UNIMOD:4	0.11	44.0	4	3	2
PRT	sp|Q9NR30-2|DDX21_HUMAN	Isoform 2 of Nucleolar RNA helicase 2 OS=Homo sapiens OX=9606 GN=DDX21	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	634-UNIMOD:267,650-UNIMOD:267,559-UNIMOD:267	0.06	44.0	4	2	0
PRT	sp|O60506-4|HNRPQ_HUMAN	Isoform 4 of Heterogeneous nuclear ribonucleoprotein Q OS=Homo sapiens OX=9606 GN=SYNCRIP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.04	44.0	2	1	0
PRT	sp|Q15149|PLEC_HUMAN	Plectin OS=Homo sapiens OX=9606 GN=PLEC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	1250-UNIMOD:188,1266-UNIMOD:188,4130-UNIMOD:35,4138-UNIMOD:188,4140-UNIMOD:188,3783-UNIMOD:267,3793-UNIMOD:267,651-UNIMOD:267,660-UNIMOD:267	0.04	43.0	16	9	4
PRT	sp|P63220|RS21_HUMAN	40S ribosomal protein S21 OS=Homo sapiens OX=9606 GN=RPS21 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	34-UNIMOD:35,61-UNIMOD:267,71-UNIMOD:267,41-UNIMOD:188,45-UNIMOD:267	0.37	43.0	6	2	1
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	43.0	null	492-UNIMOD:267,601-UNIMOD:188,617-UNIMOD:188	0.06	43.0	12	2	1
PRT	sp|P61978-3|HNRPK_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	139-UNIMOD:188,160-UNIMOD:4,161-UNIMOD:4,398-UNIMOD:188,409-UNIMOD:267	0.13	43.0	9	3	0
PRT	sp|P63244|RACK1_HUMAN	Receptor of activated protein C kinase 1 OS=Homo sapiens OX=9606 GN=RACK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	240-UNIMOD:4,245-UNIMOD:267	0.15	43.0	4	2	1
PRT	sp|P30050-2|RL12_HUMAN	Isoform 2 of 60S ribosomal protein L12 OS=Homo sapiens OX=9606 GN=RPL12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	129-UNIMOD:4	0.27	43.0	3	2	1
PRT	sp|P49755|TMEDA_HUMAN	Transmembrane emp24 domain-containing protein 10 OS=Homo sapiens OX=9606 GN=TMED10 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	87-UNIMOD:188,92-UNIMOD:188	0.08	43.0	3	1	0
PRT	sp|O95831-5|AIFM1_HUMAN	Isoform 5 of Apoptosis-inducing factor 1, mitochondrial OS=Homo sapiens OX=9606 GN=AIFM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	241-UNIMOD:188,254-UNIMOD:188	0.15	43.0	3	2	1
PRT	sp|Q92896|GSLG1_HUMAN	Golgi apparatus protein 1 OS=Homo sapiens OX=9606 GN=GLG1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	269-UNIMOD:4	0.02	43.0	1	1	1
PRT	sp|Q9Y512|SAM50_HUMAN	Sorting and assembly machinery component 50 homolog OS=Homo sapiens OX=9606 GN=SAMM50 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	403-UNIMOD:4,412-UNIMOD:188	0.04	43.0	4	1	0
PRT	sp|P21333-2|FLNA_HUMAN	Isoform 2 of Filamin-A OS=Homo sapiens OX=9606 GN=FLNA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	2370-UNIMOD:4,87-UNIMOD:188,88-UNIMOD:188,1943-UNIMOD:267,1071-UNIMOD:188,1087-UNIMOD:267,2590-UNIMOD:267	0.03	43.0	8	5	3
PRT	sp|P78371-2|TCPB_HUMAN	Isoform 2 of T-complex protein 1 subunit beta OS=Homo sapiens OX=9606 GN=CCT2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	225-UNIMOD:188,227-UNIMOD:188	0.09	42.0	4	3	2
PRT	sp|P09874|PARP1_HUMAN	Poly [ADP-ribose] polymerase 1 OS=Homo sapiens OX=9606 GN=PARP1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	548-UNIMOD:188	0.02	42.0	2	1	0
PRT	sp|P40937-2|RFC5_HUMAN	Isoform 2 of Replication factor C subunit 5 OS=Homo sapiens OX=9606 GN=RFC5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.06	42.0	2	1	0
PRT	sp|P05387|RLA2_HUMAN	60S acidic ribosomal protein P2 OS=Homo sapiens OX=9606 GN=RPLP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	1-UNIMOD:35,2-UNIMOD:267,21-UNIMOD:188	0.19	42.0	4	1	0
PRT	sp|O15143|ARC1B_HUMAN	Actin-related protein 2/3 complex subunit 1B OS=Homo sapiens OX=9606 GN=ARPC1B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	227-UNIMOD:4,233-UNIMOD:188,234-UNIMOD:188,26-UNIMOD:4,37-UNIMOD:188	0.10	42.0	4	2	0
PRT	sp|P60891-2|PRPS1_HUMAN	Isoform 2 of Ribose-phosphate pyrophosphokinase 1 OS=Homo sapiens OX=9606 GN=PRPS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	193-UNIMOD:267	0.07	42.0	2	1	0
PRT	sp|Q93009|UBP7_HUMAN	Ubiquitin carboxyl-terminal hydrolase 7 OS=Homo sapiens OX=9606 GN=USP7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	null	488-UNIMOD:385,488-UNIMOD:4,490-UNIMOD:188,508-UNIMOD:267	0.02	42.0	4	1	0
PRT	sp|P35222|CTNB1_HUMAN	Catenin beta-1 OS=Homo sapiens OX=9606 GN=CTNNB1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	49-UNIMOD:188	0.04	41.0	3	1	0
PRT	sp|P62081|RS7_HUMAN	40S ribosomal protein S7 OS=Homo sapiens OX=9606 GN=RPS7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	169-UNIMOD:188,178-UNIMOD:188	0.10	41.0	2	1	0
PRT	sp|P29401|TKT_HUMAN	Transketolase OS=Homo sapiens OX=9606 GN=TKT PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	206-UNIMOD:4,225-UNIMOD:4,226-UNIMOD:188	0.04	41.0	1	1	1
PRT	sp|O95292|VAPB_HUMAN	Vesicle-associated membrane protein-associated protein B/C OS=Homo sapiens OX=9606 GN=VAPB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	41.0	null	121-UNIMOD:4,131-UNIMOD:188,139-UNIMOD:188,121-UNIMOD:385	0.08	41.0	3	1	0
PRT	sp|Q01082-3|SPTB2_HUMAN	Isoform 2 of Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	1726-UNIMOD:267,1640-UNIMOD:188,556-UNIMOD:188	0.03	41.0	7	3	0
PRT	sp|P27816-4|MAP4_HUMAN	Isoform 4 of Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.02	41.0	1	1	1
PRT	sp|O75431-2|MTX2_HUMAN	Isoform 2 of Metaxin-2 OS=Homo sapiens OX=9606 GN=MTX2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	98-UNIMOD:188,102-UNIMOD:188	0.07	41.0	2	1	0
PRT	sp|Q15397|PUM3_HUMAN	Pumilio homolog 3 OS=Homo sapiens OX=9606 GN=PUM3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.06	41.0	2	2	2
PRT	sp|Q13616|CUL1_HUMAN	Cullin-1 OS=Homo sapiens OX=9606 GN=CUL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	741-UNIMOD:267	0.02	41.0	3	1	0
PRT	sp|P24539|AT5F1_HUMAN	ATP synthase F(0) complex subunit B1, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5PB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	233-UNIMOD:188,238-UNIMOD:188	0.07	41.0	3	1	0
PRT	sp|Q86U86-6|PB1_HUMAN	Isoform 6 of Protein polybromo-1 OS=Homo sapiens OX=9606 GN=PBRM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	616-UNIMOD:188	0.02	41.0	2	1	0
PRT	sp|P22626-2|ROA2_HUMAN	Isoform A2 of Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.09	41.0	2	2	1
PRT	sp|P07237|PDIA1_HUMAN	Protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	425-UNIMOD:35,415-UNIMOD:188,424-UNIMOD:188	0.11	41.0	5	3	1
PRT	sp|O43707|ACTN4_HUMAN	Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	521-UNIMOD:188,535-UNIMOD:188,499-UNIMOD:4,512-UNIMOD:267	0.06	41.0	5	3	1
PRT	sp|P55081|MFAP1_HUMAN	Microfibrillar-associated protein 1 OS=Homo sapiens OX=9606 GN=MFAP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.06	41.0	1	1	1
PRT	sp|P15121|ALDR_HUMAN	Aldo-keto reductase family 1 member B1 OS=Homo sapiens OX=9606 GN=AKR1B1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	187-UNIMOD:4	0.06	41.0	1	1	1
PRT	sp|Q9Y490|TLN1_HUMAN	Talin-1 OS=Homo sapiens OX=9606 GN=TLN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null	35-UNIMOD:267,57-UNIMOD:188	0.01	40.0	3	2	1
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null	1118-UNIMOD:4,1127-UNIMOD:4,1131-UNIMOD:267,992-UNIMOD:188,496-UNIMOD:4,70-UNIMOD:188	0.04	40.0	9	5	2
PRT	sp|O43242|PSMD3_HUMAN	26S proteasome non-ATPase regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PSMD3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null	256-UNIMOD:267,76-UNIMOD:188,80-UNIMOD:188	0.06	40.0	6	2	0
PRT	sp|Q8WUF5|IASPP_HUMAN	RelA-associated inhibitor OS=Homo sapiens OX=9606 GN=PPP1R13L PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	576-UNIMOD:267	0.03	40.0	1	1	1
PRT	sp|P22314-2|UBA1_HUMAN	Isoform 2 of Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	785-UNIMOD:267,790-UNIMOD:188	0.02	40.0	3	1	0
PRT	sp|O60547-2|GMDS_HUMAN	Isoform 2 of GDP-mannose 4,6 dehydratase OS=Homo sapiens OX=9606 GN=GMDS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	71-UNIMOD:188,85-UNIMOD:188	0.06	40.0	4	1	0
PRT	sp|Q96Q11-2|TRNT1_HUMAN	Isoform 2 of CCA tRNA nucleotidyltransferase 1, mitochondrial OS=Homo sapiens OX=9606 GN=TRNT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	211-UNIMOD:188,228-UNIMOD:188	0.05	40.0	3	1	0
PRT	sp|Q13451-2|FKBP5_HUMAN	Isoform 2 of Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Homo sapiens OX=9606 GN=FKBP5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.08	40.0	2	1	0
PRT	sp|P06744-2|G6PI_HUMAN	Isoform 2 of Glucose-6-phosphate isomerase OS=Homo sapiens OX=9606 GN=GPI	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	535-UNIMOD:188,561-UNIMOD:188,123-UNIMOD:35,415-UNIMOD:4,428-UNIMOD:267,263-UNIMOD:188,412-UNIMOD:35	0.13	40.0	11	4	2
PRT	sp|P09651-3|ROA1_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	15-UNIMOD:188,31-UNIMOD:267	0.07	40.0	3	1	0
PRT	sp|Q13439-3|GOGA4_HUMAN	Isoform 3 of Golgin subfamily A member 4 OS=Homo sapiens OX=9606 GN=GOLGA4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	934-UNIMOD:188,948-UNIMOD:188	0.01	40.0	1	1	1
PRT	sp|P25398|RS12_HUMAN	40S ribosomal protein S12 OS=Homo sapiens OX=9606 GN=RPS12 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	69-UNIMOD:4	0.16	40.0	2	1	0
PRT	sp|Q8NC51-4|PAIRB_HUMAN	Isoform 4 of Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	11-UNIMOD:4,16-UNIMOD:267	0.04	40.0	4	1	0
PRT	sp|P14618-2|KPYM_HUMAN	Isoform M1 of Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	279-UNIMOD:267,294-UNIMOD:267	0.03	40.0	3	1	0
PRT	sp|Q1KMD3|HNRL2_HUMAN	Heterogeneous nuclear ribonucleoprotein U-like protein 2 OS=Homo sapiens OX=9606 GN=HNRNPUL2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	538-UNIMOD:4	0.05	40.0	3	2	1
PRT	sp|P07384|CAN1_HUMAN	Calpain-1 catalytic subunit OS=Homo sapiens OX=9606 GN=CAPN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	87-UNIMOD:267,104-UNIMOD:267	0.03	40.0	3	1	0
PRT	sp|P33993|MCM7_HUMAN	DNA replication licensing factor MCM7 OS=Homo sapiens OX=9606 GN=MCM7 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	499-UNIMOD:267,514-UNIMOD:267,351-UNIMOD:188,352-UNIMOD:188	0.07	40.0	5	3	1
PRT	sp|P07305-2|H10_HUMAN	Isoform 2 of Histone H1.0 OS=Homo sapiens OX=9606 GN=H1-0	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	10-UNIMOD:188,23-UNIMOD:188	0.11	40.0	2	1	0
PRT	sp|P23246|SFPQ_HUMAN	Splicing factor, proline- and glutamine-rich OS=Homo sapiens OX=9606 GN=SFPQ PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.03	40.0	2	1	0
PRT	sp|Q9NYL9|TMOD3_HUMAN	Tropomodulin-3 OS=Homo sapiens OX=9606 GN=TMOD3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	194-UNIMOD:188,209-UNIMOD:188	0.05	40.0	4	1	0
PRT	sp|P17858|PFKAL_HUMAN	ATP-dependent 6-phosphofructokinase, liver type OS=Homo sapiens OX=9606 GN=PFKL PE=1 SV=6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	672-UNIMOD:267	0.02	40.0	3	1	0
PRT	sp|Q08257-3|QOR_HUMAN	Isoform 3 of Quinone oxidoreductase OS=Homo sapiens OX=9606 GN=CRYZ	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	290-UNIMOD:188	0.06	40.0	3	1	0
PRT	sp|Q9BQG0|MBB1A_HUMAN	Myb-binding protein 1A OS=Homo sapiens OX=9606 GN=MYBBP1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null	942-UNIMOD:4,935-UNIMOD:188,949-UNIMOD:188	0.02	40.0	4	2	1
PRT	sp|Q13085-3|ACACA_HUMAN	Isoform 3 of Acetyl-CoA carboxylase 1 OS=Homo sapiens OX=9606 GN=ACACA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	1691-UNIMOD:4,1701-UNIMOD:267	0.01	40.0	3	1	0
PRT	sp|Q9UQE7|SMC3_HUMAN	Structural maintenance of chromosomes protein 3 OS=Homo sapiens OX=9606 GN=SMC3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	72-UNIMOD:267	0.03	40.0	3	2	1
PRT	sp|P49748-2|ACADV_HUMAN	Isoform 2 of Very long-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ACADVL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	509-UNIMOD:267,276-UNIMOD:188,319-UNIMOD:267	0.07	39.0	7	3	1
PRT	sp|Q14839|CHD4_HUMAN	Chromodomain-helicase-DNA-binding protein 4 OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	39.0	null	1018-UNIMOD:4,1019-UNIMOD:4,1034-UNIMOD:188,1018-UNIMOD:385	0.01	39.0	4	1	0
PRT	sp|Q96TA1-2|NIBA2_HUMAN	Isoform 2 of Protein Niban 2 OS=Homo sapiens OX=9606 GN=NIBAN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	48-UNIMOD:267	0.02	39.0	1	1	1
PRT	sp|P18887|XRCC1_HUMAN	DNA repair protein XRCC1 OS=Homo sapiens OX=9606 GN=XRCC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	12-UNIMOD:4,20-UNIMOD:4,26-UNIMOD:188	0.03	39.0	3	1	0
PRT	sp|P05455|LA_HUMAN	Lupus La protein OS=Homo sapiens OX=9606 GN=SSB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	18-UNIMOD:4,32-UNIMOD:267	0.04	39.0	4	1	0
PRT	sp|P63096-2|GNAI1_HUMAN	Isoform 2 of Guanine nucleotide-binding protein G(i) subunit alpha-1 OS=Homo sapiens OX=9606 GN=GNAI1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	14-UNIMOD:4,15-UNIMOD:188,18-UNIMOD:188	0.06	39.0	3	1	0
PRT	sp|P63241|IF5A1_HUMAN	Eukaryotic translation initiation factor 5A-1 OS=Homo sapiens OX=9606 GN=EIF5A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	73-UNIMOD:4,68-UNIMOD:188,85-UNIMOD:188,79-UNIMOD:35,67-UNIMOD:188	0.20	39.0	9	2	0
PRT	sp|P12270|TPR_HUMAN	Nucleoprotein TPR OS=Homo sapiens OX=9606 GN=TPR PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	39.0	null	1119-UNIMOD:188,1127-UNIMOD:4,1128-UNIMOD:188	0.02	39.0	5	2	0
PRT	sp|Q6P2Q9|PRP8_HUMAN	Pre-mRNA-processing-splicing factor 8 OS=Homo sapiens OX=9606 GN=PRPF8 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	39.0	null	1210-UNIMOD:188,1222-UNIMOD:188,1402-UNIMOD:267,1414-UNIMOD:267,1131-UNIMOD:188,1132-UNIMOD:188	0.07	39.0	14	7	2
PRT	sp|P40938-2|RFC3_HUMAN	Isoform 2 of Replication factor C subunit 3 OS=Homo sapiens OX=9606 GN=RFC3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	32-UNIMOD:4,48-UNIMOD:188	0.07	39.0	2	1	0
PRT	sp|O60502-2|OGA_HUMAN	Isoform 2 of Protein O-GlcNAcase OS=Homo sapiens OX=9606 GN=OGA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	629-UNIMOD:267	0.02	39.0	2	1	0
PRT	sp|P11940-2|PABP1_HUMAN	Isoform 2 of Polyadenylate-binding protein 1 OS=Homo sapiens OX=9606 GN=PABPC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	132-UNIMOD:4	0.08	39.0	2	2	1
PRT	sp|O00471|EXOC5_HUMAN	Exocyst complex component 5 OS=Homo sapiens OX=9606 GN=EXOC5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.03	39.0	1	1	1
PRT	sp|P06576|ATPB_HUMAN	ATP synthase subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	239-UNIMOD:267,201-UNIMOD:188,212-UNIMOD:188,478-UNIMOD:35,480-UNIMOD:188	0.13	39.0	9	4	1
PRT	sp|Q9Y6C9|MTCH2_HUMAN	Mitochondrial carrier homolog 2 OS=Homo sapiens OX=9606 GN=MTCH2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	100-UNIMOD:188,111-UNIMOD:188	0.12	39.0	5	2	1
PRT	sp|Q9NX58|LYAR_HUMAN	Cell growth-regulating nucleolar protein OS=Homo sapiens OX=9606 GN=LYAR PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	95-UNIMOD:267,109-UNIMOD:267	0.04	39.0	3	1	0
PRT	sp|O00571-2|DDX3X_HUMAN	Isoform 2 of ATP-dependent RNA helicase DDX3X OS=Homo sapiens OX=9606 GN=DDX3X	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	282-UNIMOD:4,452-UNIMOD:4,459-UNIMOD:267,280-UNIMOD:267,295-UNIMOD:267	0.07	39.0	7	2	0
PRT	sp|P23381-2|SYWC_HUMAN	Isoform 2 of Tryptophan--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=WARS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	407-UNIMOD:267	0.04	38.0	1	1	1
PRT	sp|P62633-8|CNBP_HUMAN	Isoform 8 of Cellular nucleic acid-binding protein OS=Homo sapiens OX=9606 GN=CNBP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	50-UNIMOD:4,60-UNIMOD:4,68-UNIMOD:4,71-UNIMOD:4	0.15	38.0	1	1	1
PRT	sp|Q9Y265|RUVB1_HUMAN	RuvB-like 1 OS=Homo sapiens OX=9606 GN=RUVBL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	427-UNIMOD:188,441-UNIMOD:188	0.04	38.0	2	1	0
PRT	sp|P26599|PTBP1_HUMAN	Polypyrimidine tract-binding protein 1 OS=Homo sapiens OX=9606 GN=PTBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.04	38.0	1	1	1
PRT	sp|P55884|EIF3B_HUMAN	Eukaryotic translation initiation factor 3 subunit B OS=Homo sapiens OX=9606 GN=EIF3B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	384-UNIMOD:4,386-UNIMOD:267	0.02	38.0	2	1	0
PRT	sp|O15084|ANR28_HUMAN	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens OX=9606 GN=ANKRD28 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	701-UNIMOD:4,711-UNIMOD:188	0.02	38.0	3	1	0
PRT	sp|Q13895|BYST_HUMAN	Bystin OS=Homo sapiens OX=9606 GN=BYSL PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	30-UNIMOD:267	0.04	38.0	2	1	0
PRT	sp|Q13868-3|EXOS2_HUMAN	Isoform 3 of Exosome complex component RRP4 OS=Homo sapiens OX=9606 GN=EXOSC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	41-UNIMOD:267	0.07	38.0	2	1	0
PRT	sp|Q9H1I8-3|ASCC2_HUMAN	Isoform 3 of Activating signal cointegrator 1 complex subunit 2 OS=Homo sapiens OX=9606 GN=ASCC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	474-UNIMOD:267	0.02	38.0	1	1	1
PRT	sp|Q12906-5|ILF3_HUMAN	Isoform 5 of Interleukin enhancer-binding factor 3 OS=Homo sapiens OX=9606 GN=ILF3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	40-UNIMOD:267	0.03	38.0	7	1	0
PRT	sp|Q13263-2|TIF1B_HUMAN	Isoform 2 of Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	330-UNIMOD:267,345-UNIMOD:267	0.03	38.0	4	1	0
PRT	sp|Q3ZCM7|TBB8_HUMAN	Tubulin beta-8 chain OS=Homo sapiens OX=9606 GN=TUBB8 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	127-UNIMOD:4,129-UNIMOD:4	0.08	38.0	1	1	1
PRT	sp|O75489|NDUS3_HUMAN	NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFS3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.06	38.0	2	1	0
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null	648-UNIMOD:188,651-UNIMOD:4,667-UNIMOD:188,567-UNIMOD:4	0.04	38.0	6	2	1
PRT	sp|Q13206|DDX10_HUMAN	Probable ATP-dependent RNA helicase DDX10 OS=Homo sapiens OX=9606 GN=DDX10 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	709-UNIMOD:188,724-UNIMOD:188	0.02	38.0	2	1	0
PRT	sp|O96008-2|TOM40_HUMAN	Isoform 2 of Mitochondrial import receptor subunit TOM40 homolog OS=Homo sapiens OX=9606 GN=TOMM40	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	56-UNIMOD:267,74-UNIMOD:4,76-UNIMOD:4,86-UNIMOD:4,88-UNIMOD:267	0.11	38.0	1	1	1
PRT	sp|P33121-2|ACSL1_HUMAN	Isoform 2 of Long-chain-fatty-acid--CoA ligase 1 OS=Homo sapiens OX=9606 GN=ACSL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	665-UNIMOD:188	0.06	38.0	3	2	1
PRT	sp|Q9NSE4|SYIM_HUMAN	Isoleucine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=IARS2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	540-UNIMOD:188,555-UNIMOD:188	0.02	38.0	3	1	0
PRT	sp|P35579|MYH9_HUMAN	Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	1190-UNIMOD:35,91-UNIMOD:4,387-UNIMOD:267,1181-UNIMOD:188,1191-UNIMOD:267,86-UNIMOD:35,1518-UNIMOD:188,1525-UNIMOD:188	0.04	38.0	10	4	1
PRT	sp|P48681|NEST_HUMAN	Nestin OS=Homo sapiens OX=9606 GN=NES PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	1605-UNIMOD:188,575-UNIMOD:4	0.02	38.0	3	2	1
PRT	sp|Q14789-4|GOGB1_HUMAN	Isoform 4 of Golgin subfamily B member 1 OS=Homo sapiens OX=9606 GN=GOLGB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.01	38.0	1	1	1
PRT	sp|O15264-2|MK13_HUMAN	Isoform 2 of Mitogen-activated protein kinase 13 OS=Homo sapiens OX=9606 GN=MAPK13	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	40-UNIMOD:4	0.09	38.0	1	1	1
PRT	sp|O00244|ATOX1_HUMAN	Copper transport protein ATOX1 OS=Homo sapiens OX=9606 GN=ATOX1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	41-UNIMOD:4	0.28	38.0	1	1	1
PRT	sp|Q96PK6-2|RBM14_HUMAN	Isoform 2 of RNA-binding protein 14 OS=Homo sapiens OX=9606 GN=RBM14	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	108-UNIMOD:4,112-UNIMOD:188,121-UNIMOD:188	0.12	38.0	2	1	0
PRT	sp|Q7KZF4|SND1_HUMAN	Staphylococcal nuclease domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SND1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.03	38.0	1	1	1
PRT	sp|Q9Y6N5|SQOR_HUMAN	Sulfide:quinone oxidoreductase, mitochondrial OS=Homo sapiens OX=9606 GN=SQOR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null		0.05	38.0	2	1	0
PRT	sp|Q9C004|SPY4_HUMAN	Protein sprouty homolog 4 OS=Homo sapiens OX=9606 GN=SPRY4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	65-UNIMOD:188,66-UNIMOD:267	0.08	38.0	1	1	1
PRT	sp|Q9P258|RCC2_HUMAN	Protein RCC2 OS=Homo sapiens OX=9606 GN=RCC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null	92-UNIMOD:188,94-UNIMOD:267,337-UNIMOD:4	0.10	37.0	6	3	1
PRT	sp|Q9H9B4|SFXN1_HUMAN	Sideroflexin-1 OS=Homo sapiens OX=9606 GN=SFXN1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	72-UNIMOD:188,86-UNIMOD:188	0.05	37.0	2	1	0
PRT	sp|P62633-7|CNBP_HUMAN	Isoform 7 of Cellular nucleic acid-binding protein OS=Homo sapiens OX=9606 GN=CNBP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	40-UNIMOD:4,50-UNIMOD:4,57-UNIMOD:4,60-UNIMOD:4	0.15	37.0	1	1	0
PRT	sp|P17480-2|UBF1_HUMAN	Isoform UBF2 of Nucleolar transcription factor 1 OS=Homo sapiens OX=9606 GN=UBTF	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	229-UNIMOD:188,242-UNIMOD:188	0.03	37.0	3	1	0
PRT	sp|P00338|LDHA_HUMAN	L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	232-UNIMOD:188,243-UNIMOD:188	0.05	37.0	2	1	0
PRT	sp|Q5JVS0-2|HABP4_HUMAN	Isoform 2 of Intracellular hyaluronan-binding protein 4 OS=Homo sapiens OX=9606 GN=HABP4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	43-UNIMOD:267	0.06	37.0	2	1	0
PRT	sp|Q09666|AHNK_HUMAN	Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null	3032-UNIMOD:35,3036-UNIMOD:188,3048-UNIMOD:188,2257-UNIMOD:188,2269-UNIMOD:188,28-UNIMOD:267,887-UNIMOD:35,891-UNIMOD:188,903-UNIMOD:188,3616-UNIMOD:188,3628-UNIMOD:188,1524-UNIMOD:188,1536-UNIMOD:188,4794-UNIMOD:188,4806-UNIMOD:188,5337-UNIMOD:188,371-UNIMOD:188,387-UNIMOD:188	0.06	37.0	13	9	6
PRT	sp|P11166|GTR1_HUMAN	Solute carrier family 2, facilitated glucose transporter member 1 OS=Homo sapiens OX=9606 GN=SLC2A1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	458-UNIMOD:267,468-UNIMOD:267,244-UNIMOD:35,245-UNIMOD:188,249-UNIMOD:267	0.06	37.0	6	2	0
PRT	sp|P53396|ACLY_HUMAN	ATP-citrate synthase OS=Homo sapiens OX=9606 GN=ACLY PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	630-UNIMOD:188,633-UNIMOD:4,635-UNIMOD:188,148-UNIMOD:188,379-UNIMOD:267,389-UNIMOD:267	0.05	37.0	5	3	1
PRT	sp|P18206-2|VINC_HUMAN	Isoform 1 of Vinculin OS=Homo sapiens OX=9606 GN=VCL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	285-UNIMOD:267,300-UNIMOD:267	0.02	37.0	3	1	0
PRT	sp|Q9GZP4-2|PITH1_HUMAN	Isoform 2 of PITH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PITHD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	186-UNIMOD:4,198-UNIMOD:267	0.09	37.0	2	1	0
PRT	sp|Q9NPI6-2|DCP1A_HUMAN	Isoform 2 of mRNA-decapping enzyme 1A OS=Homo sapiens OX=9606 GN=DCP1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.03	37.0	1	1	1
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null	224-UNIMOD:188,489-UNIMOD:188,499-UNIMOD:188	0.07	37.0	7	4	1
PRT	sp|P31939|PUR9_HUMAN	Bifunctional purine biosynthesis protein PURH OS=Homo sapiens OX=9606 GN=ATIC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	285-UNIMOD:188	0.06	37.0	2	2	2
PRT	sp|P54577|SYYC_HUMAN	Tyrosine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=YARS1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	380-UNIMOD:188,391-UNIMOD:188,146-UNIMOD:188,147-UNIMOD:188	0.06	37.0	4	2	0
PRT	sp|P06737-2|PYGL_HUMAN	Isoform 2 of Glycogen phosphorylase, liver form OS=Homo sapiens OX=9606 GN=PYGL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	138-UNIMOD:267,151-UNIMOD:267	0.02	37.0	2	1	0
PRT	sp|Q04637-6|IF4G1_HUMAN	Isoform E of Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.01	37.0	1	1	1
PRT	sp|Q9BVA1|TBB2B_HUMAN	Tubulin beta-2B chain OS=Homo sapiens OX=9606 GN=TUBB2B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	122-UNIMOD:188,127-UNIMOD:4,129-UNIMOD:4,154-UNIMOD:188	0.08	37.0	1	1	1
PRT	sp|Q9NZT2-2|OGFR_HUMAN	Isoform 2 of Opioid growth factor receptor OS=Homo sapiens OX=9606 GN=OGFR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	234-UNIMOD:267	0.08	37.0	2	2	2
PRT	sp|Q96I24-2|FUBP3_HUMAN	Isoform 2 of Far upstream element-binding protein 3 OS=Homo sapiens OX=9606 GN=FUBP3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	136-UNIMOD:35	0.07	37.0	1	1	1
PRT	sp|Q08211|DHX9_HUMAN	ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	37.0	null	1140-UNIMOD:267,1154-UNIMOD:267,1137-UNIMOD:28,692-UNIMOD:267	0.03	37.0	4	2	1
PRT	sp|Q9NXG2|THUM1_HUMAN	THUMP domain-containing protein 1 OS=Homo sapiens OX=9606 GN=THUMPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.05	37.0	1	1	1
PRT	sp|O60256-4|KPRB_HUMAN	Isoform 4 of Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Homo sapiens OX=9606 GN=PRPSAP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.08	37.0	2	1	0
PRT	sp|Q9Y285-2|SYFA_HUMAN	Isoform 2 of Phenylalanine--tRNA ligase alpha subunit OS=Homo sapiens OX=9606 GN=FARSA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.06	37.0	1	1	1
PRT	sp|P68363-2|TBA1B_HUMAN	Isoform 2 of Tubulin alpha-1B chain OS=Homo sapiens OX=9606 GN=TUBA1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	231-UNIMOD:4	0.04	37.0	1	1	1
PRT	sp|P49589-2|SYCC_HUMAN	Isoform 2 of Cysteine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=CARS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	13-UNIMOD:267,27-UNIMOD:4,28-UNIMOD:267	0.02	37.0	2	1	0
PRT	sp|Q9Y3A5|SBDS_HUMAN	Ribosome maturation protein SBDS OS=Homo sapiens OX=9606 GN=SBDS PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	45-UNIMOD:188,62-UNIMOD:188	0.09	37.0	3	1	0
PRT	sp|Q9P0M6|H2AW_HUMAN	Core histone macro-H2A.2 OS=Homo sapiens OX=9606 GN=H2AFY2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.06	37.0	2	1	0
PRT	sp|Q96EE3|SEH1_HUMAN	Nucleoporin SEH1 OS=Homo sapiens OX=9606 GN=SEH1L PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	77-UNIMOD:4,81-UNIMOD:267	0.06	37.0	2	1	0
PRT	sp|Q8NB37|GALD1_HUMAN	Glutamine amidotransferase-like class 1 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=GATD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null	94-UNIMOD:4,109-UNIMOD:267	0.11	37.0	5	1	0
PRT	sp|P04350|TBB4A_HUMAN	Tubulin beta-4A chain OS=Homo sapiens OX=9606 GN=TUBB4A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	122-UNIMOD:188,127-UNIMOD:4,129-UNIMOD:4,154-UNIMOD:188,147-UNIMOD:35	0.08	37.0	4	1	0
PRT	sp|P68363|TBA1B_HUMAN	Tubulin alpha-1B chain OS=Homo sapiens OX=9606 GN=TUBA1B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	null	85-UNIMOD:28	0.05	37.0	3	2	1
PRT	sp|Q71U36|TBA1A_HUMAN	Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null		0.04	37.0	4	1	0
PRT	sp|P53597|SUCA_HUMAN	Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=SUCLG1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	37.0	null	272-UNIMOD:28,280-UNIMOD:188,295-UNIMOD:267,297-UNIMOD:35,308-UNIMOD:188	0.11	37.0	4	2	0
PRT	sp|P48643|TCPE_HUMAN	T-complex protein 1 subunit epsilon OS=Homo sapiens OX=9606 GN=CCT5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	37.0	null	60-UNIMOD:35,64-UNIMOD:188,89-UNIMOD:188,253-UNIMOD:4,259-UNIMOD:188,261-UNIMOD:188	0.09	37.0	3	2	1
PRT	sp|P36578|RL4_HUMAN	60S ribosomal protein L4 OS=Homo sapiens OX=9606 GN=RPL4 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	37.0	null	208-UNIMOD:4	0.08	37.0	2	2	2
PRT	sp|O75369-2|FLNB_HUMAN	Isoform 2 of Filamin-B OS=Homo sapiens OX=9606 GN=FLNB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	2181-UNIMOD:267,2195-UNIMOD:267,838-UNIMOD:188,847-UNIMOD:188	0.01	36.0	3	2	1
PRT	sp|P00558-2|PGK1_HUMAN	Isoform 2 of Phosphoglycerate kinase 1 OS=Homo sapiens OX=9606 GN=PGK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.05	36.0	3	1	0
PRT	sp|P16152|CBR1_HUMAN	Carbonyl reductase [NADPH] 1 OS=Homo sapiens OX=9606 GN=CBR1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	242-UNIMOD:188,272-UNIMOD:188,71-UNIMOD:267	0.17	36.0	4	2	0
PRT	sp|P60842-2|IF4A1_HUMAN	Isoform 2 of Eukaryotic initiation factor 4A-I OS=Homo sapiens OX=9606 GN=EIF4A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	149-UNIMOD:35,161-UNIMOD:267	0.10	36.0	7	2	1
PRT	sp|P43490|NAMPT_HUMAN	Nicotinamide phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=NAMPT PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	88-UNIMOD:188,99-UNIMOD:188	0.03	36.0	3	1	0
PRT	sp|P43034|LIS1_HUMAN	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens OX=9606 GN=PAFAH1B1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	163-UNIMOD:188	0.04	36.0	3	1	0
PRT	sp|O94966-4|UBP19_HUMAN	Isoform 4 of Ubiquitin carboxyl-terminal hydrolase 19 OS=Homo sapiens OX=9606 GN=USP19	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	820-UNIMOD:4,821-UNIMOD:267,837-UNIMOD:267	0.02	36.0	1	1	1
PRT	sp|P62826|RAN_HUMAN	GTP-binding nuclear protein Ran OS=Homo sapiens OX=9606 GN=RAN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	60-UNIMOD:188,71-UNIMOD:188	0.14	36.0	6	2	0
PRT	sp|Q9NRN7|ADPPT_HUMAN	L-aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase OS=Homo sapiens OX=9606 GN=AASDHPPT PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.05	36.0	1	1	1
PRT	sp|Q9BUR5|MIC26_HUMAN	MICOS complex subunit MIC26 OS=Homo sapiens OX=9606 GN=APOO PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	71-UNIMOD:4,78-UNIMOD:4,86-UNIMOD:188,88-UNIMOD:188	0.11	36.0	3	1	0
PRT	sp|Q99623-2|PHB2_HUMAN	Isoform 2 of Prohibitin-2 OS=Homo sapiens OX=9606 GN=PHB2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	71-UNIMOD:267	0.07	36.0	3	1	0
PRT	sp|Q07666|KHDR1_HUMAN	KH domain-containing, RNA-binding, signal transduction-associated protein 1 OS=Homo sapiens OX=9606 GN=KHDRBS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	139-UNIMOD:188,152-UNIMOD:188	0.06	36.0	5	2	1
PRT	sp|Q9C075|K1C23_HUMAN	Keratin, type I cytoskeletal 23 OS=Homo sapiens OX=9606 GN=KRT23 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	117-UNIMOD:188,137-UNIMOD:188,42-UNIMOD:267	0.08	36.0	2	2	2
PRT	sp|Q7Z7F7|RM55_HUMAN	39S ribosomal protein L55, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL55 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.13	36.0	2	1	0
PRT	sp|P12814-2|ACTN1_HUMAN	Isoform 2 of Alpha-actinin-1 OS=Homo sapiens OX=9606 GN=ACTN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	633-UNIMOD:188,649-UNIMOD:188,577-UNIMOD:188	0.03	36.0	5	2	1
PRT	sp|Q01469|FABP5_HUMAN	Fatty acid-binding protein 5 OS=Homo sapiens OX=9606 GN=FABP5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	87-UNIMOD:4	0.17	36.0	2	1	0
PRT	sp|O00303|EIF3F_HUMAN	Eukaryotic translation initiation factor 3 subunit F OS=Homo sapiens OX=9606 GN=EIF3F PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	108-UNIMOD:267	0.04	36.0	2	1	0
PRT	sp|Q9P2J5|SYLC_HUMAN	Leucine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=LARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	573-UNIMOD:4,575-UNIMOD:267	0.01	36.0	2	1	0
PRT	sp|P23396|RS3_HUMAN	40S ribosomal protein S3 OS=Homo sapiens OX=9606 GN=RPS3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.07	36.0	2	1	0
PRT	sp|Q9UL25|RAB21_HUMAN	Ras-related protein Rab-21 OS=Homo sapiens OX=9606 GN=RAB21 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	67-UNIMOD:267,80-UNIMOD:267	0.07	36.0	1	1	1
PRT	sp|Q6NVY1-2|HIBCH_HUMAN	Isoform 2 of 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=HIBCH	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.06	36.0	1	1	1
PRT	sp|Q15738|NSDHL_HUMAN	Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating OS=Homo sapiens OX=9606 GN=NSDHL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	24-UNIMOD:188,31-UNIMOD:188	0.05	36.0	2	1	0
PRT	sp|Q14847-3|LASP1_HUMAN	Isoform 3 of LIM and SH3 domain protein 1 OS=Homo sapiens OX=9606 GN=LASP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	65-UNIMOD:188,72-UNIMOD:188	0.08	36.0	2	1	0
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	153-UNIMOD:35,177-UNIMOD:267,113-UNIMOD:188,313-UNIMOD:35,315-UNIMOD:188,326-UNIMOD:188,47-UNIMOD:35,217-UNIMOD:4,50-UNIMOD:188	0.27	36.0	12	5	1
PRT	sp|P31948|STIP1_HUMAN	Stress-induced-phosphoprotein 1 OS=Homo sapiens OX=9606 GN=STIP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	100-UNIMOD:188,109-UNIMOD:188	0.03	36.0	4	1	0
PRT	sp|P26640|SYVC_HUMAN	Valine--tRNA ligase OS=Homo sapiens OX=9606 GN=VARS1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	39-UNIMOD:267	0.01	36.0	4	1	0
PRT	sp|Q96HC4-7|PDLI5_HUMAN	Isoform 7 of PDZ and LIM domain protein 5 OS=Homo sapiens OX=9606 GN=PDLIM5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	158-UNIMOD:188	0.03	36.0	2	1	0
PRT	sp|Q13813|SPTN1_HUMAN	Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	315-UNIMOD:4,320-UNIMOD:267,335-UNIMOD:188	0.01	36.0	1	1	0
PRT	sp|Q9Y6M9|NDUB9_HUMAN	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 OS=Homo sapiens OX=9606 GN=NDUFB9 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	36.0	null	96-UNIMOD:4,98-UNIMOD:188,103-UNIMOD:4,112-UNIMOD:188	0.11	36.0	3	1	0
PRT	sp|P30048-2|PRDX3_HUMAN	Isoform 2 of Thioredoxin-dependent peroxide reductase, mitochondrial OS=Homo sapiens OX=9606 GN=PRDX3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	211-UNIMOD:4,223-UNIMOD:188,230-UNIMOD:188,148-UNIMOD:188,189-UNIMOD:267	0.26	35.0	7	3	0
PRT	sp|P36551-2|HEM6_HUMAN	Isoform 2 of Oxygen-dependent coproporphyrinogen-III oxidase, mitochondrial OS=Homo sapiens OX=9606 GN=CPOX	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	115-UNIMOD:267,126-UNIMOD:267	0.06	35.0	3	1	0
PRT	sp|Q14204|DYHC1_HUMAN	Cytoplasmic dynein 1 heavy chain 1 OS=Homo sapiens OX=9606 GN=DYNC1H1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	1999-UNIMOD:4,1992-UNIMOD:188,2004-UNIMOD:188,736-UNIMOD:188,748-UNIMOD:188	0.01	35.0	3	2	1
PRT	sp|O00159-2|MYO1C_HUMAN	Isoform 2 of Unconventional myosin-Ic OS=Homo sapiens OX=9606 GN=MYO1C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	189-UNIMOD:188,954-UNIMOD:188,970-UNIMOD:188	0.03	35.0	3	2	1
PRT	sp|P98179|RBM3_HUMAN	RNA-binding protein 3 OS=Homo sapiens OX=9606 GN=RBM3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	65-UNIMOD:267	0.12	35.0	2	1	0
PRT	sp|Q9UJA5-2|TRM6_HUMAN	Isoform 2 of tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6 OS=Homo sapiens OX=9606 GN=TRMT6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.08	35.0	2	2	1
PRT	sp|Q10713-2|MPPA_HUMAN	Isoform 2 of Mitochondrial-processing peptidase subunit alpha OS=Homo sapiens OX=9606 GN=PMPCA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	357-UNIMOD:188,382-UNIMOD:188	0.07	35.0	1	1	1
PRT	sp|Q96AB3-3|ISOC2_HUMAN	Isoform 3 of Isochorismatase domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ISOC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	43-UNIMOD:267	0.12	35.0	2	1	0
PRT	sp|P31943|HNRH1_HUMAN	Heterogeneous nuclear ribonucleoprotein H OS=Homo sapiens OX=9606 GN=HNRNPH1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	22-UNIMOD:4,16-UNIMOD:267,29-UNIMOD:267	0.07	35.0	3	2	1
PRT	sp|P13796|PLSL_HUMAN	Plastin-2 OS=Homo sapiens OX=9606 GN=LCP1 PE=1 SV=6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null	146-UNIMOD:35,164-UNIMOD:4	0.04	35.0	2	1	0
PRT	sp|Q96EP5-2|DAZP1_HUMAN	Isoform 2 of DAZ-associated protein 1 OS=Homo sapiens OX=9606 GN=DAZAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	124-UNIMOD:4,130-UNIMOD:267	0.04	35.0	2	1	0
PRT	sp|Q16531|DDB1_HUMAN	DNA damage-binding protein 1 OS=Homo sapiens OX=9606 GN=DDB1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	114-UNIMOD:267,128-UNIMOD:4,129-UNIMOD:267	0.02	35.0	2	1	0
PRT	sp|Q71U36-2|TBA1A_HUMAN	Isoform 2 of Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	245-UNIMOD:188,312-UNIMOD:4	0.08	35.0	6	2	1
PRT	sp|P08754|GNAI3_HUMAN	Guanine nucleotide-binding protein G(i) subunit alpha OS=Homo sapiens OX=9606 GN=GNAI3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	66-UNIMOD:4,67-UNIMOD:188,70-UNIMOD:188	0.05	35.0	4	1	0
PRT	sp|P55084-2|ECHB_HUMAN	Isoform 2 of Trifunctional enzyme subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=HADHB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	436-UNIMOD:4	0.06	35.0	1	1	1
PRT	sp|P35241|RADI_HUMAN	Radixin OS=Homo sapiens OX=9606 GN=RDX PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	544-UNIMOD:188,556-UNIMOD:188	0.02	35.0	3	1	0
PRT	sp|Q16881-5|TRXR1_HUMAN	Isoform 5 of Thioredoxin reductase 1, cytoplasmic OS=Homo sapiens OX=9606 GN=TXNRD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	457-UNIMOD:188	0.08	35.0	2	2	2
PRT	sp|P00568|KAD1_HUMAN	Adenylate kinase isoenzyme 1 OS=Homo sapiens OX=9606 GN=AK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	187-UNIMOD:4	0.12	35.0	1	1	1
PRT	sp|P05787|K2C8_HUMAN	Keratin, type II cytoskeletal 8 OS=Homo sapiens OX=9606 GN=KRT8 PE=1 SV=7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	118-UNIMOD:35,122-UNIMOD:188,130-UNIMOD:188	0.08	35.0	4	3	2
PRT	sp|P16989-2|YBOX3_HUMAN	Isoform 2 of Y-box-binding protein 3 OS=Homo sapiens OX=9606 GN=YBX3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	113-UNIMOD:188,124-UNIMOD:188	0.05	35.0	3	1	0
PRT	sp|O75083|WDR1_HUMAN	WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=WDR1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	65-UNIMOD:188,362-UNIMOD:188	0.09	35.0	5	2	0
PRT	sp|P34932|HSP74_HUMAN	Heat shock 70 kDa protein 4 OS=Homo sapiens OX=9606 GN=HSPA4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	310-UNIMOD:4,390-UNIMOD:267,405-UNIMOD:267,719-UNIMOD:188,733-UNIMOD:188	0.06	35.0	5	3	1
PRT	sp|Q6UWP7-3|LCLT1_HUMAN	Isoform 3 of Lysocardiolipin acyltransferase 1 OS=Homo sapiens OX=9606 GN=LCLAT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	232-UNIMOD:188	0.06	35.0	3	1	0
PRT	sp|Q92616|GCN1_HUMAN	eIF-2-alpha kinase activator GCN1 OS=Homo sapiens OX=9606 GN=GCN1 PE=1 SV=6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	101-UNIMOD:188	0.01	35.0	2	1	0
PRT	sp|Q00059-2|TFAM_HUMAN	Isoform 2 of Transcription factor A, mitochondrial OS=Homo sapiens OX=9606 GN=TFAM	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	165-UNIMOD:188,173-UNIMOD:188	0.07	35.0	2	1	0
PRT	sp|Q96QD8|S38A2_HUMAN	Sodium-coupled neutral amino acid transporter 2 OS=Homo sapiens OX=9606 GN=SLC38A2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	59-UNIMOD:188,60-UNIMOD:188	0.05	35.0	3	1	0
PRT	sp|P41252|SYIC_HUMAN	Isoleucine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=IARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	946-UNIMOD:267	0.03	35.0	3	2	1
PRT	sp|P30740|ILEU_HUMAN	Leukocyte elastase inhibitor OS=Homo sapiens OX=9606 GN=SERPINB1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.09	35.0	2	2	2
PRT	sp|P40937|RFC5_HUMAN	Replication factor C subunit 5 OS=Homo sapiens OX=9606 GN=RFC5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	194-UNIMOD:188,203-UNIMOD:188	0.06	35.0	2	1	0
PRT	sp|Q13617|CUL2_HUMAN	Cullin-2 OS=Homo sapiens OX=9606 GN=CUL2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null		0.02	35.0	1	1	1
PRT	sp|Q96PK6|RBM14_HUMAN	RNA-binding protein 14 OS=Homo sapiens OX=9606 GN=RBM14 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	108-UNIMOD:4	0.03	35.0	3	1	0
PRT	sp|Q5JVS0|HABP4_HUMAN	Intracellular hyaluronan-binding protein 4 OS=Homo sapiens OX=9606 GN=HABP4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	43-UNIMOD:267	0.04	35.0	1	1	0
PRT	sp|Q5T1M5|FKB15_HUMAN	FK506-binding protein 15 OS=Homo sapiens OX=9606 GN=FKBP15 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	640-UNIMOD:188,658-UNIMOD:188	0.02	34.0	1	1	1
PRT	sp|O75937|DNJC8_HUMAN	DnaJ homolog subfamily C member 8 OS=Homo sapiens OX=9606 GN=DNAJC8 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	127-UNIMOD:188,135-UNIMOD:188	0.07	34.0	3	1	0
PRT	sp|Q9UGI8-2|TES_HUMAN	Isoform 2 of Testin OS=Homo sapiens OX=9606 GN=TES	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	34.0	null	37-UNIMOD:4,37-UNIMOD:385,52-UNIMOD:267,53-UNIMOD:188	0.04	34.0	2	1	0
PRT	sp|P19623|SPEE_HUMAN	Spermidine synthase OS=Homo sapiens OX=9606 GN=SRM PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	123-UNIMOD:4	0.13	34.0	2	2	2
PRT	sp|P42224-2|STAT1_HUMAN	Isoform Beta of Signal transducer and activator of transcription 1-alpha/beta OS=Homo sapiens OX=9606 GN=STAT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	70-UNIMOD:267	0.02	34.0	1	1	1
PRT	sp|P52907|CAZA1_HUMAN	F-actin-capping protein subunit alpha-1 OS=Homo sapiens OX=9606 GN=CAPZA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null	37-UNIMOD:267,133-UNIMOD:188,141-UNIMOD:4,146-UNIMOD:188	0.13	34.0	3	2	1
PRT	sp|Q9P0L0|VAPA_HUMAN	Vesicle-associated membrane protein-associated protein A OS=Homo sapiens OX=9606 GN=VAPA PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null	26-UNIMOD:188,38-UNIMOD:188	0.06	34.0	2	1	0
PRT	sp|P51991|ROA3_HUMAN	Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens OX=9606 GN=HNRNPA3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	182-UNIMOD:188,187-UNIMOD:188	0.06	34.0	3	1	0
PRT	sp|O75694-2|NU155_HUMAN	Isoform 2 of Nuclear pore complex protein Nup155 OS=Homo sapiens OX=9606 GN=NUP155	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	1	1	1
PRT	sp|P53621|COPA_HUMAN	Coatomer subunit alpha OS=Homo sapiens OX=9606 GN=COPA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	227-UNIMOD:267	0.02	34.0	2	1	0
PRT	sp|Q16539-2|MK14_HUMAN	Isoform CSBP1 of Mitogen-activated protein kinase 14 OS=Homo sapiens OX=9606 GN=MAPK14	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	94-UNIMOD:267	0.14	34.0	3	2	1
PRT	sp|Q6RFH5-2|WDR74_HUMAN	Isoform 2 of WD repeat-containing protein 74 OS=Homo sapiens OX=9606 GN=WDR74	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	81-UNIMOD:267	0.04	34.0	2	1	0
PRT	sp|Q12792-4|TWF1_HUMAN	Isoform 4 of Twinfilin-1 OS=Homo sapiens OX=9606 GN=TWF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	86-UNIMOD:267	0.06	34.0	2	1	0
PRT	sp|P60174-4|TPIS_HUMAN	Isoform 4 of Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	31-UNIMOD:188	0.08	34.0	2	1	0
PRT	sp|P35244|RFA3_HUMAN	Replication protein A 14 kDa subunit OS=Homo sapiens OX=9606 GN=RPA3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	26-UNIMOD:4	0.31	34.0	2	2	2
PRT	sp|P09622-2|DLDH_HUMAN	Isoform 2 of Dihydrolipoyl dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=DLD	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.05	34.0	1	1	0
PRT	sp|Q13509-2|TBB3_HUMAN	Isoform 2 of Tubulin beta-3 chain OS=Homo sapiens OX=9606 GN=TUBB3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	52-UNIMOD:4,55-UNIMOD:4,57-UNIMOD:4	0.09	34.0	1	1	1
PRT	sp|Q15424-2|SAFB1_HUMAN	Isoform 2 of Scaffold attachment factor B1 OS=Homo sapiens OX=9606 GN=SAFB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	287-UNIMOD:188,293-UNIMOD:4,301-UNIMOD:188	0.02	34.0	2	1	0
PRT	sp|Q00610-2|CLH1_HUMAN	Isoform 2 of Clathrin heavy chain 1 OS=Homo sapiens OX=9606 GN=CLTC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	245-UNIMOD:188	0.03	34.0	5	3	1
PRT	sp|P04844-2|RPN2_HUMAN	Isoform 2 of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Homo sapiens OX=9606 GN=RPN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	274-UNIMOD:188,279-UNIMOD:188	0.08	34.0	5	2	0
PRT	sp|P20700|LMNB1_HUMAN	Lamin-B1 OS=Homo sapiens OX=9606 GN=LMNB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null	261-UNIMOD:188,271-UNIMOD:188	0.02	34.0	5	1	0
PRT	sp|Q9H0U4|RAB1B_HUMAN	Ras-related protein Rab-1B OS=Homo sapiens OX=9606 GN=RAB1B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	173-UNIMOD:35	0.08	34.0	1	1	1
PRT	sp|Q14108-2|SCRB2_HUMAN	Isoform 2 of Lysosome membrane protein 2 OS=Homo sapiens OX=9606 GN=SCARB2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.06	34.0	1	1	1
PRT	sp|Q9NZB2-4|F120A_HUMAN	Isoform D of Constitutive coactivator of PPAR-gamma-like protein 1 OS=Homo sapiens OX=9606 GN=FAM120A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.04	34.0	3	2	1
PRT	sp|Q9BV40|VAMP8_HUMAN	Vesicle-associated membrane protein 8 OS=Homo sapiens OX=9606 GN=VAMP8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	47-UNIMOD:188,59-UNIMOD:188	0.15	34.0	2	1	0
PRT	sp|P21796|VDAC1_HUMAN	Voltage-dependent anion-selective channel protein 1 OS=Homo sapiens OX=9606 GN=VDAC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	274-UNIMOD:188	0.06	34.0	1	1	1
PRT	sp|Q9NPF4|OSGEP_HUMAN	Probable tRNA N6-adenosine threonylcarbamoyltransferase OS=Homo sapiens OX=9606 GN=OSGEP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.06	34.0	1	1	1
PRT	sp|Q8TEQ6|GEMI5_HUMAN	Gem-associated protein 5 OS=Homo sapiens OX=9606 GN=GEMIN5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	860-UNIMOD:188,867-UNIMOD:4,874-UNIMOD:188	0.01	34.0	2	1	0
PRT	sp|P08727|K1C19_HUMAN	Keratin, type I cytoskeletal 19 OS=Homo sapiens OX=9606 GN=KRT19 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	280-UNIMOD:267,291-UNIMOD:35,293-UNIMOD:267	0.12	34.0	10	3	2
PRT	sp|P07355-2|ANXA2_HUMAN	Isoform 2 of Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	81-UNIMOD:267,151-UNIMOD:4,153-UNIMOD:267	0.10	34.0	6	3	1
PRT	sp|P07108|ACBP_HUMAN	Acyl-CoA-binding protein OS=Homo sapiens OX=9606 GN=DBI PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	25-UNIMOD:35,19-UNIMOD:188,33-UNIMOD:188	0.20	34.0	7	1	0
PRT	sp|P06748|NPM_HUMAN	Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	65-UNIMOD:35,54-UNIMOD:188,73-UNIMOD:188	0.10	34.0	4	1	0
PRT	sp|P60891|PRPS1_HUMAN	Ribose-phosphate pyrophosphokinase 1 OS=Homo sapiens OX=9606 GN=PRPS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	260-UNIMOD:267	0.06	34.0	1	1	0
PRT	sp|Q9UKD2|MRT4_HUMAN	mRNA turnover protein 4 homolog OS=Homo sapiens OX=9606 GN=MRTO4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	34.0	null	86-UNIMOD:188,94-UNIMOD:188	0.07	34.0	2	1	0
PRT	sp|O14974|MYPT1_HUMAN	Protein phosphatase 1 regulatory subunit 12A OS=Homo sapiens OX=9606 GN=PPP1R12A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null		0.02	34.0	1	1	1
PRT	sp|Q9Y5J1|UTP18_HUMAN	U3 small nucleolar RNA-associated protein 18 homolog OS=Homo sapiens OX=9606 GN=UTP18 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	1	1	1
PRT	sp|Q13838|DX39B_HUMAN	Spliceosome RNA helicase DDX39B OS=Homo sapiens OX=9606 GN=DDX39B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	63-UNIMOD:4,75-UNIMOD:4,87-UNIMOD:4,90-UNIMOD:188,83-UNIMOD:35,165-UNIMOD:4	0.11	33.0	4	2	1
PRT	sp|Q13813-3|SPTN1_HUMAN	Isoform 3 of Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	315-UNIMOD:4,2284-UNIMOD:35,2295-UNIMOD:267	0.02	33.0	4	2	0
PRT	sp|O15355|PPM1G_HUMAN	Protein phosphatase 1G OS=Homo sapiens OX=9606 GN=PPM1G PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	1	1	1
PRT	sp|P35580|MYH10_HUMAN	Myosin-10 OS=Homo sapiens OX=9606 GN=MYH10 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.01	33.0	1	1	1
PRT	sp|Q8N6T3-4|ARFG1_HUMAN	Isoform 4 of ADP-ribosylation factor GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=ARFGAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	140-UNIMOD:188,145-UNIMOD:188	0.07	33.0	2	1	0
PRT	sp|P62917|RL8_HUMAN	60S ribosomal protein L8 OS=Homo sapiens OX=9606 GN=RPL8 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	144-UNIMOD:188,145-UNIMOD:188	0.07	33.0	2	1	0
PRT	sp|Q8IY67-2|RAVR1_HUMAN	Isoform 2 of Ribonucleoprotein PTB-binding 1 OS=Homo sapiens OX=9606 GN=RAVER1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	222-UNIMOD:4,224-UNIMOD:4,239-UNIMOD:4,227-UNIMOD:267,240-UNIMOD:267,524-UNIMOD:188	0.09	33.0	5	3	2
PRT	sp|Q9BPX3|CND3_HUMAN	Condensin complex subunit 3 OS=Homo sapiens OX=9606 GN=NCAPG PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	551-UNIMOD:188,559-UNIMOD:188	0.01	33.0	1	1	1
PRT	sp|Q9H488-2|OFUT1_HUMAN	Isoform 2 of GDP-fucose protein O-fucosyltransferase 1 OS=Homo sapiens OX=9606 GN=POFUT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	59-UNIMOD:188	0.09	33.0	2	1	0
PRT	sp|P31153-2|METK2_HUMAN	Isoform 2 of S-adenosylmethionine synthase isoform type-2 OS=Homo sapiens OX=9606 GN=MAT2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.06	33.0	1	1	1
PRT	sp|O95347-2|SMC2_HUMAN	Isoform 2 of Structural maintenance of chromosomes protein 2 OS=Homo sapiens OX=9606 GN=SMC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	958-UNIMOD:188	0.01	33.0	2	1	0
PRT	sp|P30101|PDIA3_HUMAN	Protein disulfide-isomerase A3 OS=Homo sapiens OX=9606 GN=PDIA3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	107-UNIMOD:267,119-UNIMOD:267	0.03	33.0	2	1	0
PRT	sp|Q9C0C9|UBE2O_HUMAN	(E3-independent) E2 ubiquitin-conjugating enzyme OS=Homo sapiens OX=9606 GN=UBE2O PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	1	1	1
PRT	sp|P22102|PUR2_HUMAN	Trifunctional purine biosynthetic protein adenosine-3 OS=Homo sapiens OX=9606 GN=GART PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	62-UNIMOD:4,692-UNIMOD:267	0.04	33.0	2	2	2
PRT	sp|Q07021|C1QBP_HUMAN	Complement component 1 Q subcomponent-binding protein, mitochondrial OS=Homo sapiens OX=9606 GN=C1QBP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	186-UNIMOD:4	0.10	33.0	1	1	1
PRT	sp|P11413|G6PD_HUMAN	Glucose-6-phosphate 1-dehydrogenase OS=Homo sapiens OX=9606 GN=G6PD PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	411-UNIMOD:35,158-UNIMOD:4,166-UNIMOD:267	0.07	33.0	4	2	0
PRT	sp|Q9HC35-2|EMAL4_HUMAN	Isoform 2 of Echinoderm microtubule-associated protein-like 4 OS=Homo sapiens OX=9606 GN=EML4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	63-UNIMOD:188,64-UNIMOD:188	0.02	33.0	2	1	0
PRT	sp|Q92598-2|HS105_HUMAN	Isoform Beta of Heat shock protein 105 kDa OS=Homo sapiens OX=9606 GN=HSPH1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	221-UNIMOD:188,234-UNIMOD:188	0.05	33.0	2	2	2
PRT	sp|Q6DKJ4|NXN_HUMAN	Nucleoredoxin OS=Homo sapiens OX=9606 GN=NXN PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	61-UNIMOD:267,83-UNIMOD:267	0.06	33.0	1	1	1
PRT	sp|P07814|SYEP_HUMAN	Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens OX=9606 GN=EPRS1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	1251-UNIMOD:35,1480-UNIMOD:4,1487-UNIMOD:4,1484-UNIMOD:188,1494-UNIMOD:188	0.02	33.0	3	2	1
PRT	sp|Q92890-3|UFD1_HUMAN	Isoform 3 of Ubiquitin recognition factor in ER-associated degradation protein 1 OS=Homo sapiens OX=9606 GN=UFD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	226-UNIMOD:267	0.09	33.0	4	1	0
PRT	sp|P56192-2|SYMC_HUMAN	Isoform 2 of Methionine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=MARS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	1	1	1
PRT	sp|Q00839-2|HNRPU_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.06	33.0	4	3	2
PRT	sp|O15213|WDR46_HUMAN	WD repeat-containing protein 46 OS=Homo sapiens OX=9606 GN=WDR46 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	1	1	1
PRT	sp|P26368-2|U2AF2_HUMAN	Isoform 2 of Splicing factor U2AF 65 kDa subunit OS=Homo sapiens OX=9606 GN=U2AF2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	425-UNIMOD:4	0.04	33.0	1	1	1
PRT	sp|Q15185-4|TEBP_HUMAN	Isoform 4 of Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	35-UNIMOD:188,40-UNIMOD:4,48-UNIMOD:188,95-UNIMOD:188,107-UNIMOD:188	0.22	33.0	4	2	0
PRT	sp|Q99439-2|CNN2_HUMAN	Isoform 2 of Calponin-2 OS=Homo sapiens OX=9606 GN=CNN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	93-UNIMOD:188	0.06	33.0	1	1	1
PRT	sp|Q07157-2|ZO1_HUMAN	Isoform Short of Tight junction protein ZO-1 OS=Homo sapiens OX=9606 GN=TJP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.01	33.0	2	1	0
PRT	sp|Q9UPT5-4|EXOC7_HUMAN	Isoform 4 of Exocyst complex component 7 OS=Homo sapiens OX=9606 GN=EXOC7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	83-UNIMOD:4,99-UNIMOD:188	0.07	33.0	2	1	0
PRT	sp|P62191-2|PRS4_HUMAN	Isoform 2 of 26S proteasome regulatory subunit 4 OS=Homo sapiens OX=9606 GN=PSMC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.06	33.0	1	1	1
PRT	sp|P38571-2|LICH_HUMAN	Isoform 2 of Lysosomal acid lipase/cholesteryl ester hydrolase OS=Homo sapiens OX=9606 GN=LIPA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.08	33.0	1	1	1
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	1	1	1
PRT	sp|P08758|ANXA5_HUMAN	Annexin A5 OS=Homo sapiens OX=9606 GN=ANXA5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.05	33.0	1	1	1
PRT	sp|P61088|UBE2N_HUMAN	Ubiquitin-conjugating enzyme E2 N OS=Homo sapiens OX=9606 GN=UBE2N PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.14	33.0	2	1	0
PRT	sp|Q96I15|SCLY_HUMAN	Selenocysteine lyase OS=Homo sapiens OX=9606 GN=SCLY PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	293-UNIMOD:267,307-UNIMOD:188	0.04	33.0	1	1	0
PRT	sp|P52292|IMA1_HUMAN	Importin subunit alpha-1 OS=Homo sapiens OX=9606 GN=KPNA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null		0.04	33.0	1	1	1
PRT	sp|Q9BRA2|TXD17_HUMAN	Thioredoxin domain-containing protein 17 OS=Homo sapiens OX=9606 GN=TXNDC17 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	25-UNIMOD:188,35-UNIMOD:188	0.15	33.0	2	1	0
PRT	sp|O15067|PUR4_HUMAN	Phosphoribosylformylglycinamidine synthase OS=Homo sapiens OX=9606 GN=PFAS PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	502-UNIMOD:4,512-UNIMOD:4	0.02	32.0	1	1	1
PRT	sp|P50991-2|TCPD_HUMAN	Isoform 2 of T-complex protein 1 subunit delta OS=Homo sapiens OX=9606 GN=CCT4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	215-UNIMOD:188,222-UNIMOD:4,227-UNIMOD:188	0.06	32.0	2	2	2
PRT	sp|Q02878|RL6_HUMAN	60S ribosomal protein L6 OS=Homo sapiens OX=9606 GN=RPL6 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	156-UNIMOD:267	0.06	32.0	2	1	0
PRT	sp|O60927|PP1RB_HUMAN	E3 ubiquitin-protein ligase PPP1R11 OS=Homo sapiens OX=9606 GN=PPP1R11 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.21	32.0	1	1	1
PRT	sp|Q6PGP7|TTC37_HUMAN	Tetratricopeptide repeat protein 37 OS=Homo sapiens OX=9606 GN=TTC37 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.01	32.0	1	1	1
PRT	sp|Q8WUM4|PDC6I_HUMAN	Programmed cell death 6-interacting protein OS=Homo sapiens OX=9606 GN=PDCD6IP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	512-UNIMOD:4	0.02	32.0	1	1	1
PRT	sp|Q49A26-5|GLYR1_HUMAN	Isoform 5 of Putative oxidoreductase GLYR1 OS=Homo sapiens OX=9606 GN=GLYR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	1	1	1
PRT	sp|Q9Y3I0|RTCB_HUMAN	RNA-splicing ligase RtcB homolog OS=Homo sapiens OX=9606 GN=RTCB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	193-UNIMOD:4	0.10	32.0	2	2	2
PRT	sp|Q5VTE0|EF1A3_HUMAN	Putative elongation factor 1-alpha-like 3 OS=Homo sapiens OX=9606 GN=EEF1A1P5 PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	146-UNIMOD:188	0.03	32.0	2	1	0
PRT	sp|P09327-2|VILI_HUMAN	Isoform 2 of Villin-1 OS=Homo sapiens OX=9606 GN=VIL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	285-UNIMOD:4	0.06	32.0	2	1	0
PRT	sp|Q7Z5L9-3|I2BP2_HUMAN	Isoform 3 of Interferon regulatory factor 2-binding protein 2 OS=Homo sapiens OX=9606 GN=IRF2BP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	81-UNIMOD:4,82-UNIMOD:4,85-UNIMOD:4,88-UNIMOD:267	0.25	32.0	2	1	0
PRT	sp|Q08J23-2|NSUN2_HUMAN	Isoform 2 of RNA cytosine C(5)-methyltransferase NSUN2 OS=Homo sapiens OX=9606 GN=NSUN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|O00429-9|DNM1L_HUMAN	Isoform 9 of Dynamin-1-like protein OS=Homo sapiens OX=9606 GN=DNM1L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	610-UNIMOD:267	0.02	32.0	2	1	0
PRT	sp|Q9GZR7-2|DDX24_HUMAN	Isoform 2 of ATP-dependent RNA helicase DDX24 OS=Homo sapiens OX=9606 GN=DDX24	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	751-UNIMOD:188	0.02	32.0	1	1	1
PRT	sp|P13797-3|PLST_HUMAN	Isoform 3 of Plastin-3 OS=Homo sapiens OX=9606 GN=PLS3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	113-UNIMOD:188,537-UNIMOD:188,542-UNIMOD:188	0.05	32.0	4	2	0
PRT	sp|Q53H12|AGK_HUMAN	Acylglycerol kinase, mitochondrial OS=Homo sapiens OX=9606 GN=AGK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.06	32.0	1	1	1
PRT	sp|Q9Y3S2|ZN330_HUMAN	Zinc finger protein 330 OS=Homo sapiens OX=9606 GN=ZNF330 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	114-UNIMOD:4,120-UNIMOD:4,122-UNIMOD:4,129-UNIMOD:4,132-UNIMOD:4	0.07	32.0	1	1	1
PRT	sp|P35998-2|PRS7_HUMAN	Isoform 2 of 26S proteasome regulatory subunit 7 OS=Homo sapiens OX=9606 GN=PSMC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	1	1	1
PRT	sp|P54136-2|SYRC_HUMAN	Isoform Monomeric of Arginine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=RARS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	297-UNIMOD:4	0.05	32.0	2	2	2
PRT	sp|P19367-4|HXK1_HUMAN	Isoform 4 of Hexokinase-1 OS=Homo sapiens OX=9606 GN=HK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	135-UNIMOD:188,146-UNIMOD:4,150-UNIMOD:188	0.02	32.0	1	1	1
PRT	sp|P27708|PYR1_HUMAN	CAD protein OS=Homo sapiens OX=9606 GN=CAD PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	1889-UNIMOD:4,280-UNIMOD:4,287-UNIMOD:267,379-UNIMOD:4,394-UNIMOD:267	0.03	32.0	6	3	1
PRT	sp|P36404|ARL2_HUMAN	ADP-ribosylation factor-like protein 2 OS=Homo sapiens OX=9606 GN=ARL2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	61-UNIMOD:188,71-UNIMOD:188	0.22	32.0	2	2	2
PRT	sp|O14776-2|TCRG1_HUMAN	Isoform 2 of Transcription elongation regulator 1 OS=Homo sapiens OX=9606 GN=TCERG1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.01	32.0	1	1	1
PRT	sp|P84103-2|SRSF3_HUMAN	Isoform 2 of Serine/arginine-rich splicing factor 3 OS=Homo sapiens OX=9606 GN=SRSF3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	57-UNIMOD:267,64-UNIMOD:267	0.18	32.0	2	1	0
PRT	sp|P27695|APEX1_HUMAN	DNA-(apurinic or apyrimidinic site) lyase OS=Homo sapiens OX=9606 GN=APEX1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	138-UNIMOD:4	0.07	32.0	1	1	1
PRT	sp|Q13501|SQSTM_HUMAN	Sequestosome-1 OS=Homo sapiens OX=9606 GN=SQSTM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	22-UNIMOD:267,26-UNIMOD:4,27-UNIMOD:4,44-UNIMOD:4,46-UNIMOD:267,128-UNIMOD:4,131-UNIMOD:4,139-UNIMOD:267	0.11	32.0	3	2	1
PRT	sp|P16615-5|AT2A2_HUMAN	Isoform 5 of Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Homo sapiens OX=9606 GN=ATP2A2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|P52732|KIF11_HUMAN	Kinesin-like protein KIF11 OS=Homo sapiens OX=9606 GN=KIF11 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	1034-UNIMOD:188,1045-UNIMOD:188	0.01	32.0	4	1	0
PRT	sp|Q99459|CDC5L_HUMAN	Cell division cycle 5-like protein OS=Homo sapiens OX=9606 GN=CDC5L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|Q96I15-2|SCLY_HUMAN	Isoform 2 of Selenocysteine lyase OS=Homo sapiens OX=9606 GN=SCLY	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.12	32.0	2	2	1
PRT	sp|P57740-3|NU107_HUMAN	Isoform 3 of Nuclear pore complex protein Nup107 OS=Homo sapiens OX=9606 GN=NUP107	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	366-UNIMOD:188	0.02	32.0	1	1	0
PRT	sp|P43304|GPDM_HUMAN	Glycerol-3-phosphate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=GPD2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	557-UNIMOD:267,572-UNIMOD:267	0.02	32.0	1	1	1
PRT	sp|P57740|NU107_HUMAN	Nuclear pore complex protein Nup107 OS=Homo sapiens OX=9606 GN=NUP107 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null		0.02	32.0	1	1	0
PRT	sp|Q86VP1|TAXB1_HUMAN	Tax1-binding protein 1 OS=Homo sapiens OX=9606 GN=TAX1BP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|Q6IBS0|TWF2_HUMAN	Twinfilin-2 OS=Homo sapiens OX=9606 GN=TWF2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null		0.05	32.0	2	1	0
PRT	sp|P26639|SYTC_HUMAN	Threonine--tRNA ligase 1, cytoplasmic OS=Homo sapiens OX=9606 GN=TARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|Q5SWX8-3|ODR4_HUMAN	Isoform 3 of Protein odr-4 homolog OS=Homo sapiens OX=9606 GN=ODR4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	77-UNIMOD:4	0.06	31.0	1	1	1
PRT	sp|P17987|TCPA_HUMAN	T-complex protein 1 subunit alpha OS=Homo sapiens OX=9606 GN=TCP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	541-UNIMOD:188	0.03	31.0	2	1	0
PRT	sp|P54886-2|P5CS_HUMAN	Isoform Short of Delta-1-pyrroline-5-carboxylate synthase OS=Homo sapiens OX=9606 GN=ALDH18A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	604-UNIMOD:4,610-UNIMOD:4	0.03	31.0	1	1	0
PRT	sp|P62910|RL32_HUMAN	60S ribosomal protein L32 OS=Homo sapiens OX=9606 GN=RPL32 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null	50-UNIMOD:188,64-UNIMOD:188	0.13	31.0	2	1	0
PRT	sp|Q15008-3|PSMD6_HUMAN	Isoform 3 of 26S proteasome non-ATPase regulatory subunit 6 OS=Homo sapiens OX=9606 GN=PSMD6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	218-UNIMOD:267	0.05	31.0	2	1	0
PRT	sp|Q8NEV1|CSK23_HUMAN	Casein kinase II subunit alpha 3 OS=Homo sapiens OX=9606 GN=CSNK2A3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.05	31.0	1	1	1
PRT	sp|Q9H6T3-3|RPAP3_HUMAN	Isoform 3 of RNA polymerase II-associated protein 3 OS=Homo sapiens OX=9606 GN=RPAP3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	254-UNIMOD:267	0.03	31.0	2	1	0
PRT	sp|P42167|LAP2B_HUMAN	Lamina-associated polypeptide 2, isoforms beta/gamma OS=Homo sapiens OX=9606 GN=TMPO PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	319-UNIMOD:267	0.07	31.0	5	2	1
PRT	sp|P46777|RL5_HUMAN	60S ribosomal protein L5 OS=Homo sapiens OX=9606 GN=RPL5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.04	31.0	1	1	1
PRT	sp|O15111|IKKA_HUMAN	Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Homo sapiens OX=9606 GN=CHUK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	1	1	1
PRT	sp|P62277|RS13_HUMAN	40S ribosomal protein S13 OS=Homo sapiens OX=9606 GN=RPS13 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.09	31.0	1	1	1
PRT	sp|P31150|GDIA_HUMAN	Rab GDP dissociation inhibitor alpha OS=Homo sapiens OX=9606 GN=GDI1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	335-UNIMOD:4	0.05	31.0	1	1	1
PRT	sp|P35249-2|RFC4_HUMAN	Isoform 2 of Replication factor C subunit 4 OS=Homo sapiens OX=9606 GN=RFC4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.07	31.0	1	1	1
PRT	sp|Q9Y618-5|NCOR2_HUMAN	Isoform 4 of Nuclear receptor corepressor 2 OS=Homo sapiens OX=9606 GN=NCOR2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.01	31.0	1	1	1
PRT	sp|P20073-2|ANXA7_HUMAN	Isoform 2 of Annexin A7 OS=Homo sapiens OX=9606 GN=ANXA7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	305-UNIMOD:4,309-UNIMOD:267,326-UNIMOD:267	0.06	31.0	2	1	0
PRT	sp|P46100-2|ATRX_HUMAN	Isoform 1 of Transcriptional regulator ATRX OS=Homo sapiens OX=9606 GN=ATRX	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.01	31.0	1	1	1
PRT	sp|P00403|COX2_HUMAN	Cytochrome c oxidase subunit 2 OS=Homo sapiens OX=9606 GN=MT-CO2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	152-UNIMOD:35,153-UNIMOD:35	0.09	31.0	2	1	0
PRT	sp|P30876|RPB2_HUMAN	DNA-directed RNA polymerase II subunit RPB2 OS=Homo sapiens OX=9606 GN=POLR2B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	984-UNIMOD:4,988-UNIMOD:188	0.01	31.0	2	1	0
PRT	sp|P31930|QCR1_HUMAN	Cytochrome b-c1 complex subunit 1, mitochondrial OS=Homo sapiens OX=9606 GN=UQCRC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	99-UNIMOD:188	0.03	31.0	2	1	0
PRT	sp|P49257|LMAN1_HUMAN	Protein ERGIC-53 OS=Homo sapiens OX=9606 GN=LMAN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	190-UNIMOD:4,192-UNIMOD:267	0.06	31.0	1	1	1
PRT	sp|P62249|RS16_HUMAN	40S ribosomal protein S16 OS=Homo sapiens OX=9606 GN=RPS16 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.10	31.0	1	1	1
PRT	sp|P47756-2|CAPZB_HUMAN	Isoform 2 of F-actin-capping protein subunit beta OS=Homo sapiens OX=9606 GN=CAPZB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	206-UNIMOD:4	0.08	31.0	2	1	0
PRT	sp|P18124|RL7_HUMAN	60S ribosomal protein L7 OS=Homo sapiens OX=9606 GN=RPL7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.05	31.0	1	1	1
PRT	sp|Q15437|SC23B_HUMAN	Protein transport protein Sec23B OS=Homo sapiens OX=9606 GN=SEC23B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	1	1	1
PRT	sp|Q9H6H4|REEP4_HUMAN	Receptor expression-enhancing protein 4 OS=Homo sapiens OX=9606 GN=REEP4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	180-UNIMOD:267	0.09	31.0	1	1	1
PRT	sp|Q9BXS4|TMM59_HUMAN	Transmembrane protein 59 OS=Homo sapiens OX=9606 GN=TMEM59 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	302-UNIMOD:188,315-UNIMOD:188	0.05	31.0	2	1	0
PRT	sp|Q03426|KIME_HUMAN	Mevalonate kinase OS=Homo sapiens OX=9606 GN=MVK PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.04	31.0	1	1	1
PRT	sp|Q9UGP8|SEC63_HUMAN	Translocation protein SEC63 homolog OS=Homo sapiens OX=9606 GN=SEC63 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	396-UNIMOD:267	0.02	31.0	2	1	0
PRT	sp|P30044-2|PRDX5_HUMAN	Isoform Cytoplasmic+peroxisomal of Peroxiredoxin-5, mitochondrial OS=Homo sapiens OX=9606 GN=PRDX5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.09	31.0	1	1	1
PRT	sp|Q6PIU2-3|NCEH1_HUMAN	Isoform 3 of Neutral cholesterol ester hydrolase 1 OS=Homo sapiens OX=9606 GN=NCEH1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	212-UNIMOD:4,223-UNIMOD:35	0.08	31.0	2	1	0
PRT	sp|P12956-2|XRCC6_HUMAN	Isoform 2 of X-ray repair cross-complementing protein 6 OS=Homo sapiens OX=9606 GN=XRCC6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	524-UNIMOD:188,529-UNIMOD:188	0.03	31.0	2	1	0
PRT	sp|A0MZ66-2|SHOT1_HUMAN	Isoform 2 of Shootin-1 OS=Homo sapiens OX=9606 GN=SHTN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.04	31.0	1	1	1
PRT	sp|Q9BRQ8-2|FSP1_HUMAN	Isoform 2 of Ferroptosis suppressor protein 1 OS=Homo sapiens OX=9606 GN=AIFM2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	249-UNIMOD:4	0.07	31.0	1	1	1
PRT	sp|P09110-2|THIK_HUMAN	Isoform 2 of 3-ketoacyl-CoA thiolase, peroxisomal OS=Homo sapiens OX=9606 GN=ACAA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	288-UNIMOD:4	0.06	31.0	1	1	1
PRT	sp|Q9UQ16-5|DYN3_HUMAN	Isoform 5 of Dynamin-3 OS=Homo sapiens OX=9606 GN=DNM3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.04	31.0	1	1	1
PRT	sp|Q06203|PUR1_HUMAN	Amidophosphoribosyltransferase OS=Homo sapiens OX=9606 GN=PPAT PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	100-UNIMOD:4,105-UNIMOD:4	0.05	31.0	2	1	0
PRT	sp|P22626|ROA2_HUMAN	Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	22-UNIMOD:188,38-UNIMOD:267	0.05	31.0	1	1	0
PRT	sp|P68104|EF1A1_HUMAN	Elongation factor 1-alpha 1 OS=Homo sapiens OX=9606 GN=EEF1A1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.04	31.0	1	1	1
PRT	sp|Q9BZK7|TBL1R_HUMAN	F-box-like/WD repeat-containing protein TBL1XR1 OS=Homo sapiens OX=9606 GN=TBL1XR1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	null	380-UNIMOD:28,383-UNIMOD:4,392-UNIMOD:188,398-UNIMOD:188	0.04	31.0	1	1	1
PRT	sp|P62633|CNBP_HUMAN	Cellular nucleic acid-binding protein OS=Homo sapiens OX=9606 GN=CNBP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	null	57-UNIMOD:385,57-UNIMOD:4,67-UNIMOD:4,74-UNIMOD:4,77-UNIMOD:4,65-UNIMOD:188,79-UNIMOD:267	0.14	31.0	2	1	0
PRT	sp|P13929|ENOB_HUMAN	Beta-enolase OS=Homo sapiens OX=9606 GN=ENO3 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.07	31.0	2	1	0
PRT	sp|Q8TAT6|NPL4_HUMAN	Nuclear protein localization protein 4 homolog OS=Homo sapiens OX=9606 GN=NPLOC4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.03	31.0	1	1	1
PRT	sp|P98175|RBM10_HUMAN	RNA-binding protein 10 OS=Homo sapiens OX=9606 GN=RBM10 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.02	31.0	1	1	0
PRT	sp|A0AVT1|UBA6_HUMAN	Ubiquitin-like modifier-activating enzyme 6 OS=Homo sapiens OX=9606 GN=UBA6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	null	581-UNIMOD:385,581-UNIMOD:4,586-UNIMOD:267,597-UNIMOD:188	0.02	31.0	2	1	0
PRT	sp|P37837|TALDO_HUMAN	Transaldolase OS=Homo sapiens OX=9606 GN=TALDO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	286-UNIMOD:188,292-UNIMOD:188	0.05	30.0	1	1	1
PRT	sp|Q14160-2|SCRIB_HUMAN	Isoform 2 of Protein scribble homolog OS=Homo sapiens OX=9606 GN=SCRIB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	1274-UNIMOD:267	0.02	30.0	1	1	1
PRT	sp|Q14690|RRP5_HUMAN	Protein RRP5 homolog OS=Homo sapiens OX=9606 GN=PDCD11 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	1754-UNIMOD:4,1758-UNIMOD:188,1766-UNIMOD:188	0.01	30.0	2	1	0
PRT	sp|P49753-2|ACOT2_HUMAN	Isoform 2 of Acyl-coenzyme A thioesterase 2, mitochondrial OS=Homo sapiens OX=9606 GN=ACOT2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.06	30.0	1	1	1
PRT	sp|O43670-3|ZN207_HUMAN	Isoform 3 of BUB3-interacting and GLEBS motif-containing protein ZNF207 OS=Homo sapiens OX=9606 GN=ZNF207	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	24-UNIMOD:188,31-UNIMOD:188	0.04	30.0	2	1	0
PRT	sp|Q9H910-2|JUPI2_HUMAN	Isoform 2 of Jupiter microtubule associated homolog 2 OS=Homo sapiens OX=9606 GN=JPT2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	102-UNIMOD:4,108-UNIMOD:188,112-UNIMOD:188	0.10	30.0	2	1	0
PRT	sp|P45880-2|VDAC2_HUMAN	Isoform 2 of Voltage-dependent anion-selective channel protein 2 OS=Homo sapiens OX=9606 GN=VDAC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	20-UNIMOD:188,28-UNIMOD:188	0.05	30.0	2	1	0
PRT	sp|P55854|SUMO3_HUMAN	Small ubiquitin-related modifier 3 OS=Homo sapiens OX=9606 GN=SUMO3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	11-UNIMOD:188,20-UNIMOD:188	0.14	30.0	1	1	1
PRT	sp|P61956-2|SUMO2_HUMAN	Isoform 2 of Small ubiquitin-related modifier 2 OS=Homo sapiens OX=9606 GN=SUMO2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	11-UNIMOD:188,21-UNIMOD:188	0.21	30.0	2	1	0
PRT	sp|P38646|GRP75_HUMAN	Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	2	1	0
PRT	sp|Q7Z7K6-2|CENPV_HUMAN	Isoform 2 of Centromere protein V OS=Homo sapiens OX=9606 GN=CENPV	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.13	30.0	1	1	1
PRT	sp|P98175-4|RBM10_HUMAN	Isoform 4 of RNA-binding protein 10 OS=Homo sapiens OX=9606 GN=RBM10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	109-UNIMOD:267	0.02	30.0	2	1	0
PRT	sp|P46013-2|KI67_HUMAN	Isoform Short of Proliferation marker protein Ki-67 OS=Homo sapiens OX=9606 GN=MKI67	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	1249-UNIMOD:188,1252-UNIMOD:188	0.01	30.0	1	1	1
PRT	sp|Q9Y2U8|MAN1_HUMAN	Inner nuclear membrane protein Man1 OS=Homo sapiens OX=9606 GN=LEMD3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	1	1	1
PRT	sp|P62857|RS28_HUMAN	40S ribosomal protein S28 OS=Homo sapiens OX=9606 GN=RPS28 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	51-UNIMOD:267,63-UNIMOD:267	0.25	30.0	1	1	1
PRT	sp|Q9NW08-2|RPC2_HUMAN	Isoform 2 of DNA-directed RNA polymerase III subunit RPC2 OS=Homo sapiens OX=9606 GN=POLR3B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	757-UNIMOD:4	0.02	30.0	1	1	1
PRT	sp|O43390-3|HNRPR_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein R OS=Homo sapiens OX=9606 GN=HNRNPR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	202-UNIMOD:4	0.02	30.0	1	1	1
PRT	sp|O15066-2|KIF3B_HUMAN	Isoform 2 of Kinesin-like protein KIF3B OS=Homo sapiens OX=9606 GN=KIF3B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	222-UNIMOD:188	0.04	30.0	2	1	0
PRT	sp|Q0VDG4-2|SCRN3_HUMAN	Isoform 2 of Secernin-3 OS=Homo sapiens OX=9606 GN=SCRN3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	359-UNIMOD:188,361-UNIMOD:188	0.04	30.0	1	1	1
PRT	sp|O75533|SF3B1_HUMAN	Splicing factor 3B subunit 1 OS=Homo sapiens OX=9606 GN=SF3B1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|P61106|RAB14_HUMAN	Ras-related protein Rab-14 OS=Homo sapiens OX=9606 GN=RAB14 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.14	30.0	1	1	1
PRT	sp|Q9Y2X3|NOP58_HUMAN	Nucleolar protein 58 OS=Homo sapiens OX=9606 GN=NOP58 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	310-UNIMOD:188	0.03	30.0	1	1	1
PRT	sp|O60610-2|DIAP1_HUMAN	Isoform 2 of Protein diaphanous homolog 1 OS=Homo sapiens OX=9606 GN=DIAPH1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	511-UNIMOD:188,518-UNIMOD:188	0.01	30.0	2	1	0
PRT	sp|Q92541|RTF1_HUMAN	RNA polymerase-associated protein RTF1 homolog OS=Homo sapiens OX=9606 GN=RTF1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|O75131|CPNE3_HUMAN	Copine-3 OS=Homo sapiens OX=9606 GN=CPNE3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	406-UNIMOD:267	0.03	30.0	2	1	0
PRT	sp|Q14978|NOLC1_HUMAN	Nucleolar and coiled-body phosphoprotein 1 OS=Homo sapiens OX=9606 GN=NOLC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	1	1	1
PRT	sp|Q9BY77-2|PDIP3_HUMAN	Isoform 2 of Polymerase delta-interacting protein 3 OS=Homo sapiens OX=9606 GN=POLDIP3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	294-UNIMOD:188	0.08	30.0	2	2	2
PRT	sp|P78527-2|PRKDC_HUMAN	Isoform 2 of DNA-dependent protein kinase catalytic subunit OS=Homo sapiens OX=9606 GN=PRKDC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	2683-UNIMOD:188	0.01	30.0	2	2	2
PRT	sp|P07737|PROF1_HUMAN	Profilin-1 OS=Homo sapiens OX=9606 GN=PFN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.14	30.0	1	1	1
PRT	sp|O43395|PRPF3_HUMAN	U4/U6 small nuclear ribonucleoprotein Prp3 OS=Homo sapiens OX=9606 GN=PRPF3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|Q06830|PRDX1_HUMAN	Peroxiredoxin-1 OS=Homo sapiens OX=9606 GN=PRDX1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	30.0	null	94-UNIMOD:28,109-UNIMOD:188,110-UNIMOD:267,93-UNIMOD:188	0.16	30.0	6	3	1
PRT	sp|Q13263|TIF1B_HUMAN	Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	412-UNIMOD:267,427-UNIMOD:267	0.03	30.0	2	1	0
PRT	sp|P02768|ALBU_HUMAN	Serum albumin OS=Homo sapiens OX=9606 GN=ALB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null		0.03	30.0	2	1	0
PRT	sp|Q12788|TBL3_HUMAN	Transducin beta-like protein 3 OS=Homo sapiens OX=9606 GN=TBL3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	413-UNIMOD:4,428-UNIMOD:4,429-UNIMOD:4,431-UNIMOD:267	0.03	29.0	2	1	0
PRT	sp|O94875-9|SRBS2_HUMAN	Isoform 9 of Sorbin and SH3 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=SORBS2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	2	1	0
PRT	sp|P47755|CAZA2_HUMAN	F-actin-capping protein subunit alpha-2 OS=Homo sapiens OX=9606 GN=CAPZA2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	141-UNIMOD:4	0.06	29.0	1	1	1
PRT	sp|O75955-2|FLOT1_HUMAN	Isoform 2 of Flotillin-1 OS=Homo sapiens OX=9606 GN=FLOT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	118-UNIMOD:188	0.04	29.0	2	1	0
PRT	sp|Q9BX68|HINT2_HUMAN	Histidine triad nucleotide-binding protein 2, mitochondrial OS=Homo sapiens OX=9606 GN=HINT2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.10	29.0	1	1	1
PRT	sp|Q9Y394-2|DHRS7_HUMAN	Isoform 2 of Dehydrogenase/reductase SDR family member 7 OS=Homo sapiens OX=9606 GN=DHRS7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.08	29.0	1	1	1
PRT	sp|Q92667-2|AKAP1_HUMAN	Isoform 2 of A-kinase anchor protein 1, mitochondrial OS=Homo sapiens OX=9606 GN=AKAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.04	29.0	2	1	0
PRT	sp|Q86W92-3|LIPB1_HUMAN	Isoform 3 of Liprin-beta-1 OS=Homo sapiens OX=9606 GN=PPFIBP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	45-UNIMOD:267,58-UNIMOD:267	0.02	29.0	1	1	1
PRT	sp|Q99615-2|DNJC7_HUMAN	Isoform 2 of DnaJ homolog subfamily C member 7 OS=Homo sapiens OX=9606 GN=DNAJC7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	23-UNIMOD:267,34-UNIMOD:267	0.03	29.0	1	1	1
PRT	sp|P08865|RSSA_HUMAN	40S ribosomal protein SA OS=Homo sapiens OX=9606 GN=RPSA PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.06	29.0	1	1	1
PRT	sp|Q9Y3E5|PTH2_HUMAN	Peptidyl-tRNA hydrolase 2, mitochondrial OS=Homo sapiens OX=9606 GN=PTRH2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	86-UNIMOD:4	0.09	29.0	1	1	1
PRT	sp|Q9UN86-2|G3BP2_HUMAN	Isoform B of Ras GTPase-activating protein-binding protein 2 OS=Homo sapiens OX=9606 GN=G3BP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.05	29.0	2	1	0
PRT	sp|P13010|XRCC5_HUMAN	X-ray repair cross-complementing protein 5 OS=Homo sapiens OX=9606 GN=XRCC5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	141-UNIMOD:267	0.03	29.0	2	2	2
PRT	sp|P50454|SERPH_HUMAN	Serpin H1 OS=Homo sapiens OX=9606 GN=SERPINH1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	332-UNIMOD:188	0.03	29.0	2	1	0
PRT	sp|Q14103-3|HNRPD_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein D0 OS=Homo sapiens OX=9606 GN=HNRNPD	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.06	29.0	1	1	1
PRT	sp|Q16555-2|DPYL2_HUMAN	Isoform 2 of Dihydropyrimidinase-related protein 2 OS=Homo sapiens OX=9606 GN=DPYSL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.05	29.0	1	1	1
PRT	sp|Q15758-3|AAAT_HUMAN	Isoform 3 of Neutral amino acid transporter B(0) OS=Homo sapiens OX=9606 GN=SLC1A5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.04	29.0	1	1	1
PRT	sp|O60264|SMCA5_HUMAN	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Homo sapiens OX=9606 GN=SMARCA5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|O14980|XPO1_HUMAN	Exportin-1 OS=Homo sapiens OX=9606 GN=XPO1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	492-UNIMOD:188	0.01	29.0	2	1	0
PRT	sp|P40429|RL13A_HUMAN	60S ribosomal protein L13a OS=Homo sapiens OX=9606 GN=RPL13A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	103-UNIMOD:188,114-UNIMOD:188,2-UNIMOD:1	0.16	29.0	2	2	2
PRT	sp|Q27J81-2|INF2_HUMAN	Isoform 2 of Inverted formin-2 OS=Homo sapiens OX=9606 GN=INF2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	1	1	1
PRT	sp|Q9BXP5-5|SRRT_HUMAN	Isoform 5 of Serrate RNA effector molecule homolog OS=Homo sapiens OX=9606 GN=SRRT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	451-UNIMOD:267,453-UNIMOD:4,461-UNIMOD:267	0.02	29.0	1	1	1
PRT	sp|Q9Y333|LSM2_HUMAN	U6 snRNA-associated Sm-like protein LSm2 OS=Homo sapiens OX=9606 GN=LSM2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	50-UNIMOD:188,58-UNIMOD:188	0.21	29.0	2	1	0
PRT	sp|Q99729-3|ROAA_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein A/B OS=Homo sapiens OX=9606 GN=HNRNPAB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	72-UNIMOD:35,83-UNIMOD:188,84-UNIMOD:188	0.05	29.0	1	1	1
PRT	sp|P52272-2|HNRPM_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein M OS=Homo sapiens OX=9606 GN=HNRNPM	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	380-UNIMOD:35,390-UNIMOD:267	0.02	29.0	2	1	0
PRT	sp|P17931|LEG3_HUMAN	Galectin-3 OS=Homo sapiens OX=9606 GN=LGALS3 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.06	29.0	1	1	1
PRT	sp|Q3KQV9|UAP1L_HUMAN	UDP-N-acetylhexosamine pyrophosphorylase-like protein 1 OS=Homo sapiens OX=9606 GN=UAP1L1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.04	29.0	2	1	0
PRT	sp|Q9NTJ3|SMC4_HUMAN	Structural maintenance of chromosomes protein 4 OS=Homo sapiens OX=9606 GN=SMC4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	1	1	1
PRT	sp|P53634|CATC_HUMAN	Dipeptidyl peptidase 1 OS=Homo sapiens OX=9606 GN=CTSC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	1	1	1
PRT	sp|Q8NBX0|SCPDL_HUMAN	Saccharopine dehydrogenase-like oxidoreductase OS=Homo sapiens OX=9606 GN=SCCPDH PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	1	1	1
PRT	sp|O60493-2|SNX3_HUMAN	Isoform 2 of Sorting nexin-3 OS=Homo sapiens OX=9606 GN=SNX3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	72-UNIMOD:267,86-UNIMOD:267	0.15	29.0	2	1	0
PRT	sp|Q9Y2L1-2|RRP44_HUMAN	Isoform 2 of Exosome complex exonuclease RRP44 OS=Homo sapiens OX=9606 GN=DIS3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	519-UNIMOD:4	0.02	29.0	1	1	1
PRT	sp|Q9UNH7-2|SNX6_HUMAN	Isoform 2 of Sorting nexin-6 OS=Homo sapiens OX=9606 GN=SNX6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.08	29.0	1	1	1
PRT	sp|P55809-2|SCOT1_HUMAN	Isoform 2 of Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial OS=Homo sapiens OX=9606 GN=OXCT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	39-UNIMOD:188,49-UNIMOD:188	0.11	29.0	2	1	0
PRT	sp|P49419-2|AL7A1_HUMAN	Isoform 2 of Alpha-aminoadipic semialdehyde dehydrogenase OS=Homo sapiens OX=9606 GN=ALDH7A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	347-UNIMOD:188	0.04	29.0	2	1	0
PRT	sp|P34949-2|MPI_HUMAN	Isoform 2 of Mannose-6-phosphate isomerase OS=Homo sapiens OX=9606 GN=MPI	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	87-UNIMOD:188,99-UNIMOD:188	0.04	29.0	2	1	0
PRT	sp|Q9BUP3-2|HTAI2_HUMAN	Isoform 2 of Oxidoreductase HTATIP2 OS=Homo sapiens OX=9606 GN=HTATIP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	36-UNIMOD:188,46-UNIMOD:188	0.11	29.0	1	1	1
PRT	sp|O75607|NPM3_HUMAN	Nucleoplasmin-3 OS=Homo sapiens OX=9606 GN=NPM3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	41-UNIMOD:4,48-UNIMOD:267	0.12	29.0	2	1	0
PRT	sp|P11940|PABP1_HUMAN	Polyadenylate-binding protein 1 OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	132-UNIMOD:4,138-UNIMOD:188,153-UNIMOD:267	0.04	29.0	3	1	0
PRT	sp|P52272|HNRPM_HUMAN	Heterogeneous nuclear ribonucleoprotein M OS=Homo sapiens OX=9606 GN=HNRNPM PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|Q32P51|RA1L2_HUMAN	Heterogeneous nuclear ribonucleoprotein A1-like 2 OS=Homo sapiens OX=9606 GN=HNRNPA1L2 PE=2 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	null		0.06	29.0	1	1	0
PRT	sp|O15498|YKT6_HUMAN	Synaptobrevin homolog YKT6 OS=Homo sapiens OX=9606 GN=YKT6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	66-UNIMOD:4	0.08	29.0	1	1	1
PRT	sp|Q9UN37|VPS4A_HUMAN	Vacuolar protein sorting-associated protein 4A OS=Homo sapiens OX=9606 GN=VPS4A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	null	218-UNIMOD:28,233-UNIMOD:4	0.05	29.0	1	1	1
PRT	sp|P0DMV8|HS71A_HUMAN	Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	301-UNIMOD:267,306-UNIMOD:4,311-UNIMOD:267	0.02	29.0	1	1	0
PRT	sp|P11216|PYGB_HUMAN	Glycogen phosphorylase, brain form OS=Homo sapiens OX=9606 GN=PYGB PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null		0.01	29.0	1	1	1
PRT	sp|Q96Q05|TPPC9_HUMAN	Trafficking protein particle complex subunit 9 OS=Homo sapiens OX=9606 GN=TRAPPC9 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	270-UNIMOD:267,283-UNIMOD:267	0.01	29.0	1	1	1
PRT	sp|P80303-2|NUCB2_HUMAN	Isoform 2 of Nucleobindin-2 OS=Homo sapiens OX=9606 GN=NUCB2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|P02545-5|LMNA_HUMAN	Isoform 5 of Prelamin-A/C OS=Homo sapiens OX=9606 GN=LMNA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	36-UNIMOD:188,45-UNIMOD:188,161-UNIMOD:188,162-UNIMOD:188	0.04	28.0	5	2	1
PRT	sp|P48741|HSP77_HUMAN	Putative heat shock 70 kDa protein 7 OS=Homo sapiens OX=9606 GN=HSPA7 PE=5 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	308-UNIMOD:4	0.04	28.0	1	1	0
PRT	sp|P04792|HSPB1_HUMAN	Heat shock protein beta-1 OS=Homo sapiens OX=9606 GN=HSPB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.07	28.0	1	1	1
PRT	sp|Q8NBS9-2|TXND5_HUMAN	Isoform 2 of Thioredoxin domain-containing protein 5 OS=Homo sapiens OX=9606 GN=TXNDC5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	179-UNIMOD:267,188-UNIMOD:267	0.05	28.0	1	1	1
PRT	sp|P60866|RS20_HUMAN	40S ribosomal protein S20 OS=Homo sapiens OX=9606 GN=RPS20 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.13	28.0	2	1	0
PRT	sp|Q9UBE0|SAE1_HUMAN	SUMO-activating enzyme subunit 1 OS=Homo sapiens OX=9606 GN=SAE1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	141-UNIMOD:188,146-UNIMOD:4,148-UNIMOD:188	0.04	28.0	1	1	1
PRT	sp|P43243|MATR3_HUMAN	Matrin-3 OS=Homo sapiens OX=9606 GN=MATR3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	552-UNIMOD:4,554-UNIMOD:188,555-UNIMOD:188	0.02	28.0	2	1	0
PRT	sp|Q15459-2|SF3A1_HUMAN	Isoform 2 of Splicing factor 3A subunit 1 OS=Homo sapiens OX=9606 GN=SF3A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	95-UNIMOD:267	0.02	28.0	2	1	0
PRT	sp|Q9UHN6-2|CEIP2_HUMAN	Isoform 2 of Cell surface hyaluronidase OS=Homo sapiens OX=9606 GN=CEMIP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|O75821|EIF3G_HUMAN	Eukaryotic translation initiation factor 3 subunit G OS=Homo sapiens OX=9606 GN=EIF3G PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	57-UNIMOD:188,65-UNIMOD:188	0.11	28.0	1	1	1
PRT	sp|Q99797|MIPEP_HUMAN	Mitochondrial intermediate peptidase OS=Homo sapiens OX=9606 GN=MIPEP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	83-UNIMOD:188	0.03	28.0	1	1	1
PRT	sp|Q9Y2Z4|SYYM_HUMAN	Tyrosine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=YARS2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|Q8IUD2-4|RB6I2_HUMAN	Isoform 4 of ELKS/Rab6-interacting/CAST family member 1 OS=Homo sapiens OX=9606 GN=ERC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|Q9NVH1-3|DJC11_HUMAN	Isoform 3 of DnaJ homolog subfamily C member 11 OS=Homo sapiens OX=9606 GN=DNAJC11	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|Q99880|H2B1L_HUMAN	Histone H2B type 1-L OS=Homo sapiens OX=9606 GN=H2BC13 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	117-UNIMOD:188,121-UNIMOD:188	0.10	28.0	2	1	0
PRT	sp|P18669|PGAM1_HUMAN	Phosphoglycerate mutase 1 OS=Homo sapiens OX=9606 GN=PGAM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	21-UNIMOD:267	0.05	28.0	2	1	0
PRT	sp|Q9H4L4|SENP3_HUMAN	Sentrin-specific protease 3 OS=Homo sapiens OX=9606 GN=SENP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|P68036-2|UB2L3_HUMAN	Isoform 2 of Ubiquitin-conjugating enzyme E2 L3 OS=Homo sapiens OX=9606 GN=UBE2L3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.13	28.0	1	1	1
PRT	sp|O00116|ADAS_HUMAN	Alkyldihydroxyacetonephosphate synthase, peroxisomal OS=Homo sapiens OX=9606 GN=AGPS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	214-UNIMOD:4,220-UNIMOD:188	0.03	28.0	1	1	1
PRT	sp|P42345|MTOR_HUMAN	Serine/threonine-protein kinase mTOR OS=Homo sapiens OX=9606 GN=MTOR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|Q9BTW9-3|TBCD_HUMAN	Isoform 3 of Tubulin-specific chaperone D OS=Homo sapiens OX=9606 GN=TBCD	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.15	28.0	1	1	1
PRT	sp|P04843|RPN1_HUMAN	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Homo sapiens OX=9606 GN=RPN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	193-UNIMOD:267,204-UNIMOD:267	0.03	28.0	2	1	0
PRT	sp|Q92552|RT27_HUMAN	28S ribosomal protein S27, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS27 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.05	28.0	1	1	1
PRT	sp|P17152|TMM11_HUMAN	Transmembrane protein 11, mitochondrial OS=Homo sapiens OX=9606 GN=TMEM11 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.09	28.0	1	1	1
PRT	sp|P18615|NELFE_HUMAN	Negative elongation factor E OS=Homo sapiens OX=9606 GN=NELFE PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.06	28.0	1	1	1
PRT	sp|Q8WUA4|TF3C2_HUMAN	General transcription factor 3C polypeptide 2 OS=Homo sapiens OX=9606 GN=GTF3C2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	608-UNIMOD:4,617-UNIMOD:267	0.02	28.0	1	1	1
PRT	sp|P48739|PIPNB_HUMAN	Phosphatidylinositol transfer protein beta isoform OS=Homo sapiens OX=9606 GN=PITPNB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	74-UNIMOD:35	0.05	28.0	1	1	1
PRT	sp|P63279|UBC9_HUMAN	SUMO-conjugating enzyme UBC9 OS=Homo sapiens OX=9606 GN=UBE2I PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	62-UNIMOD:35	0.09	28.0	1	1	1
PRT	sp|P08133-2|ANXA6_HUMAN	Isoform 2 of Annexin A6 OS=Homo sapiens OX=9606 GN=ANXA6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	547-UNIMOD:188,548-UNIMOD:188,410-UNIMOD:188	0.05	28.0	2	2	2
PRT	sp|Q14558|KPRA_HUMAN	Phosphoribosyl pyrophosphate synthase-associated protein 1 OS=Homo sapiens OX=9606 GN=PRPSAP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	236-UNIMOD:188	0.05	28.0	1	1	1
PRT	sp|Q8IWX8|CHERP_HUMAN	Calcium homeostasis endoplasmic reticulum protein OS=Homo sapiens OX=9606 GN=CHERP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|Q9UQ80-2|PA2G4_HUMAN	Isoform 2 of Proliferation-associated protein 2G4 OS=Homo sapiens OX=9606 GN=PA2G4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.10	28.0	2	2	2
PRT	sp|P13647|K2C5_HUMAN	Keratin, type II cytoskeletal 5 OS=Homo sapiens OX=9606 GN=KRT5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	73-UNIMOD:267,84-UNIMOD:267	0.02	28.0	1	1	1
PRT	sp|P25205-2|MCM3_HUMAN	Isoform 2 of DNA replication licensing factor MCM3 OS=Homo sapiens OX=9606 GN=MCM3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	437-UNIMOD:267,448-UNIMOD:267,364-UNIMOD:4	0.03	28.0	2	2	2
PRT	sp|Q8TDD1|DDX54_HUMAN	ATP-dependent RNA helicase DDX54 OS=Homo sapiens OX=9606 GN=DDX54 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|Q9UHQ4|BAP29_HUMAN	B-cell receptor-associated protein 29 OS=Homo sapiens OX=9606 GN=BCAP29 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.07	28.0	1	1	1
PRT	sp|P51149|RAB7A_HUMAN	Ras-related protein Rab-7a OS=Homo sapiens OX=9606 GN=RAB7A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	103-UNIMOD:267,113-UNIMOD:267	0.08	28.0	2	1	0
PRT	sp|Q8WWM7-6|ATX2L_HUMAN	Isoform 6 of Ataxin-2-like protein OS=Homo sapiens OX=9606 GN=ATXN2L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	428-UNIMOD:267,443-UNIMOD:267	0.02	28.0	2	1	0
PRT	sp|P40939|ECHA_HUMAN	Trifunctional enzyme subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=HADHA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	460-UNIMOD:188,470-UNIMOD:4,489-UNIMOD:188,215-UNIMOD:35	0.10	28.0	4	3	2
PRT	sp|P49642|PRI1_HUMAN	DNA primase small subunit OS=Homo sapiens OX=9606 GN=PRIM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|P16070-15|CD44_HUMAN	Isoform 15 of CD44 antigen OS=Homo sapiens OX=9606 GN=CD44	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	90-UNIMOD:267	0.04	28.0	1	1	1
PRT	sp|Q9UJA5|TRM6_HUMAN	tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6 OS=Homo sapiens OX=9606 GN=TRMT6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	367-UNIMOD:267	0.02	28.0	1	1	0
PRT	sp|A8MXV4|NUD19_HUMAN	Nucleoside diphosphate-linked moiety X motif 19 OS=Homo sapiens OX=9606 GN=NUDT19 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	28.0	null	111-UNIMOD:188,125-UNIMOD:267	0.14	28.0	2	2	2
PRT	sp|P53618|COPB_HUMAN	Coatomer subunit beta OS=Homo sapiens OX=9606 GN=COPB1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	2	2	2
PRT	sp|Q96HS1|PGAM5_HUMAN	Serine/threonine-protein phosphatase PGAM5, mitochondrial OS=Homo sapiens OX=9606 GN=PGAM5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	218-UNIMOD:267,229-UNIMOD:4,235-UNIMOD:267	0.08	28.0	1	1	1
PRT	sp|P69905|HBA_HUMAN	Hemoglobin subunit alpha OS=Homo sapiens OX=9606 GN=HBA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null		0.11	28.0	1	1	1
PRT	sp|Q96JH7|VCIP1_HUMAN	Deubiquitinating protein VCIP135 OS=Homo sapiens OX=9606 GN=VCPIP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	658-UNIMOD:188,675-UNIMOD:267	0.02	28.0	1	1	1
PRT	sp|Q01813|PFKAP_HUMAN	ATP-dependent 6-phosphofructokinase, platelet type OS=Homo sapiens OX=9606 GN=PFKP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|Q9Y6D9-3|MD1L1_HUMAN	Isoform 2 of Mitotic spindle assembly checkpoint protein MAD1 OS=Homo sapiens OX=9606 GN=MAD1L1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|Q92900-2|RENT1_HUMAN	Isoform 2 of Regulator of nonsense transcripts 1 OS=Homo sapiens OX=9606 GN=UPF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	123-UNIMOD:4,126-UNIMOD:4,133-UNIMOD:4,137-UNIMOD:4,141-UNIMOD:188	0.02	27.0	1	1	1
PRT	sp|P62195-2|PRS8_HUMAN	Isoform 2 of 26S proteasome regulatory subunit 8 OS=Homo sapiens OX=9606 GN=PSMC5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	250-UNIMOD:267	0.05	27.0	1	1	1
PRT	sp|P15880|RS2_HUMAN	40S ribosomal protein S2 OS=Homo sapiens OX=9606 GN=RPS2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.06	27.0	1	1	1
PRT	sp|P41567|EIF1_HUMAN	Eukaryotic translation initiation factor 1 OS=Homo sapiens OX=9606 GN=EIF1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	69-UNIMOD:4	0.23	27.0	2	1	0
PRT	sp|Q9UHX3-5|AGRE2_HUMAN	Isoform 5 of Adhesion G protein-coupled receptor E2 OS=Homo sapiens OX=9606 GN=ADGRE2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|Q9ULR0|ISY1_HUMAN	Pre-mRNA-splicing factor ISY1 homolog OS=Homo sapiens OX=9606 GN=ISY1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.07	27.0	1	1	1
PRT	sp|P20340-3|RAB6A_HUMAN	Isoform 3 of Ras-related protein Rab-6A OS=Homo sapiens OX=9606 GN=RAB6A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	15-UNIMOD:188,26-UNIMOD:188	0.13	27.0	1	1	1
PRT	sp|P62942|FKB1A_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Homo sapiens OX=9606 GN=FKBP1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.10	27.0	1	1	1
PRT	sp|Q9Y4L1|HYOU1_HUMAN	Hypoxia up-regulated protein 1 OS=Homo sapiens OX=9606 GN=HYOU1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	131-UNIMOD:267,51-UNIMOD:188,62-UNIMOD:188	0.03	27.0	2	2	2
PRT	sp|Q13151|ROA0_HUMAN	Heterogeneous nuclear ribonucleoprotein A0 OS=Homo sapiens OX=9606 GN=HNRNPA0 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.05	27.0	1	1	1
PRT	sp|Q9GZL7|WDR12_HUMAN	Ribosome biogenesis protein WDR12 OS=Homo sapiens OX=9606 GN=WDR12 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	203-UNIMOD:188,205-UNIMOD:4,211-UNIMOD:188	0.06	27.0	2	1	0
PRT	sp|Q9NUJ1-3|ABHDA_HUMAN	Isoform 3 of Mycophenolic acid acyl-glucuronide esterase, mitochondrial OS=Homo sapiens OX=9606 GN=ABHD10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	74-UNIMOD:188,92-UNIMOD:188	0.10	27.0	1	1	1
PRT	sp|Q6UX53|MET7B_HUMAN	Methyltransferase-like protein 7B OS=Homo sapiens OX=9606 GN=METTL7B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	202-UNIMOD:4,203-UNIMOD:4	0.05	27.0	1	1	1
PRT	sp|Q13608-2|PEX6_HUMAN	Isoform 2 of Peroxisome assembly factor 2 OS=Homo sapiens OX=9606 GN=PEX6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	564-UNIMOD:4,575-UNIMOD:267	0.03	27.0	1	1	1
PRT	sp|Q9UMY4-3|SNX12_HUMAN	Isoform 3 of Sorting nexin-12 OS=Homo sapiens OX=9606 GN=SNX12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	136-UNIMOD:267	0.08	27.0	2	1	0
PRT	sp|Q9Y6G9|DC1L1_HUMAN	Cytoplasmic dynein 1 light intermediate chain 1 OS=Homo sapiens OX=9606 GN=DYNC1LI1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	344-UNIMOD:188	0.02	27.0	1	1	1
PRT	sp|Q96RQ3|MCCA_HUMAN	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=MCCC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	409-UNIMOD:267	0.03	27.0	1	1	1
PRT	sp|P16144-5|ITB4_HUMAN	Isoform Beta-4E of Integrin beta-4 OS=Homo sapiens OX=9606 GN=ITGB4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|P46379-4|BAG6_HUMAN	Isoform 4 of Large proline-rich protein BAG6 OS=Homo sapiens OX=9606 GN=BAG6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	806-UNIMOD:267	0.02	27.0	1	1	1
PRT	sp|Q13247-3|SRSF6_HUMAN	Isoform SRP55-3 of Serine/arginine-rich splicing factor 6 OS=Homo sapiens OX=9606 GN=SRSF6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.04	27.0	1	1	1
PRT	sp|Q14152-2|EIF3A_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit A OS=Homo sapiens OX=9606 GN=EIF3A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	1216-UNIMOD:267,1226-UNIMOD:267	0.01	27.0	2	1	0
PRT	sp|P62805|H4_HUMAN	Histone H4 OS=Homo sapiens OX=9606 GN=H4C1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	46-UNIMOD:267,56-UNIMOD:267	0.12	27.0	2	1	0
PRT	sp|P15104|GLNA_HUMAN	Glutamine synthetase OS=Homo sapiens OX=9606 GN=GLUL PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	341-UNIMOD:267,346-UNIMOD:4,357-UNIMOD:267	0.05	27.0	1	1	1
PRT	sp|Q14241|ELOA1_HUMAN	Elongin-A OS=Homo sapiens OX=9606 GN=ELOA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|P78417-2|GSTO1_HUMAN	Isoform 2 of Glutathione S-transferase omega-1 OS=Homo sapiens OX=9606 GN=GSTO1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.09	27.0	1	1	1
PRT	sp|O00505|IMA4_HUMAN	Importin subunit alpha-4 OS=Homo sapiens OX=9606 GN=KPNA3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	174-UNIMOD:4,191-UNIMOD:4,192-UNIMOD:267	0.05	27.0	1	1	1
PRT	sp|P04920-2|B3A2_HUMAN	Isoform B1 of Anion exchange protein 2 OS=Homo sapiens OX=9606 GN=SLC4A2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	32-UNIMOD:267,43-UNIMOD:267	0.01	27.0	2	1	0
PRT	sp|Q96ER9-2|MITOK_HUMAN	Isoform 2 of Mitochondrial potassium channel OS=Homo sapiens OX=9606 GN=CCDC51	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	33-UNIMOD:267,47-UNIMOD:267	0.06	27.0	1	1	1
PRT	sp|P17812-2|PYRG1_HUMAN	Isoform 2 of CTP synthase 1 OS=Homo sapiens OX=9606 GN=CTPS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.07	27.0	1	1	1
PRT	sp|Q709C8-4|VP13C_HUMAN	Isoform 4 of Vacuolar protein sorting-associated protein 13C OS=Homo sapiens OX=9606 GN=VPS13C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|O75369|FLNB_HUMAN	Filamin-B OS=Homo sapiens OX=9606 GN=FLNB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	864-UNIMOD:188,873-UNIMOD:188	0.01	27.0	1	1	1
PRT	sp|O60506|HNRPQ_HUMAN	Heterogeneous nuclear ribonucleoprotein Q OS=Homo sapiens OX=9606 GN=SYNCRIP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	237-UNIMOD:4,244-UNIMOD:267	0.02	27.0	1	1	1
PRT	sp|P13987|CD59_HUMAN	CD59 glycoprotein OS=Homo sapiens OX=9606 GN=CD59 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	null	64-UNIMOD:385,64-UNIMOD:4,66-UNIMOD:188,70-UNIMOD:4,78-UNIMOD:267	0.13	27.0	1	1	1
PRT	sp|Q9H773|DCTP1_HUMAN	dCTP pyrophosphatase 1 OS=Homo sapiens OX=9606 GN=DCTPP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	null	110-UNIMOD:385,110-UNIMOD:4	0.08	27.0	1	1	1
PRT	sp|Q9UKX7|NUP50_HUMAN	Nuclear pore complex protein Nup50 OS=Homo sapiens OX=9606 GN=NUP50 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|P01023|A2MG_HUMAN	Alpha-2-macroglobulin OS=Homo sapiens OX=9606 GN=A2M PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|P62753|RS6_HUMAN	40S ribosomal protein S6 OS=Homo sapiens OX=9606 GN=RPS6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	149-UNIMOD:188,154-UNIMOD:267	0.05	27.0	1	1	1
PRT	sp|P33316-2|DUT_HUMAN	Isoform 2 of Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=DUT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	17-UNIMOD:267,27-UNIMOD:267	0.08	26.0	1	1	1
PRT	sp|Q7Z417|NUFP2_HUMAN	Nuclear fragile X mental retardation-interacting protein 2 OS=Homo sapiens OX=9606 GN=NUFIP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|P11117-2|PPAL_HUMAN	Isoform 2 of Lysosomal acid phosphatase OS=Homo sapiens OX=9606 GN=ACP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	84-UNIMOD:267	0.09	26.0	1	1	1
PRT	sp|Q9BVJ6-2|UT14A_HUMAN	Isoform 2 of U3 small nucleolar RNA-associated protein 14 homolog A OS=Homo sapiens OX=9606 GN=UTP14A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	362-UNIMOD:267,372-UNIMOD:267	0.02	26.0	1	1	1
PRT	sp|O14964-2|HGS_HUMAN	Isoform 2 of Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	166-UNIMOD:4	0.03	26.0	1	1	1
PRT	sp|P11717|MPRI_HUMAN	Cation-independent mannose-6-phosphate receptor OS=Homo sapiens OX=9606 GN=IGF2R PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	1065-UNIMOD:267	0.01	26.0	1	1	1
PRT	sp|P25705-2|ATPA_HUMAN	Isoform 2 of ATP synthase subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|P11172-2|UMPS_HUMAN	Isoform 2 of Uridine 5'-monophosphate synthase OS=Homo sapiens OX=9606 GN=UMPS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	185-UNIMOD:267	0.04	26.0	1	1	1
PRT	sp|O94973|AP2A2_HUMAN	AP-2 complex subunit alpha-2 OS=Homo sapiens OX=9606 GN=AP2A2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	282-UNIMOD:4	0.01	26.0	1	1	1
PRT	sp|Q13177|PAK2_HUMAN	Serine/threonine-protein kinase PAK 2 OS=Homo sapiens OX=9606 GN=PAK2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.06	26.0	1	1	1
PRT	sp|Q99613-2|EIF3C_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit C OS=Homo sapiens OX=9606 GN=EIF3C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	321-UNIMOD:188,322-UNIMOD:188	0.01	26.0	2	1	0
PRT	sp|Q8TBF4|ZCRB1_HUMAN	Zinc finger CCHC-type and RNA-binding motif-containing protein 1 OS=Homo sapiens OX=9606 GN=ZCRB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	67-UNIMOD:4	0.09	26.0	1	1	1
PRT	sp|O43837-2|IDH3B_HUMAN	Isoform A of Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=IDH3B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	164-UNIMOD:267	0.03	26.0	1	1	1
PRT	sp|Q96KG9-5|SCYL1_HUMAN	Isoform 5 of N-terminal kinase-like protein OS=Homo sapiens OX=9606 GN=SCYL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	87-UNIMOD:188	0.03	26.0	1	1	1
PRT	sp|Q13404-6|UB2V1_HUMAN	Isoform 4 of Ubiquitin-conjugating enzyme E2 variant 1 OS=Homo sapiens OX=9606 GN=UBE2V1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	27-UNIMOD:4	0.16	26.0	1	1	1
PRT	sp|P23284|PPIB_HUMAN	Peptidyl-prolyl cis-trans isomerase B OS=Homo sapiens OX=9606 GN=PPIB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.08	26.0	1	1	1
PRT	sp|O94832|MYO1D_HUMAN	Unconventional myosin-Id OS=Homo sapiens OX=9606 GN=MYO1D PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	954-UNIMOD:188	0.01	26.0	1	1	1
PRT	sp|Q13435|SF3B2_HUMAN	Splicing factor 3B subunit 2 OS=Homo sapiens OX=9606 GN=SF3B2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q13428-5|TCOF_HUMAN	Isoform 5 of Treacle protein OS=Homo sapiens OX=9606 GN=TCOF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	384-UNIMOD:188,393-UNIMOD:188	0.01	26.0	1	1	1
PRT	sp|Q9Y3D6|FIS1_HUMAN	Mitochondrial fission 1 protein OS=Homo sapiens OX=9606 GN=FIS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	53-UNIMOD:188,64-UNIMOD:188	0.09	26.0	1	1	1
PRT	sp|O75947-2|ATP5H_HUMAN	Isoform 2 of ATP synthase subunit d, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5PD	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.10	26.0	1	1	1
PRT	sp|O75334-6|LIPA2_HUMAN	Isoform 6 of Liprin-alpha-2 OS=Homo sapiens OX=9606 GN=PPFIA2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	69-UNIMOD:4,73-UNIMOD:267	0.01	26.0	2	1	0
PRT	sp|P09382|LEG1_HUMAN	Galectin-1 OS=Homo sapiens OX=9606 GN=LGALS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.10	26.0	1	1	1
PRT	sp|Q14980-2|NUMA1_HUMAN	Isoform 2 of Nuclear mitotic apparatus protein 1 OS=Homo sapiens OX=9606 GN=NUMA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|P48147|PPCE_HUMAN	Prolyl endopeptidase OS=Homo sapiens OX=9606 GN=PREP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	1-UNIMOD:1	0.03	26.0	1	1	1
PRT	sp|P51116|FXR2_HUMAN	Fragile X mental retardation syndrome-related protein 2 OS=Homo sapiens OX=9606 GN=FXR2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	217-UNIMOD:188,223-UNIMOD:188	0.02	26.0	1	1	1
PRT	sp|P50579-3|MAP2_HUMAN	Isoform 3 of Methionine aminopeptidase 2 OS=Homo sapiens OX=9606 GN=METAP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	314-UNIMOD:267	0.03	26.0	1	1	1
PRT	sp|O15344-2|TRI18_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase Midline-1 OS=Homo sapiens OX=9606 GN=MID1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|O43913-2|ORC5_HUMAN	Isoform 2 of Origin recognition complex subunit 5 OS=Homo sapiens OX=9606 GN=ORC5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	10-UNIMOD:4,11-UNIMOD:267	0.03	26.0	1	1	1
PRT	sp|Q96SB4-4|SRPK1_HUMAN	Isoform 3 of SRSF protein kinase 1 OS=Homo sapiens OX=9606 GN=SRPK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	214-UNIMOD:267,224-UNIMOD:267	0.02	26.0	1	1	1
PRT	sp|Q14739|LBR_HUMAN	Delta(14)-sterol reductase LBR OS=Homo sapiens OX=9606 GN=LBR PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q86X55-1|CARM1_HUMAN	Isoform 1 of Histone-arginine methyltransferase CARM1 OS=Homo sapiens OX=9606 GN=CARM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|O75146|HIP1R_HUMAN	Huntingtin-interacting protein 1-related protein OS=Homo sapiens OX=9606 GN=HIP1R PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|P11310|ACADM_HUMAN	Medium-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ACADM PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.04	26.0	1	1	1
PRT	sp|P31942-3|HNRH3_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein H3 OS=Homo sapiens OX=9606 GN=HNRNPH3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.04	26.0	1	1	1
PRT	sp|Q7Z6Z7-2|HUWE1_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens OX=9606 GN=HUWE1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	1879-UNIMOD:4,1880-UNIMOD:267,1891-UNIMOD:4,1892-UNIMOD:4,1894-UNIMOD:267	0.01	26.0	1	1	1
PRT	sp|Q01081-4|U2AF1_HUMAN	Isoform 4 of Splicing factor U2AF 35 kDa subunit OS=Homo sapiens OX=9606 GN=U2AF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	78-UNIMOD:267	0.11	26.0	1	1	1
PRT	sp|P62913-2|RL11_HUMAN	Isoform 2 of 60S ribosomal protein L11 OS=Homo sapiens OX=9606 GN=RPL11	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	168-UNIMOD:188,177-UNIMOD:188	0.08	26.0	2	1	0
PRT	sp|P50402|EMD_HUMAN	Emerin OS=Homo sapiens OX=9606 GN=EMD PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	31-UNIMOD:267	0.06	26.0	1	1	1
PRT	sp|Q96FJ2|DYL2_HUMAN	Dynein light chain 2, cytoplasmic OS=Homo sapiens OX=9606 GN=DYNLL2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	56-UNIMOD:4,60-UNIMOD:267	0.13	26.0	1	1	1
PRT	sp|P22314|UBA1_HUMAN	Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	null	58-UNIMOD:28	0.01	26.0	1	1	1
PRT	sp|P00367|DHE3_HUMAN	Glutamate dehydrogenase 1, mitochondrial OS=Homo sapiens OX=9606 GN=GLUD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	503-UNIMOD:188,516-UNIMOD:267	0.04	26.0	1	1	0
PRT	sp|P09622|DLDH_HUMAN	Dihydrolipoyl dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=DLD PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	365-UNIMOD:188	0.04	26.0	1	1	0
PRT	sp|P54886|P5CS_HUMAN	Delta-1-pyrroline-5-carboxylate synthase OS=Homo sapiens OX=9606 GN=ALDH18A1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	606-UNIMOD:4,612-UNIMOD:4	0.03	26.0	1	1	0
PRT	sp|O75691|UTP20_HUMAN	Small subunit processome component 20 homolog OS=Homo sapiens OX=9606 GN=UTP20 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	null	1222-UNIMOD:28,1229-UNIMOD:4	0.01	26.0	1	1	1
PRT	sp|Q9HCC0|MCCB_HUMAN	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial OS=Homo sapiens OX=9606 GN=MCCC2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	null	181-UNIMOD:28,188-UNIMOD:267,193-UNIMOD:267	0.02	26.0	1	1	1
PRT	sp|P28074|PSB5_HUMAN	Proteasome subunit beta type-5 OS=Homo sapiens OX=9606 GN=PSMB5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	166-UNIMOD:267,179-UNIMOD:267	0.06	26.0	1	1	1
PRT	sp|P43403|ZAP70_HUMAN	Tyrosine-protein kinase ZAP-70 OS=Homo sapiens OX=9606 GN=ZAP70 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	37-UNIMOD:267	0.02	26.0	1	1	1
PRT	sp|P16144|ITB4_HUMAN	Integrin beta-4 OS=Homo sapiens OX=9606 GN=ITGB4 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	1160-UNIMOD:188,1177-UNIMOD:188	0.01	26.0	1	1	1
PRT	sp|O00159|MYO1C_HUMAN	Unconventional myosin-Ic OS=Homo sapiens OX=9606 GN=MYO1C PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q13470|TNK1_HUMAN	Non-receptor tyrosine-protein kinase TNK1 OS=Homo sapiens OX=9606 GN=TNK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	151-UNIMOD:267,158-UNIMOD:35,167-UNIMOD:267	0.03	26.0	1	1	1
PRT	sp|P17812|PYRG1_HUMAN	CTP synthase 1 OS=Homo sapiens OX=9606 GN=CTPS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	1-UNIMOD:35	0.03	26.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	LHGSVGGAQNLSALGALVSLSNAR	1	sp|Q8IZL8|PELP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	24-UNIMOD:267	ms_run[2]:scan=11132	71.134	2	2301.2429	2301.2429	R	L	75	99
PSM	LMELHGEGSSSGKATGDETGAK	2	sp|P61247|RS3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0		ms_run[2]:scan=2407	16.821	2	2160.9957	2160.9957	K	V	228	250
PSM	SSGFPVHLLPDIAEPGSVAGR	3	sp|Q9UHJ6|SHPK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	21-UNIMOD:267	ms_run[2]:scan=10299	65.521	2	2115.0988	2115.0988	R	T	219	240
PSM	KVEHEISEGNVATAAAAALASAATK	4	sp|Q92922|SMRC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0		ms_run[2]:scan=9257	58.608	2	2409.25	2409.2500	K	A	856	881
PSM	SRDESASETSTPSEHSAAPSPQVEVR	5	sp|Q92614-3|MY18A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0		ms_run[2]:scan=3257	21.947	3	2740.2536	2740.2536	R	T	145	171
PSM	GHASAPYFGKEEPSVAPSSTGK	6	sp|Q8N183|NDUF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	10-UNIMOD:188,22-UNIMOD:188	ms_run[2]:scan=4318	28.316	2	2215.0948	2215.0948	K	T	131	153
PSM	HTGPGILSMANAGPNTNGSQFFICTAK	7	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	24-UNIMOD:4	ms_run[2]:scan=9678	61.377	2	2790.3218	2790.3218	K	T	92	119
PSM	AKVDEFPLCGHMVSDEYEQLSSEALEAAR	8	sp|P27635|RL10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	9-UNIMOD:4	ms_run[2]:scan=11345	72.557	3	3280.5016	3280.5016	K	I	41	70
PSM	ALPGQLKPFETLLSQNQGGK	9	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=10055	63.842	2	2125.1532	2125.1532	K	T	122	142
PSM	FCKYEHDDIVSTVSVLSSGTQAVSGSK	10	sp|Q9BQA1|MEP50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	2-UNIMOD:4,3-UNIMOD:188,27-UNIMOD:188	ms_run[2]:scan=8567	54.279	2	2912.4265	2912.4265	K	D	119	146
PSM	GHYTEGAELVDSVLDVVR	11	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	18-UNIMOD:267	ms_run[2]:scan=12128	77.972	2	1967.9828	1967.9828	K	K	104	122
PSM	KVLTGVAGEDAECHAAK	12	sp|O95373|IPO7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	1-UNIMOD:188,13-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=2164	15.424	2	1766.9024	1766.9024	K	L	724	741
PSM	LHGSVGGAQNLSALGALVSLSNAR	13	sp|Q8IZL8|PELP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=11136	71.164	2	2291.2346	2291.2346	R	L	75	99
PSM	LYAVHQEGNKNVGLDIEAEVPAVK	14	sp|P50990|TCPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=7640	48.382	3	2592.3548	2592.3548	K	D	467	491
PSM	NHEEEVKGLQAQIASSGLTVEVDAPK	15	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=8192	51.912	2	2748.393	2748.3930	K	S	216	242
PSM	VGEVCHITCKPEYAYGSAGSPPK	16	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	5-UNIMOD:4,9-UNIMOD:4,10-UNIMOD:188,23-UNIMOD:188	ms_run[2]:scan=4558	29.736	3	2518.2023	2518.2023	K	I	99	122
PSM	VLHEAEGHIVTCETNTGEVYR	17	sp|P62318-2|SMD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	12-UNIMOD:4	ms_run[2]:scan=4617	30.079	2	2413.1332	2413.1332	K	G	9	30
PSM	ALPGQLKPFETLLSQNQGGK	18	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	7-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=10064	63.897	2	2137.1934	2137.1934	K	T	122	142
PSM	ALRLDVGNFSWGSECCTR	19	sp|P62241|RS8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	3-UNIMOD:267,15-UNIMOD:4,16-UNIMOD:4,18-UNIMOD:267	ms_run[2]:scan=9329	59.057	2	2146.9791	2146.9791	R	K	57	75
PSM	FGVPVIADGGIQNVGHIAK	20	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	19-UNIMOD:188	ms_run[2]:scan=8929	56.562	2	1897.0517	1897.0517	R	A	357	376
PSM	GHASAPYFGKEEPSVAPSSTGK	21	sp|Q8N183|NDUF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=4316	28.304	2	2203.0546	2203.0546	K	T	131	153
PSM	IGEHTPSALAIMENANVLAR	22	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	20-UNIMOD:267	ms_run[2]:scan=10374	66.022	2	2116.0974	2116.0974	K	Y	154	174
PSM	ISGASEKDIVHSGLAYTMER	23	sp|P00367-2|DHE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=6975	44.289	2	2163.063	2163.0630	R	S	330	350
PSM	IVKADEHVIDQGDDGDNFYVIER	24	sp|P13861-2|KAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=7109	45.116	2	2646.2562	2646.2562	R	G	159	182
PSM	KPPVPLDWAEVQSQGEETNASDQQNEPQLGLK	25	sp|Q9UBT2-2|SAE2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=9109	57.684	3	3531.7118	3531.7118	R	D	181	213
PSM	KVLTGVAGEDAECHAAK	26	sp|O95373|IPO7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	13-UNIMOD:4	ms_run[2]:scan=2171	15.465	2	1754.8621	1754.8621	K	L	724	741
PSM	RWQLSVATEQPELEGPR	27	sp|Q9NR30-2|DDX21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=7610	48.209	2	1995.0174	1995.0174	R	E	634	651
PSM	VAEKLDEIYVAGLVAHSDLDER	28	sp|O60506-4|HNRPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=9767	61.983	3	2441.2438	2441.2438	K	A	39	61
PSM	AHEEQLKEAQAVPATLPELEATK	29	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=6936	44.067	2	2502.2966	2502.2966	R	A	1244	1267
PSM	DHASIQMNVAEVDKVTGR	30	sp|P63220|RS21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=6595	41.988	2	1968.9687	1968.9687	K	F	28	46
PSM	DNHLLGTFDLTGIPPAPR	31	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=10304	65.551	2	1933.0058	1933.0058	K	G	475	493
PSM	HESGASIKIDEPLEGSEDR	32	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=4946	32.004	2	2067.9709	2067.9709	R	I	391	410
PSM	HLYTLDGGDIINALCFSPNR	33	sp|P63244|RACK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	15-UNIMOD:4	ms_run[2]:scan=11485	73.514	2	2275.1056	2275.1056	K	Y	226	246
PSM	HPHDIIDDINSGAVECPAS	34	sp|P30050-2|RL12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	16-UNIMOD:4	ms_run[2]:scan=7160	45.439	2	2045.9113	2045.9113	R	-	114	133
PSM	HTGPGILSMANAGPNTNGSQFFICTAK	35	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	24-UNIMOD:4	ms_run[2]:scan=9734	61.775	3	2790.3218	2790.3218	K	T	92	119
PSM	IGEHTPSALAIMENANVLAR	36	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=10381	66.068	2	2106.0892	2106.0892	K	Y	154	174
PSM	ITDSAGHILYSKEDATK	37	sp|P49755|TMEDA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	12-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=3759	24.987	2	1859.9668	1859.9668	K	G	76	93
PSM	KVETDHIVAAVGLEPNVELAK	38	sp|O95831-5|AIFM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=7609	48.203	2	2231.2161	2231.2161	R	T	36	57
PSM	LGEKDAHSQGEVVSCLEK	39	sp|Q92896|GSLG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	15-UNIMOD:4	ms_run[2]:scan=4155	27.34	2	1984.9524	1984.9524	R	G	255	273
PSM	NHEEEVKGLQAQIASSGLTVEVDAPK	40	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=8193	51.918	3	2748.393	2748.3930	K	S	216	242
PSM	RWQLSVATEQPELEGPR	41	sp|Q9NR30-2|DDX21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:267,17-UNIMOD:267	ms_run[2]:scan=7615	48.238	2	2015.0339	2015.0339	R	E	634	651
PSM	THFFLNAGNLCNLNYGEGPK	42	sp|Q9Y512|SAM50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	11-UNIMOD:4	ms_run[2]:scan=9176	58.098	2	2265.0637	2265.0637	R	A	393	413
PSM	THFFLNAGNLCNLNYGEGPK	43	sp|Q9Y512|SAM50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	11-UNIMOD:4,20-UNIMOD:188	ms_run[2]:scan=9175	58.092	2	2271.0838	2271.0838	R	A	393	413
PSM	VKAFGPGLQGGSAGSPAR	44	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=4070	26.842	2	1655.8744	1655.8744	K	F	1070	1088
PSM	ALPGQLKPFETLLSQNQGGK	45	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=10200	64.856	2	2125.1532	2125.1532	K	T	122	142
PSM	DHASIQMNVAEVDKVTGR	46	sp|P63220|RS21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	7-UNIMOD:35	ms_run[2]:scan=5646	36.273	2	1984.9636	1984.9636	K	F	28	46
PSM	EALLSSAVDHGSDEVKFR	47	sp|P78371-2|TCPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=6748	42.92	2	1958.9698	1958.9698	R	Q	92	110
PSM	GGAAVDPDSGLEHSAHVLEK	48	sp|P09874|PARP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	20-UNIMOD:188	ms_run[2]:scan=5324	34.321	2	1993.9801	1993.9801	K	G	529	549
PSM	HTGPGILSMANAGPNTNGSQFFICTAK	49	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	24-UNIMOD:4,27-UNIMOD:188	ms_run[2]:scan=9532	60.342	2	2796.3419	2796.3419	K	T	92	119
PSM	LEHVVEEEKVDISEDGMK	50	sp|P40937-2|RFC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=5494	35.349	2	2084.9936	2084.9936	R	A	165	183
PSM	MRYVASYLLAALGGNSSPSAK	51	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=11476	73.453	2	2155.1096	2155.1096	-	D	1	22
PSM	VAEKLDEIYVAGLVAHSDLDER	52	sp|O60506-4|HNRPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=9770	62.001	2	2441.2438	2441.2438	K	A	39	61
PSM	VAWVSHDSTVCLADADKK	53	sp|O15143|ARC1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	11-UNIMOD:4,17-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=5486	35.299	2	2013.0028	2013.0028	R	M	217	235
PSM	VYAILTHGIFSGPAISR	54	sp|P60891-2|PRPS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=9795	62.159	2	1800.9887	1800.9887	R	I	177	194
PSM	HTGPGILSMANAGPNTNGSQFFICTAK	55	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	24-UNIMOD:4	ms_run[1]:scan=9847	62.49895166666667	2	2791.306156	2790.321769	K	T	92	119
PSM	CTKEEAIEHNYGGHDDDLSVR	56	sp|Q93009|UBP7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=5191	33.520995	2	2427.0384	2427.0392	R	H	488	509
PSM	AAVSHWQQQSYLDSGIHSGATTTAPSLSGK	57	sp|P35222|CTNB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	30-UNIMOD:188	ms_run[2]:scan=6566	41.812	3	3090.5102	3090.5102	K	G	20	50
PSM	ALPGQLKPFETLLSQNQGGK	58	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	7-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=10211	64.946	2	2137.1934	2137.1934	K	T	122	142
PSM	ALRLDVGNFSWGSECCTR	59	sp|P62241|RS8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	15-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=9330	59.063	2	2126.9626	2126.9626	R	K	57	75
PSM	AQQNNVEHKVETFSGVYK	60	sp|P62081|RS7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	9-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=5553	35.704	2	2089.0631	2089.0631	K	K	161	179
PSM	AQQNNVEHKVETFSGVYK	61	sp|P62081|RS7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=5555	35.715	2	2077.0229	2077.0229	K	K	161	179
PSM	CEAFGWHAIIVDGHSVEELCK	62	sp|P29401|TKT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:4,20-UNIMOD:4,21-UNIMOD:188	ms_run[2]:scan=9091	57.571	2	2462.1454	2462.1454	R	A	206	227
PSM	CVFELPAENDKPHDVEINK	63	sp|O95292|VAPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:4	ms_run[2]:scan=6672	42.454	2	2253.0736	2253.0736	R	I	121	140
PSM	DNHLLGTFDLTGIPPAPR	64	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	18-UNIMOD:267	ms_run[2]:scan=10751	68.581	2	1943.014	1943.0140	K	G	475	493
PSM	DNHLLGTFDLTGIPPAPR	65	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=10449	66.541	2	1933.0058	1933.0058	K	G	475	493
PSM	EVVAGSHELGQDYEHVTMLQER	66	sp|Q01082-3|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	22-UNIMOD:267	ms_run[2]:scan=6920	43.967	2	2536.1892	2536.1892	R	F	1705	1727
PSM	FCKYEHDDIVSTVSVLSSGTQAVSGSK	67	sp|Q9BQA1|MEP50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	2-UNIMOD:4	ms_run[2]:scan=8555	54.199	2	2900.3862	2900.3862	K	D	119	146
PSM	FGVPVIADGGIQNVGHIAK	68	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=8913	56.46	2	1891.0316	1891.0316	R	A	357	376
PSM	FRQDLMNIAGTTLSSK	69	sp|P78371-2|TCPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=8169	51.763	2	1780.9142	1780.9142	K	L	108	124
PSM	GGAAVDPDSGLEHSAHVLEK	70	sp|P09874|PARP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=5322	34.31	2	1987.9599	1987.9599	K	G	529	549
PSM	GHLLPGVPVEDQSLPGEAR	71	sp|P27816-4|MAP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=7603	48.165	2	1970.0221	1970.0221	K	A	180	199
PSM	GHSLSDGLEEVQKAEMK	72	sp|O75431-2|MTX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	13-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=6406	40.834	2	1868.9341	1868.9341	K	A	86	103
PSM	GHSLSDGLEEVQKAEMK	73	sp|O75431-2|MTX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=6409	40.851	2	1856.8938	1856.8938	K	A	86	103
PSM	HAEASAIVEYAYNDKAILEQR	74	sp|Q15397|PUM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=8369	53.036	3	2390.1866	2390.1866	R	N	248	269
PSM	HQILEQAVEDYAETVHQLSK	75	sp|Q01082-3|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	20-UNIMOD:188	ms_run[2]:scan=11283	72.143	3	2343.1802	2343.1802	K	T	1621	1641
PSM	HQQLLGEVLTQLSSR	76	sp|Q13616|CUL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	15-UNIMOD:267	ms_run[2]:scan=10570	67.336	2	1717.9351	1717.9351	K	F	727	742
PSM	HVVQSISTQQEKETIAK	77	sp|P24539|AT5F1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=2804	19.167	2	1925.0218	1925.0218	K	C	222	239
PSM	HYNEEGSQVYNDAHILEK	78	sp|Q86U86-6|PB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	18-UNIMOD:188	ms_run[2]:scan=5602	36.004	2	2150.9964	2150.9964	R	L	599	617
PSM	KLFIGGLSFETTEESLR	79	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=10288	65.445	2	1926.0098	1926.0098	R	N	10	27
PSM	LYAVHQEGNKNVGLDIEAEVPAVK	80	sp|P50990|TCPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=7665	48.537	2	2592.3548	2592.3548	K	D	467	491
PSM	MDSTANEVEAVKVHSFPTLK	81	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:35	ms_run[2]:scan=6960	44.204	2	2218.094	2218.0940	K	F	425	445
PSM	MRYVASYLLAALGGNSSPSAK	82	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:35	ms_run[2]:scan=10627	67.704	2	2171.1045	2171.1045	-	D	1	22
PSM	RQFASQANVVGPWIQTK	83	sp|O43707|ACTN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=7278	46.17	2	1929.0221	1929.0221	R	M	652	669
PSM	TKYTHLVDQDTTSFDSAWGQESAQNTK	84	sp|P55081|MFAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=7041	44.687	3	3057.3952	3057.3952	R	F	389	416
PSM	VGEVCHITCKPEYAYGSAGSPPK	85	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	5-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=4556	29.72	3	2506.1621	2506.1621	K	I	99	122
PSM	YKPAVNQIECHPYLTQEK	86	sp|P15121|ALDR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	10-UNIMOD:4	ms_run[2]:scan=5166	33.375	2	2217.0888	2217.0888	K	L	178	196
PSM	HTGPGILSMANAGPNTNGSQFFICTAK	87	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	24-UNIMOD:4,27-UNIMOD:188	ms_run[1]:scan=9855	62.552018333333336	2	2797.325191	2796.341898	K	T	92	119
PSM	AAVSHWQQQSYLDSGIHSGATTTAPSLSGK	88	sp|P35222|CTNB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	30-UNIMOD:188	ms_run[2]:scan=6584	41.923	2	3090.5102	3090.5102	K	G	20	50
PSM	AAVSHWQQQSYLDSGIHSGATTTAPSLSGK	89	sp|P35222|CTNB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=6573	41.849	2	3084.4901	3084.4901	K	G	20	50
PSM	DNHLLGTFDLTGIPPAPR	90	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=10605	67.562	2	1933.0058	1933.0058	K	G	475	493
PSM	ERIPEAPAGPPSDFGLFLSDDDPK	91	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=10499	66.872	3	2569.2336	2569.2336	R	K	34	58
PSM	FCFTPHTEEGCLSER	92	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	2-UNIMOD:4,11-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=6199	39.607	2	1878.7904	1878.7904	K	A	1117	1132
PSM	HDADGQATLLNLLLR	93	sp|O43242|PSMD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	15-UNIMOD:267	ms_run[2]:scan=12206	78.529	2	1658.8979	1658.8979	R	N	242	257
PSM	HGGPGPGGPEPELSPITEGSEAR	94	sp|Q8WUF5|IASPP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	23-UNIMOD:267	ms_run[2]:scan=5766	36.977	2	2237.0588	2237.0588	R	A	554	577
PSM	HQQLLGEVLTQLSSR	95	sp|Q13616|CUL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=10573	67.353	2	1707.9268	1707.9268	K	F	727	742
PSM	HSGNITFDEIVNIAR	96	sp|P30050-2|RL12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=9585	60.683	2	1684.8533	1684.8533	K	Q	67	82
PSM	HTGPGILSMANAGPNTNGSQFFICTAK	97	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	9-UNIMOD:35,24-UNIMOD:4	ms_run[2]:scan=8273	52.416	2	2806.3167	2806.3167	K	T	92	119
PSM	IHVSDQELQSANASVDDSRLEELK	98	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=6976	44.294	3	2682.3097	2682.3097	K	A	767	791
PSM	IINEVKPTEIYNLGAQSHVK	99	sp|O60547-2|GMDS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=6800	43.236	3	2252.2165	2252.2165	K	I	66	86
PSM	IVDKPGDHDPETLEAIAENAK	100	sp|Q96Q11-2|TRNT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=6570	41.832	2	2261.1176	2261.1176	R	G	208	229
PSM	KGEGYSNPNEGATVEIHLEGR	101	sp|Q13451-2|FKBP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=5469	35.191	2	2256.0771	2256.0771	R	C	155	176
PSM	KIEPELDGSAQVTSHDASTNGLINFIK	102	sp|P06744-2|G6PI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=8992	56.955	3	2883.4614	2883.4614	K	Q	535	562
PSM	KLFIGGLSFETTDESLR	103	sp|P09651-3|ROA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=9979	63.354	2	1911.9942	1911.9942	R	S	15	32
PSM	LSAKEDSIHILNEEYETK	104	sp|Q13439-3|GOGA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	4-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=6239	39.847	2	2130.0883	2130.0883	K	F	931	949
PSM	LVEALCAEHQINLIKVDDNK	105	sp|P25398|RS12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:4	ms_run[2]:scan=7632	48.335	2	2321.2049	2321.2049	K	K	64	84
PSM	PGHLQEGFGCVVTNR	106	sp|Q8NC51-4|PAIRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	10-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=5315	34.267	2	1679.8077	1679.8077	M	F	2	17
PSM	PGHLQEGFGCVVTNR	107	sp|Q8NC51-4|PAIRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	10-UNIMOD:4	ms_run[2]:scan=5316	34.273	2	1669.7995	1669.7995	M	F	2	17
PSM	RFDEILEASDGIMVAR	108	sp|P14618-2|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=9459	59.865	2	1840.9256	1840.9256	R	G	279	295
PSM	RNFILDQCNVYNSGQR	109	sp|Q1KMD3|HNRL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	8-UNIMOD:4	ms_run[2]:scan=6287	40.136	2	1982.9381	1982.9381	K	R	531	547
PSM	RPTELLSNPQFIVDGATR	110	sp|P07384|CAN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=8440	53.481	2	2013.0643	2013.0643	K	T	87	105
PSM	RSLEQNIQLPAALLSR	111	sp|P33993|MCM7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=9433	59.698	2	1808.0268	1808.0268	R	F	499	515
PSM	STDHPKYSDMIVAAIQAEK	112	sp|P07305-2|H10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=8670	54.92	2	2115.0709	2115.0709	K	N	5	24
PSM	STDHPKYSDMIVAAIQAEK	113	sp|P07305-2|H10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=8671	54.926	2	2103.0307	2103.0307	K	N	5	24
PSM	TERFGQGGAGPVGGQGPR	114	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=3063	20.755	2	1726.8499	1726.8499	R	G	664	682
PSM	TKENDAHLVEVNLNNIK	115	sp|Q9NYL9|TMOD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	2-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=6341	40.448	2	1962.0573	1962.0573	R	N	193	210
PSM	TNVLGHLQQGGAPTPFDR	116	sp|P17858|PFKAL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=7184	45.584	2	1906.965	1906.9650	R	N	655	673
PSM	TNVLGHLQQGGAPTPFDR	117	sp|P17858|PFKAL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	18-UNIMOD:267	ms_run[2]:scan=7181	45.567	2	1916.9732	1916.9732	R	N	655	673
PSM	TSSAQVEGGVHSLHSYEK	118	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=3686	24.552	2	1914.9072	1914.9072	R	R	494	512
PSM	VAEAHENIIHGSGATGK	119	sp|Q08257-3|QOR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	17-UNIMOD:188	ms_run[2]:scan=1688	12.713	2	1695.8636	1695.8636	K	M	274	291
PSM	VAWVSHDSTVCLADADKK	120	sp|O15143|ARC1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	11-UNIMOD:4	ms_run[2]:scan=5485	35.293	2	2000.9626	2000.9626	R	M	217	235
PSM	VLKGNTAEGCVHETQEK	121	sp|Q9BQG0|MBB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	10-UNIMOD:4	ms_run[2]:scan=1216	9.8986	2	1898.9156	1898.9156	R	Q	933	950
PSM	VSALNSVHCEHVEDEGESR	122	sp|Q13085-3|ACACA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	9-UNIMOD:4	ms_run[2]:scan=3383	22.707	2	2152.9444	2152.9444	R	Y	1683	1702
PSM	VSHIDVITAEMAKDFVEDDTTHG	123	sp|Q9UQE7|SMC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=10498	66.865	3	2529.1693	2529.1693	K	-	1195	1218
PSM	HTGPGILSMANAGPNTNGSQFFICTAK	124	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	9-UNIMOD:35,24-UNIMOD:4,27-UNIMOD:188	ms_run[1]:scan=8509	53.913918333333335	3	2813.322182	2812.336813	K	T	92	119
PSM	VLKGNTAEGCVHETQEK	125	sp|Q9BQG0|MBB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	3-UNIMOD:188,10-UNIMOD:4,17-UNIMOD:188	ms_run[1]:scan=1228	9.963163333333332	2	1911.963919	1910.955884	R	Q	933	950
PSM	AGLGSGLSLSGLVHPELSR	126	sp|P49748-2|ACADV_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	19-UNIMOD:267	ms_run[2]:scan=10046	63.788	2	1859.014	1859.0140	R	S	491	510
PSM	CCNHPYLFPVAAMEAPK	127	sp|Q14839|CHD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:4,2-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=8896	56.353	2	2009.9257	2009.9257	K	M	1018	1035
PSM	HDADGQATLLNLLLR	128	sp|O43242|PSMD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=12207	78.535	2	1648.8897	1648.8897	R	N	242	257
PSM	HEIEGTGLPQAQLLWR	129	sp|Q96TA1-2|NIBA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	16-UNIMOD:267	ms_run[2]:scan=9014	57.09	2	1856.9772	1856.9773	R	K	33	49
PSM	HTGPGILSMANAGPNTNGSQFFICTAK	130	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	24-UNIMOD:4	ms_run[2]:scan=9533	60.348	2	2790.3218	2790.3218	K	T	92	119
PSM	HVVSCSSQDSTHCAENLLK	131	sp|P18887|XRCC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:4,13-UNIMOD:4,19-UNIMOD:188	ms_run[2]:scan=4320	28.328	2	2176.9937	2176.9937	R	A	8	27
PSM	ICHQIEYYFGDFNLPR	132	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	2-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=10810	68.981	2	2080.9704	2080.9705	K	D	17	33
PSM	IIHEAGYSEEECKQYK	133	sp|P63096-2|GNAI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	12-UNIMOD:4	ms_run[2]:scan=2517	17.437	2	1982.9044	1982.9044	K	A	3	19
PSM	KPPVPLDWAEVQSQGEETNASDQQNEPQLGLK	134	sp|Q9UBT2-2|SAE2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:188,32-UNIMOD:188	ms_run[2]:scan=9107	57.672	3	3543.752	3543.7520	R	D	181	213
PSM	KYEDICPSTHNMDVPNIK	135	sp|P63241|IF5A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:4	ms_run[2]:scan=5814	37.274	2	2159.998	2159.9980	K	R	68	86
PSM	LEQEKELLHSQNTWLNTELK	136	sp|P12270|TPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=8091	51.268	2	2452.2598	2452.2598	R	T	183	203
PSM	LNQSQREELGLIEQAYDNPHEALSR	137	sp|Q6P2Q9|PRP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=8938	56.616	3	2909.4268	2909.4268	R	I	856	881
PSM	LQLEETDHQKNLLDEELQR	138	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=7215	45.781	2	2350.1765	2350.1765	R	L	2330	2349
PSM	NLVQCGDFPHLLVYGPSGAGK	139	sp|P40938-2|RFC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:4,21-UNIMOD:188	ms_run[2]:scan=9899	62.837	2	2234.125	2234.1250	R	K	28	49
PSM	RFDEILEASDGIMVAR	140	sp|P14618-2|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=9461	59.877	2	1820.9091	1820.9091	R	G	279	295
PSM	SHSSAQFLIGDQEPWAFR	141	sp|O60502-2|OGA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=9989	63.417	2	2074.9861	2074.9861	R	G	612	630
PSM	SKVDEAVAVLQAHQAK	142	sp|P11940-2|PABP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=5725	36.745	2	1692.9159	1692.9159	R	E	516	532
PSM	SNQVAFQHFQELDEHISYVATK	143	sp|O00471|EXOC5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=8658	54.843	3	2590.2452	2590.2452	K	V	88	110
PSM	TSSAQVEGGVHSLHSYEK	144	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	18-UNIMOD:188	ms_run[2]:scan=3683	24.537	2	1920.9273	1920.9273	R	R	494	512
PSM	VAEAHENIIHGSGATGK	145	sp|Q08257-3|QOR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=1687	12.707	2	1689.8434	1689.8434	K	M	274	291
PSM	VLDSGAPIKIPVGPETLGR	146	sp|P06576|ATPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=8581	54.363	2	1918.0888	1918.0888	K	I	125	144
PSM	VLQHYQESDKGEELGPGNVQK	147	sp|Q9Y6C9|MTCH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	10-UNIMOD:188,21-UNIMOD:188	ms_run[2]:scan=3650	24.347	2	2366.1905	2366.1905	K	E	91	112
PSM	VRELLEQISAFDNVPR	148	sp|Q9NX58|LYAR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=9864	62.609	2	1885.0058	1885.0058	K	K	94	110
PSM	VRPCVVYGGADIGQQIR	149	sp|O00571-2|DDX3X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:4	ms_run[2]:scan=6238	39.841	2	1886.9785	1886.9785	R	D	279	296
PSM	VYAILTHGIFSGPAISR	150	sp|P60891-2|PRPS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	17-UNIMOD:267	ms_run[2]:scan=9784	62.09	2	1810.9969	1810.9969	R	I	177	194
PSM	HTGPGILSMANAGPNTNGSQFFICTAK	151	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	24-UNIMOD:4	ms_run[1]:scan=10242	65.15000333333333	3	2792.296473	2790.321769	K	T	92	119
PSM	HTGPGILSMANAGPNTNGSQFFICTAK	152	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	24-UNIMOD:4,27-UNIMOD:188	ms_run[1]:scan=9677	61.371805	2	2796.342296	2796.341898	K	T	92	119
PSM	AGLGSGLSLSGLVHPELSR	153	sp|P49748-2|ACADV_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=10034	63.708	2	1849.0058	1849.0058	R	S	491	510
PSM	ALIEVLQPLIAEHQAR	154	sp|P23381-2|SYWC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	16-UNIMOD:267	ms_run[2]:scan=10676	68.022	2	1810.034	1810.0340	K	R	392	408
PSM	CGESGHLAKDCDLQEDEACYNCGR	155	sp|P62633-8|CNBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:4,11-UNIMOD:4,19-UNIMOD:4,22-UNIMOD:4	ms_run[2]:scan=4231	27.777	3	2843.1004	2843.1004	R	G	50	74
PSM	DNHLLGTFDLTGIPPAPR	156	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	18-UNIMOD:267	ms_run[2]:scan=10450	66.547	2	1943.014	1943.0140	K	G	475	493
PSM	DSIEKEHVEEISELFYDAK	157	sp|Q9Y265|RUVB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=10360	65.927	2	2280.0798	2280.0798	K	S	423	442
PSM	EGQEDQGLTKDYGNSPLHR	158	sp|P26599|PTBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=4319	28.322	2	2142.993	2142.9930	R	F	419	438
PSM	FSHQGVQLIDFSPCER	159	sp|P55884|EIF3B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	14-UNIMOD:4	ms_run[2]:scan=8077	51.179	2	1918.8996	1918.8996	R	Y	371	387
PSM	GAVTGHEECVDALLQHGAK	160	sp|O15084|ANR28_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	9-UNIMOD:4,19-UNIMOD:188	ms_run[2]:scan=5827	37.351	2	1996.9732	1996.9732	R	C	693	712
PSM	HAPLADQILAGNAVR	161	sp|Q13895|BYST_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	15-UNIMOD:267	ms_run[2]:scan=6613	42.098	2	1554.8506	1554.8506	K	A	16	31
PSM	HAPLADQILAGNAVR	162	sp|Q13895|BYST_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=6617	42.121	2	1544.8423	1544.8423	K	A	16	31
PSM	HLVVPGDTITTDTGFMR	163	sp|Q13868-3|EXOS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=8221	52.087	2	1858.9247	1858.9247	K	G	25	42
PSM	HLYTLDGGDIINALCFSPNR	164	sp|P63244|RACK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	15-UNIMOD:4,20-UNIMOD:267	ms_run[2]:scan=11478	73.466	2	2285.1138	2285.1138	K	Y	226	246
PSM	HNVFQNDEFDVFSR	165	sp|Q9H1I8-3|ASCC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	14-UNIMOD:267	ms_run[2]:scan=9158	57.993	2	1762.7939	1762.7939	R	D	461	475
PSM	HSSVYPTQEELEAVQNMVSHTER	166	sp|Q12906-5|ILF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=10119	64.26	3	2670.2344	2670.2344	K	A	18	41
PSM	HVVQSISTQQEKETIAK	167	sp|P24539|AT5F1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	12-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=2803	19.161	2	1937.0621	1937.0621	K	C	222	239
PSM	ICHQIEYYFGDFNLPR	168	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	2-UNIMOD:4	ms_run[2]:scan=10811	68.987	2	2070.9622	2070.9622	K	D	17	33
PSM	IINEVKPTEIYNLGAQSHVK	169	sp|O60547-2|GMDS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=6804	43.256	2	2252.2165	2252.2165	K	I	66	86
PSM	IPEAPAGPPSDFGLFLSDDDPKK	170	sp|Q9Y490|TLN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=10302	65.54	3	2412.1849	2412.1849	R	G	36	59
PSM	ITDSAGHILYSKEDATK	171	sp|P49755|TMEDA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=3757	24.976	2	1847.9265	1847.9265	K	G	76	93
PSM	IVAERPGTNSTGPAPMAPPR	172	sp|Q13263-2|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	5-UNIMOD:267,20-UNIMOD:267	ms_run[2]:scan=4171	27.435	2	2038.0533	2038.0533	K	A	326	346
PSM	IVDKPGDHDPETLEAIAENAK	173	sp|Q96Q11-2|TRNT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:188,21-UNIMOD:188	ms_run[2]:scan=6571	41.838	2	2273.1578	2273.1578	R	G	208	229
PSM	KEAESCDCLQGFQLTHSLGGGTGSGMGTLLLSK	174	sp|Q3ZCM7|TBB8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=10050	63.81	3	3438.6218	3438.6218	R	I	122	155
PSM	KFDLNSPWEAFPVYR	175	sp|O75489|NDUS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=11257	71.972	2	1867.9257	1867.9257	R	Q	232	247
PSM	KIEPELDGSAQVTSHDASTNGLINFIK	176	sp|P06744-2|G6PI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=9087	57.547	3	2883.4614	2883.4614	K	Q	535	562
PSM	KIEPELDGSAQVTSHDASTNGLINFIK	177	sp|P06744-2|G6PI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:188,27-UNIMOD:188	ms_run[2]:scan=9061	57.387	2	2895.5017	2895.5017	K	Q	535	562
PSM	KIWCFGPDGTGPNILTDITK	178	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:188,4-UNIMOD:4,20-UNIMOD:188	ms_run[2]:scan=11386	72.828	2	2244.1651	2244.1651	R	G	648	668
PSM	KIWCFGPDGTGPNILTDITK	179	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:4	ms_run[2]:scan=11371	72.727	3	2232.1249	2232.1249	R	G	648	668
PSM	LMELHGEGSSSGKATGDETGAK	180	sp|P61247|RS3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=2396	16.757	3	2160.9957	2160.9957	K	V	228	250
PSM	SAIKDAEEDDDTGGINLHK	181	sp|Q13206|DDX10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=4262	27.978	3	2038.9846	2038.9846	K	A	706	725
PSM	SSERTPGAATASASGAAEDGACGCLPNPGTFEECHR	182	sp|O96008-2|TOM40_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:267,22-UNIMOD:4,24-UNIMOD:4,34-UNIMOD:4,36-UNIMOD:267	ms_run[2]:scan=6351	40.509	3	3697.5695	3697.5695	R	K	53	89
PSM	TAEALDKDGWLHTGDIGK	183	sp|P33121-2|ACSL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=6624	42.164	2	1925.9483	1925.9483	K	W	516	534
PSM	TKDEYLINSQTTEHIVK	184	sp|Q9NSE4|SYIM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=5379	34.636	2	2018.032	2018.0320	K	L	539	556
PSM	TKDEYLINSQTTEHIVK	185	sp|Q9NSE4|SYIM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	2-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=5394	34.729	2	2030.0723	2030.0723	K	L	539	556
PSM	TKENDAHLVEVNLNNIK	186	sp|Q9NYL9|TMOD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=6315	40.297	2	1950.0171	1950.0171	R	N	193	210
PSM	TLEEEAKTHEAQIQEMR	187	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	16-UNIMOD:35	ms_run[2]:scan=4757	30.891	2	2057.9688	2057.9688	K	Q	1175	1192
PSM	TLEEEAKTHEAQIQEMR	188	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=5995	38.355	2	2041.9739	2041.9739	K	Q	1175	1192
PSM	TSWAGAPVHLGQGQFLK	189	sp|P48681|NEST_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=8194	51.923	2	1795.937	1795.9370	K	F	1589	1606
PSM	TVSHEAEVHAESLQQK	190	sp|Q14789-4|GOGB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=2825	19.299	2	1791.8751	1791.8751	K	L	1283	1299
PSM	TYVSPTHVGSGAYGSVCSAIDKR	191	sp|O15264-2|MK13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	17-UNIMOD:4	ms_run[2]:scan=6192	39.56	2	2411.154	2411.1540	K	S	24	47
PSM	VCIESEHSMDTLLATLKK	192	sp|O00244|ATOX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	2-UNIMOD:4	ms_run[2]:scan=9038	57.237	2	2074.0439	2074.0439	K	T	40	58
PSM	VGEVCHITCKPEYAYGSAGSPPK	193	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	5-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=4560	29.746	2	2506.1621	2506.1621	K	I	99	122
PSM	VIECDVVKDYAFVHMEK	194	sp|Q96PK6-2|RBM14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:4,8-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=8032	50.894	2	2093.0364	2093.0364	R	E	105	122
PSM	VLHEAEGHIVTCETNTGEVYR	195	sp|P62318-2|SMD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	12-UNIMOD:4,21-UNIMOD:267	ms_run[2]:scan=4618	30.085	3	2423.1415	2423.1415	K	G	9	30
PSM	VWAHYEEQPVEEVMPVLEEKER	196	sp|Q7KZF4|SND1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=8995	56.971	3	2725.3058	2725.3058	K	S	657	679
PSM	TSPVADAAGWVDVDKETLQHR	197	sp|Q9Y6N5|SQOR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0		ms_run[1]:scan=8189	51.88979666666667	2	2295.134105	2294.129124	K	R	306	327
PSM	TSHVENDYIDNPSLALTTGPKR	198	sp|Q9C004|SPY4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	21-UNIMOD:188,22-UNIMOD:267	ms_run[1]:scan=6598	42.00451833333334	3	2444.233237	2443.231415	K	T	45	67
PSM	AGGAAVVITEPEHTKER	199	sp|Q9P258|RCC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=2606	17.929	2	1763.9166	1763.9166	K	V	78	95
PSM	AKYIYDSAFHPDTGEK	200	sp|Q9H9B4|SFXN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=5067	32.773	2	1852.9034	1852.9034	R	M	71	87
PSM	CGESGHLAKDCDLQEDACYNCGR	201	sp|P62633-7|CNBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:4,11-UNIMOD:4,18-UNIMOD:4,21-UNIMOD:4	ms_run[2]:scan=3953	26.143	3	2714.0578	2714.0578	R	G	40	63
PSM	CVFELPAENDKPHDVEINK	202	sp|O95292|VAPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:4,11-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=6670	42.444	2	2265.1138	2265.1138	R	I	121	140
PSM	DNHLLGTFDLTGIPPAPR	203	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=10752	68.587	2	1933.0058	1933.0058	K	G	475	493
PSM	DNHLLGTFDLTGIPPAPR	204	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=10902	69.605	2	1933.0058	1933.0058	K	G	475	493
PSM	DYIQKHPELNISEEGITK	205	sp|P17480-2|UBF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=6271	40.042	2	2113.0691	2113.0691	R	S	225	243
PSM	EVHKQVVESAYEVIK	206	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=5353	34.486	2	1756.9359	1756.9359	K	L	229	244
PSM	FHQLLDDESDPFDILR	207	sp|Q5JVS0-2|HABP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=11440	73.194	2	1958.9374	1958.9374	R	E	28	44
PSM	FSMPGFKGEGPDVDVNLPK	208	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:35,7-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=7301	46.309	2	2061.028	2061.0280	K	A	3030	3049
PSM	GAVTGHEECVDALLQHGAK	209	sp|O15084|ANR28_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	9-UNIMOD:4	ms_run[2]:scan=5834	37.397	2	1990.9531	1990.9531	R	C	693	712
PSM	GTADVTHDLQEMKEESR	210	sp|P11166|GTR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=5738	36.817	2	1944.8847	1944.8847	R	Q	233	250
PSM	GVTIIGPATVGGIKPGCFK	211	sp|P53396|ACLY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	14-UNIMOD:188,17-UNIMOD:4,19-UNIMOD:188	ms_run[2]:scan=8450	53.544	2	1883.0741	1883.0741	K	I	617	636
PSM	GWLRDPSASPGDAGEQAIR	212	sp|P18206-2|VINC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=6141	39.243	2	1981.9606	1981.9606	K	Q	282	301
PSM	HEVTICNYEASANPADHR	213	sp|Q9GZP4-2|PITH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:4,18-UNIMOD:267	ms_run[2]:scan=4338	28.436	3	2092.926	2092.9260	R	V	181	199
PSM	HGGTIPIVPTAEFQDR	214	sp|P00367-2|DHE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	16-UNIMOD:267	ms_run[2]:scan=7223	45.832	2	1746.8929	1746.8929	K	I	314	330
PSM	HLTVEELFGTSLPK	215	sp|Q9NPI6-2|DCP1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=10021	63.627	2	1569.8403	1569.8403	K	E	178	192
PSM	HSQFIGYPITLFVEK	216	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=11373	72.739	2	1777.9403	1777.9403	K	E	210	225
PSM	HSSVYPTQEELEAVQNMVSHTER	217	sp|Q12906-5|ILF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=9997	63.469	2	2670.2344	2670.2344	K	A	18	41
PSM	HTGPGILSMANAGPNTNGSQFFICTAK	218	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	9-UNIMOD:35,24-UNIMOD:4,27-UNIMOD:188	ms_run[2]:scan=8268	52.381	2	2812.3368	2812.3368	K	T	92	119
PSM	HTGPGILSMANAGPNTNGSQFFICTAK	219	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	24-UNIMOD:4,27-UNIMOD:188	ms_run[2]:scan=9676	61.367	3	2796.3419	2796.3419	K	T	92	119
PSM	HVSPAGAAVGIPLSEDEAK	220	sp|P31939|PUR9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	19-UNIMOD:188	ms_run[2]:scan=5956	38.131	2	1852.9626	1852.9626	K	V	267	286
PSM	HVVQSISTQQEKETIAK	221	sp|P24539|AT5F1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	12-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=2812	19.218	3	1937.0621	1937.0621	K	C	222	239
PSM	IHVSDQELQSANASVDDSRLEELK	222	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=6988	44.362	2	2682.3097	2682.3097	K	A	767	791
PSM	IITVEKHPDADSLYVEK	223	sp|P54577|SYYC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=5402	34.78	2	1968.0607	1968.0607	K	I	375	392
PSM	IRDGWQVEEADDWLR	224	sp|P06737-2|PYGL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:267,15-UNIMOD:267	ms_run[2]:scan=9280	58.752	2	1906.9077	1906.9077	K	Y	137	152
PSM	ITKPGSIDSNNQLFAPGGR	225	sp|Q04637-6|IF4G1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=5883	37.691	2	1971.0174	1971.0174	K	L	876	895
PSM	IVKADEHVIDQGDDGDNFYVIER	226	sp|P13861-2|KAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=7097	45.042	3	2646.2562	2646.2562	R	G	159	182
PSM	KESESCDCLQGFQLTHSLGGGTGSGMGTLLISK	227	sp|Q9BVA1|TBB2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:188,6-UNIMOD:4,8-UNIMOD:4,33-UNIMOD:188	ms_run[2]:scan=10039	63.742	3	3466.6569	3466.6569	R	I	122	155
PSM	KGEGYSNPNEGATVEIHLEGR	228	sp|Q13451-2|FKBP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=5474	35.225	3	2256.0771	2256.0771	R	C	155	176
PSM	KIEPELDGSAQVTSHDASTNGLINFIK	229	sp|P06744-2|G6PI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:188,27-UNIMOD:188	ms_run[2]:scan=9069	57.439	3	2895.5017	2895.5017	K	Q	535	562
PSM	KVDEGAGDSAAVASGGAQTLALAGSPAPSGHPK	230	sp|Q9NZT2-2|OGFR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=5918	37.901	3	2973.4792	2973.4792	R	A	460	493
PSM	KYEDICPSTHNMDVPNIK	231	sp|P63241|IF5A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:188,6-UNIMOD:4,18-UNIMOD:188	ms_run[2]:scan=5808	37.236	2	2172.0382	2172.0382	K	R	68	86
PSM	MVMIQDGPLPTGADKPLR	232	sp|Q96I24-2|FUBP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:35	ms_run[2]:scan=6526	41.564	2	1954.0016	1954.0016	K	I	136	154
PSM	QISRPSAAGINLMIGSTR	233	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	4-UNIMOD:267,18-UNIMOD:267	ms_run[2]:scan=7450	47.194	2	1891.0213	1891.0213	R	Y	1137	1155
PSM	RFQSVESGANNVVFIR	234	sp|Q9NXG2|THUM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=6843	43.491	2	1821.9486	1821.9486	R	T	116	132
PSM	RIEESAIDEVVVTNTIPHEVQK	235	sp|O60256-4|KPRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=7660	48.503	2	2505.3075	2505.3075	R	L	223	245
PSM	RLEASDGGLDSAELAAELGMEHQAVVGAVK	236	sp|Q9Y285-2|SYFA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=9961	63.238	3	3022.503	3022.5030	R	S	13	43
PSM	RSIQFVDWCPTGFK	237	sp|P68363-2|TBA1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	9-UNIMOD:4	ms_run[2]:scan=9185	58.154	2	1739.8454	1739.8454	K	V	223	237
PSM	RVQPQWSPPAGTQPCR	238	sp|P49589-2|SYCC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:267,15-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=4454	29.126	2	1883.9328	1883.9328	R	L	13	29
PSM	RVQPQWSPPAGTQPCR	239	sp|P49589-2|SYCC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	15-UNIMOD:4	ms_run[2]:scan=4452	29.114	2	1863.9162	1863.9162	R	L	13	29
PSM	SAIKDAEEDDDTGGINLHK	240	sp|Q13206|DDX10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=4261	27.972	3	2026.9443	2026.9443	K	A	706	725
PSM	SGVEKDLDEVLQTHSVFVNVSK	241	sp|Q9Y3A5|SBDS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=10234	65.098	3	2429.2438	2429.2438	R	G	41	63
PSM	SHSSAQFLIGDQEPWAFR	242	sp|O60502-2|OGA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	18-UNIMOD:267	ms_run[2]:scan=9972	63.309	2	2084.9944	2084.9944	R	G	612	630
PSM	THFFLNAGNLCNLNYGEGPK	243	sp|Q9Y512|SAM50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	11-UNIMOD:4,20-UNIMOD:188	ms_run[2]:scan=9174	58.087	3	2271.0838	2271.0838	R	A	393	413
PSM	VAQGVSGAVQDKGSIHK	244	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	12-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=1871	13.748	2	1691.9357	1691.9357	K	F	439	456
PSM	VEGIVHPTTAEIDLKEDIGK	245	sp|Q9P0M6|H2AW_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=7089	44.992	2	2163.1423	2163.1423	R	A	212	232
PSM	VGEVCHITCKPEYAYGSAGSPPK	246	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:4,9-UNIMOD:4,10-UNIMOD:188,23-UNIMOD:188	ms_run[2]:scan=4562	29.758	2	2518.2023	2518.2023	K	I	99	122
PSM	VTWAHPEFGQVLASCSFDR	247	sp|Q96EE3|SEH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	15-UNIMOD:4	ms_run[2]:scan=9848	62.505	2	2206.0266	2206.0266	R	T	63	82
PSM	YHALLIPSCPGALTDLASSGSLAR	248	sp|Q8NB37|GALD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	9-UNIMOD:4,24-UNIMOD:267	ms_run[2]:scan=10674	68.005	3	2479.2769	2479.2769	R	I	86	110
PSM	KEAESCDCLQGFQLTHSLGGGTGSGMGTLLISK	249	sp|P04350|TBB4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	1-UNIMOD:188,6-UNIMOD:4,8-UNIMOD:4,33-UNIMOD:188	ms_run[1]:scan=10049	63.80441666666666	3	3450.662149	3450.662034	R	I	122	155
PSM	QLFHPEQLITGKEDAANNYAR	250	sp|P68363|TBA1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:28	ms_run[1]:scan=9161	58.01072833333333	2	2397.1727	2397.1708	R	G	85	106
PSM	IHFPLATYAPVISAEK	251	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=9610	60.86794833333333	2	1755.957413	1755.955957	R	A	265	281
PSM	AGGAAVVITEPEHTKER	252	sp|Q9P258|RCC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	15-UNIMOD:188,17-UNIMOD:267	ms_run[1]:scan=2605	17.924088333333334	2	1780.948241	1779.945010	K	V	78	95
PSM	QHNSGPNSKPVVSFIAGLTAPPGR	253	sp|P53597|SUCA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:28	ms_run[1]:scan=10253	65.221195	2	2413.2520	2413.2497	K	R	272	296
PSM	MMVDKDGDVTVTNDGATILSMMDVDHQIAK	254	sp|P48643|TCPE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	1-UNIMOD:35,5-UNIMOD:188,30-UNIMOD:188	ms_run[1]:scan=10869	69.37665166666667	3	3277.542601	3277.537745	K	L	60	90
PSM	NIPGITLLNVSKLNILK	255	sp|P36578|RL4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=12178	78.33429333333333	2	1850.137109	1849.140070	R	L	223	240
PSM	TSPVADAAGWVDVDKETLQHR	256	sp|Q9Y6N5|SQOR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=8199	51.94912	2	2295.134105	2294.129124	K	R	306	327
PSM	AGGPGLERGEAGVPAEFSIWTR	257	sp|O75369-2|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	8-UNIMOD:267,22-UNIMOD:267	ms_run[2]:scan=9733	61.769	3	2276.1453	2276.1453	R	E	2174	2196
PSM	ALESPERPFLAILGGAK	258	sp|P00558-2|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=10802	68.929	2	1767.9883	1767.9883	K	V	172	189
PSM	ATKSPEEGAETPVYLALLPPDAEGPHGQFVSEK	259	sp|P16152|CBR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=9904	62.87	3	3463.7147	3463.7147	K	R	240	273
PSM	DFTVSAMHGDMDQKER	260	sp|P60842-2|IF4A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=5025	32.485	2	1865.8036	1865.8036	R	D	296	312
PSM	DVYKEHFQDDVFNEK	261	sp|P43490|NAMPT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	4-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=6197	39.594	2	1923.9042	1923.9042	K	G	85	100
PSM	EIIEVLQKGDGNAHSK	262	sp|Q15397|PUM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=4507	29.438	2	1736.9057	1736.9057	R	K	457	473
PSM	EVVNKDVLDVYIEHR	263	sp|P33993|MCM7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=7352	46.613	2	1826.9527	1826.9527	R	L	92	107
PSM	FSMPGFKGEGPEVDVNLPK	264	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	7-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=9328	59.051	2	2059.0487	2059.0487	K	A	2251	2270
PSM	GHTDSVQDISFDHSGK	265	sp|P43034|LIS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	16-UNIMOD:188	ms_run[2]:scan=3900	25.819	2	1734.7905	1734.7905	K	L	148	164
PSM	GLCRPENIGYPFLVSVPASR	266	sp|O94966-4|UBP19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:4,4-UNIMOD:267,20-UNIMOD:267	ms_run[2]:scan=9932	63.049	2	2251.1686	2251.1686	K	L	818	838
PSM	GPIKFNVWDTAGQEK	267	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	4-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=7633	48.341	2	1700.8925	1700.8925	R	F	57	72
PSM	GPIKFNVWDTAGQEK	268	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=7635	48.355	2	1688.8522	1688.8522	R	F	57	72
PSM	GYLNKDTHDQLSEPSEVR	269	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=4270	28.028	3	2086.992	2086.9920	R	S	3964	3982
PSM	GYLNKDTHDQLSEPSEVR	270	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=4271	28.033	2	2086.992	2086.9920	R	S	3964	3982
PSM	HLVVPGDTITTDTGFMR	271	sp|Q13868-3|EXOS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	17-UNIMOD:267	ms_run[2]:scan=8219	52.075	2	1868.933	1868.9330	K	G	25	42
PSM	HQDVPSQDDSKPTQR	272	sp|Q9NRN7|ADPPT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=735	7.2828	2	1736.8078	1736.8078	R	Q	253	268
PSM	HSSVYPTQEELEAVQNMVSHTER	273	sp|Q12906-5|ILF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	23-UNIMOD:267	ms_run[2]:scan=10000	63.487	2	2680.2427	2680.2427	K	A	18	41
PSM	HTGPGILSMANAGPNTNGSQFFICTAK	274	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	24-UNIMOD:4,27-UNIMOD:188	ms_run[2]:scan=9531	60.337	3	2796.3419	2796.3419	K	T	92	119
PSM	HVVSCSSQDSTHCAENLLK	275	sp|P18887|XRCC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	5-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=4322	28.34	2	2170.9736	2170.9736	R	A	8	27
PSM	HYCEPYTTWCQETYSQTKPK	276	sp|Q9BUR5|MIC26_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=5902	37.806	2	2606.1206	2606.1206	R	M	69	89
PSM	HYNEEGSQVYNDAHILEK	277	sp|Q86U86-6|PB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=5601	35.999	3	2144.9763	2144.9763	R	L	599	617
PSM	IGGVQQDTILAEGLHFR	278	sp|Q99623-2|PHB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=9348	59.176	3	1852.9795	1852.9795	R	I	55	72
PSM	IGGVQQDTILAEGLHFR	279	sp|Q99623-2|PHB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	17-UNIMOD:267	ms_run[2]:scan=9352	59.202	2	1862.9878	1862.9878	R	I	55	72
PSM	IRDGWQVEEADDWLR	280	sp|P06737-2|PYGL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=9281	58.759	2	1886.8911	1886.8911	K	Y	137	152
PSM	KDDEENYLDLFSHK	281	sp|Q07666|KHDR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=8108	51.373	2	1751.8002	1751.8002	K	N	139	153
PSM	KDYSQYEENITHLQEQIVDGK	282	sp|Q9C075|K1C23_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:188,21-UNIMOD:188	ms_run[2]:scan=9036	57.226	3	2548.2484	2548.2484	K	M	117	138
PSM	KEYEQELSDDLHVER	283	sp|Q7Z7F7|RM55_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=5986	38.302	2	1888.8803	1888.8803	R	Y	104	119
PSM	KQFGAQANVIGPWIQTK	284	sp|P12814-2|ACTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=8023	50.837	2	1885.021	1885.0210	R	M	633	650
PSM	KTQTVCNFTDGALVQHQEWDGK	285	sp|Q01469|FABP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:4	ms_run[2]:scan=6724	42.773	3	2561.1969	2561.1969	R	E	82	104
PSM	KYEDICPSTHNMDVPNIK	286	sp|P63241|IF5A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:188,6-UNIMOD:4,18-UNIMOD:188	ms_run[2]:scan=5805	37.22	3	2172.0382	2172.0382	K	R	68	86
PSM	LHPVILASIVDSYER	287	sp|O00303|EIF3F_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=10263	65.287	2	1710.9305	1710.9305	R	R	94	109
PSM	LLIHQSLAGGIIGVK	288	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=8103	51.342	2	1517.9293	1517.9293	R	G	125	140
PSM	NFEATLGWLQEHACSR	289	sp|Q9P2J5|SYLC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	14-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=10340	65.793	2	1927.8874	1927.8874	R	T	560	576
PSM	NHEEEVKGLQAQIASSGLTVEVDAPK	290	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	7-UNIMOD:188,26-UNIMOD:188	ms_run[2]:scan=8327	52.771	3	2760.4333	2760.4333	K	S	216	242
PSM	RFGFPEGSVELYAEK	291	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=8232	52.155	2	1727.8519	1727.8519	K	V	76	91
PSM	RVNLAIWDTAGQER	292	sp|Q9UL25|RAB21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:267,14-UNIMOD:267	ms_run[2]:scan=7377	46.768	2	1647.8596	1647.8596	K	F	67	81
PSM	SGVEKDLDEVLQTHSVFVNVSK	293	sp|Q9Y3A5|SBDS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	5-UNIMOD:188,22-UNIMOD:188	ms_run[2]:scan=10247	65.184	2	2441.2841	2441.2841	R	G	41	63
PSM	SPSKENIASVLENYHTESK	294	sp|Q6NVY1-2|HIBCH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=6661	42.391	2	2132.0386	2132.0386	K	I	234	253
PSM	THLTEDTPKVNADIEK	295	sp|Q15738|NSDHL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=4010	26.481	2	1809.9109	1809.9109	R	V	16	32
PSM	TQDQISNIKYHEEFEK	296	sp|Q14847-3|LASP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	9-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=4694	30.532	2	2019.994	2019.9940	K	S	57	73
PSM	TQDQISNIKYHEEFEK	297	sp|Q14847-3|LASP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=4695	30.538	2	2007.9538	2007.9538	K	S	57	73
PSM	TTGIVMDSGDGVTHTVPIYEGYALPHAILR	298	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:35,30-UNIMOD:267	ms_run[2]:scan=9832	62.401	3	3208.6102	3208.6102	R	L	148	178
PSM	TYEEGLKHEANNPQLK	299	sp|P31948|STIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=3497	23.415	2	1869.9221	1869.9221	R	E	94	110
PSM	TYEEGLKHEANNPQLK	300	sp|P31948|STIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	7-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=3541	23.682	2	1881.9623	1881.9623	R	E	94	110
PSM	VAPEEHPVLLTEAPLNPK	301	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	18-UNIMOD:188	ms_run[2]:scan=7067	44.848	2	1959.0773	1959.0773	R	A	96	114
PSM	VAQGVSGAVQDKGSIHK	302	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=1879	13.791	2	1679.8955	1679.8955	K	F	439	456
PSM	YGEAGEGPGWGGAHPR	303	sp|P26640|SYVC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=3695	24.601	2	1596.707	1596.7070	R	I	24	40
PSM	YTEFYHVPTHSDASK	304	sp|Q96HC4-7|PDLI5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	15-UNIMOD:188	ms_run[2]:scan=4303	28.224	2	1786.8258	1786.8258	R	K	144	159
PSM	QISRPSAAGINLMIGSTR	305	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:28	ms_run[1]:scan=9266	58.66389833333333	2	1853.9789	1853.9776	R	Y	1137	1155
PSM	HTGPGILSMANAGPNTNGSQFFICTAK	306	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	24-UNIMOD:4,27-UNIMOD:188	ms_run[1]:scan=9846	62.49419	3	2797.323939	2796.341898	K	T	92	119
PSM	ALCAEADRLQQSHPLSATQIQVK	307	sp|Q13813|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	3-UNIMOD:4,8-UNIMOD:267,23-UNIMOD:188	ms_run[1]:scan=6444	41.06337166666667	3	2581.351937	2579.346068	K	R	313	336
PSM	YDCYKVPEWCLDDWHPSEK	308	sp|Q9Y6M9|NDUB9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	3-UNIMOD:4,5-UNIMOD:188,10-UNIMOD:4,19-UNIMOD:188	ms_run[1]:scan=8943	56.64552666666667	3	2539.113090	2538.102290	R	A	94	113
PSM	AFQYVETHGEVCPANWTPDSPTIKPSPAASK	309	sp|P30048-2|PRDX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	12-UNIMOD:4,24-UNIMOD:188,31-UNIMOD:188	ms_run[2]:scan=7537	47.74	3	3396.6487	3396.6487	K	E	200	231
PSM	AHEEQLKEAQAVPATLPELEATK	310	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	7-UNIMOD:188,23-UNIMOD:188	ms_run[2]:scan=6996	44.409	2	2514.3368	2514.3368	R	A	1244	1267
PSM	AHGGYSVFAGVGER	311	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	14-UNIMOD:267	ms_run[2]:scan=5736	36.807	2	1415.6821	1415.6821	K	T	226	240
PSM	ATSLGRPEEEEDELAHR	312	sp|P36551-2|HEM6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=4205	27.624	2	1937.9079	1937.9079	R	C	110	127
PSM	CCNHPYLFPVAAMEAPK	313	sp|Q14839|CHD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:4,2-UNIMOD:4	ms_run[2]:scan=8889	56.308	2	2003.9056	2003.9056	K	M	1018	1035
PSM	DVACGANHTLVLDSQKR	314	sp|Q9P258|RCC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	4-UNIMOD:4	ms_run[2]:scan=3917	25.922	2	1882.9319	1882.9319	R	V	334	351
PSM	DVYKEHFQDDVFNEK	315	sp|P43490|NAMPT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=6194	39.572	2	1911.8639	1911.8639	K	G	85	100
PSM	EHSNPNYDKTSAPITCELLNK	316	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	16-UNIMOD:4	ms_run[2]:scan=5954	38.119	2	2430.1485	2430.1485	R	Q	1984	2005
PSM	ELDTVTLEDIKEHVK	317	sp|O43242|PSMD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=7626	48.305	2	1767.9254	1767.9254	R	Q	66	81
PSM	FCFTPHTEEGCLSER	318	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=6200	39.613	2	1868.7822	1868.7822	K	A	1117	1132
PSM	GADSLEDFLYHEGYACTSIHGDR	319	sp|O00571-2|DDX3X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	16-UNIMOD:4,23-UNIMOD:267	ms_run[2]:scan=9856	62.557	3	2622.132	2622.1320	K	S	437	460
PSM	GAPVGGHILSYLLEK	320	sp|O00159-2|MYO1C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:188	ms_run[2]:scan=10060	63.87	2	1558.8815	1558.8815	K	S	175	190
PSM	GFGFITFTNPEHASVAMR	321	sp|P98179|RBM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	18-UNIMOD:267	ms_run[2]:scan=10108	64.185	2	1990.9599	1990.9599	R	A	48	66
PSM	GHTDSVQDISFDHSGK	322	sp|P43034|LIS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=3899	25.813	2	1728.7703	1728.7703	K	L	148	164
PSM	GIKGEEIVQQLIENSTTFR	323	sp|Q9UJA5-2|TRM6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=12391	79.916	2	2161.1379	2161.1379	K	D	118	137
PSM	GKPAVAALGDLTDLPTYEHIQTALSSK	324	sp|Q10713-2|MPPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:188,27-UNIMOD:188	ms_run[2]:scan=11056	70.633	3	2807.5108	2807.5108	R	D	356	383
PSM	HNIAYFPQIVSVAAR	325	sp|Q96AB3-3|ISOC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=8979	56.871	2	1684.9049	1684.9049	R	M	29	44
PSM	HTGPGILSMANAGPNTNGSQFFICTAK	326	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	9-UNIMOD:35,24-UNIMOD:4,27-UNIMOD:188	ms_run[2]:scan=8264	52.358	3	2812.3368	2812.3368	K	T	92	119
PSM	HTGPNSPDTANDGFVR	327	sp|P31943|HNRH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=3110	21.023	2	1683.7601	1683.7601	K	L	99	115
PSM	HVIPMNPNTNDLFNAVGDGIVLCK	328	sp|P13796|PLSL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	5-UNIMOD:35,23-UNIMOD:4	ms_run[2]:scan=10438	66.47	3	2653.2992	2653.2992	R	M	142	166
PSM	IFVGGIPHNCGETELR	329	sp|Q96EP5-2|DAZP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	10-UNIMOD:4	ms_run[2]:scan=6355	40.533	2	1797.8832	1797.8832	K	E	115	131
PSM	IGRPSETGIIGIIDPECR	330	sp|Q16531|DDB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:267,17-UNIMOD:4,18-UNIMOD:267	ms_run[2]:scan=9351	59.196	2	2002.042	2002.0420	R	M	112	130
PSM	IHFPLATYAPVISAEK	331	sp|Q71U36-2|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	16-UNIMOD:188	ms_run[2]:scan=9484	60.023	2	1761.9761	1761.9761	R	A	230	246
PSM	IHFPLATYAPVISAEK	332	sp|Q71U36-2|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	16-UNIMOD:188	ms_run[2]:scan=9630	61.028	2	1761.9761	1761.9761	R	A	230	246
PSM	IIHEDGYSEDECKQYK	333	sp|P08754|GNAI3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	12-UNIMOD:4	ms_run[2]:scan=2691	18.402	2	2012.8786	2012.8786	K	V	55	71
PSM	KDDEENYLDLFSHK	334	sp|Q07666|KHDR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=8109	51.378	2	1763.8405	1763.8405	K	N	139	153
PSM	KEGGQYGLVAACAAGGQGHAMIVEAYPK	335	sp|P55084-2|ECHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	12-UNIMOD:4	ms_run[2]:scan=7274	46.144	3	2832.3687	2832.3687	R	-	425	453
PSM	KTQNDVLHAENVK	336	sp|P35241|RADI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=1848	13.623	2	1494.7791	1494.7791	K	A	544	557
PSM	KVMVLDFVTPTPLGTR	337	sp|Q16881-5|TRXR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=10079	63.987	2	1772.9859	1772.9859	K	W	37	53
PSM	KVNAEGSVDSVFSQVCTHLDALK	338	sp|P00568|KAD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	16-UNIMOD:4	ms_run[2]:scan=11029	70.453	3	2503.2377	2503.2377	R	-	172	195
PSM	LFDHPESPTPNPTEPLFLAQAEVYK	339	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=10973	70.083	3	2839.4069	2839.4069	R	E	968	993
PSM	LLIHQSLAGGIIGVK	340	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:188	ms_run[2]:scan=8100	51.326	2	1523.9495	1523.9495	R	G	125	140
PSM	MLETKWSLLQQQK	341	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:35	ms_run[2]:scan=6728	42.8	2	1647.8654	1647.8654	K	T	118	131
PSM	MRYVASYLLAALGGNSSPSAK	342	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:35,2-UNIMOD:267,21-UNIMOD:188	ms_run[2]:scan=10644	67.814	2	2187.1329	2183.1447	-	D	1	22
PSM	NDTKEDVFVHQTAIK	343	sp|P16989-2|YBOX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=4248	27.89	2	1743.8792	1743.8792	R	K	110	125
PSM	NIDNPALADIYTEHAHQVVVAK	344	sp|O75083|WDR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	22-UNIMOD:188	ms_run[2]:scan=7461	47.256	2	2423.2541	2423.2541	R	Y	44	66
PSM	NKEDQYDHLDAADMTK	345	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=4301	28.212	2	1892.8211	1892.8211	K	V	718	734
PSM	NLDAVHDITVAYPHNIPQSEK	346	sp|Q6UWP7-3|LCLT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	21-UNIMOD:188	ms_run[2]:scan=7156	45.412	2	2366.1962	2366.1962	K	H	212	233
PSM	NLDAVHDITVAYPHNIPQSEK	347	sp|Q6UWP7-3|LCLT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=7137	45.294	2	2360.1761	2360.1761	K	H	212	233
PSM	NLLHSLQSSGIGSK	348	sp|Q92616|GCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=6441	41.049	2	1439.7732	1439.7732	K	A	88	102
PSM	NLLHSLQSSGIGSK	349	sp|Q92616|GCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	14-UNIMOD:188	ms_run[2]:scan=6442	41.054	2	1445.7934	1445.7934	K	A	88	102
PSM	NLSDSEKELYIQHAK	350	sp|Q00059-2|TFAM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=4722	30.686	2	1773.8897	1773.8897	K	E	159	174
PSM	SHYADVDPENQNFLLESNLGKK	351	sp|Q96QD8|S38A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	21-UNIMOD:188,22-UNIMOD:188	ms_run[2]:scan=7348	46.592	3	2529.2538	2529.2538	K	K	39	61
PSM	TGTIVVEGHELHDEDIR	352	sp|P41252|SYIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=5437	34.999	2	1918.9385	1918.9385	K	L	930	947
PSM	TGTIVVEGHELHDEDIR	353	sp|P41252|SYIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	17-UNIMOD:267	ms_run[2]:scan=5440	35.014	2	1928.9467	1928.9467	K	L	930	947
PSM	TKDEYLINSQTTEHIVK	354	sp|Q9NSE4|SYIM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=5386	34.678	3	2030.0723	2030.0723	K	L	539	556
PSM	TYGADLASVDFQHASEDARK	355	sp|P30740|ILEU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=6490	41.345	2	2180.0134	2180.0134	K	T	111	131
PSM	VSALNSVHCEHVEDEGESR	356	sp|Q13085-3|ACACA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	9-UNIMOD:4,19-UNIMOD:267	ms_run[2]:scan=3382	22.701	2	2162.9526	2162.9526	R	Y	1683	1702
PSM	VTWAHPEFGQVLASCSFDR	357	sp|Q96EE3|SEH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:4,19-UNIMOD:267	ms_run[2]:scan=9839	62.447	2	2216.0348	2216.0348	R	T	63	82
PSM	VVCDENGSKGYGFVHFETQEAAER	358	sp|P11940-2|PABP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:4	ms_run[2]:scan=6431	40.989	3	2728.2187	2728.2187	K	A	130	154
PSM	YDCYKVPEWCLDDWHPSEK	359	sp|Q9Y6M9|NDUB9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=8939	56.622	3	2526.062	2526.0620	R	A	94	113
PSM	YLTEHPDPNNENIVGYNNKK	360	sp|Q6P2Q9|PRP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=4551	29.692	2	2358.124	2358.1240	R	C	1113	1133
PSM	YTEFYHVPTHSDASK	361	sp|Q96HC4-7|PDLI5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=4302	28.218	2	1780.8057	1780.8057	R	K	144	159
PSM	IHFPLATYAPVISAEK	362	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=9458	59.860838333333334	2	1755.957413	1755.955957	R	A	265	281
PSM	IHFPLATYAPVISAEK	363	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=9751	61.88548833333333	2	1755.957413	1755.955957	R	A	265	281
PSM	HTGPGILSMANAGPNTNGSQFFICTAK	364	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	9-UNIMOD:35,24-UNIMOD:4,27-UNIMOD:188	ms_run[1]:scan=8491	53.803578333333334	2	2813.322835	2812.336813	K	T	92	119
PSM	LEHVVEEEKVDISEDGMK	365	sp|P40937|RFC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	9-UNIMOD:188,18-UNIMOD:188	ms_run[1]:scan=5483	35.28080666666666	3	2098.034062	2097.033859	R	A	186	204
PSM	HNALIQEVISQSR	366	sp|Q13617|CUL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=7009	44.49171166666667	2	1493.796061	1493.795040	R	A	696	709
PSM	VIECDVVKDYAFVHMEK	367	sp|Q96PK6|RBM14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	4-UNIMOD:4	ms_run[1]:scan=8020	50.813853333333334	2	2080.984221	2080.996184	R	E	105	122
PSM	FHQLLDDESDPFDILR	368	sp|Q5JVS0|HABP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	16-UNIMOD:267	ms_run[1]:scan=11446	73.236255	2	1968.945733	1968.945676	R	E	28	44
PSM	AHGGYSVFAGVGER	369	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=5739	36.823	2	1405.6739	1405.6739	K	T	226	240
PSM	AKVTEELAAATAQVSHLQLK	370	sp|Q5T1M5|FKB15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=9493	60.08	2	2119.204	2119.2040	K	M	639	659
PSM	ALDVIQAGKEYVEHTVK	371	sp|O75937|DNJC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	9-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=8940	56.627	2	1911.0504	1911.0504	R	E	119	136
PSM	ALESPERPFLAILGGAK	372	sp|P00558-2|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=10660	67.918	2	1767.9883	1767.9883	K	V	172	189
PSM	ATKSPEEGAETPVYLALLPPDAEGPHGQFVSEK	373	sp|P16152|CBR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:188,33-UNIMOD:188	ms_run[2]:scan=9897	62.825	3	3475.755	3475.7550	K	R	240	273
PSM	CGQEEHDVLLSNEEDRK	374	sp|Q9UGI8-2|TES_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:4	ms_run[2]:scan=3235	21.805	2	2056.912	2056.9120	K	V	37	54
PSM	DSIEKEHVEEISELFYDAK	375	sp|Q9Y265|RUVB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	5-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=10357	65.909	2	2292.12	2292.1200	K	S	423	442
PSM	ELLLPNWQGSGSHGLTIAQR	376	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	20-UNIMOD:267	ms_run[2]:scan=9432	59.692	2	2186.1472	2186.1472	R	D	9	29
PSM	EVHKQVVESAYEVIK	377	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=5373	34.603	2	1768.9762	1768.9762	K	L	229	244
PSM	EVVKHPSVESVVQCEIDEDVIQVSK	378	sp|P19623|SPEE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:4	ms_run[2]:scan=10560	67.273	3	2851.4273	2851.4273	R	K	110	135
PSM	EVVNKDVLDVYIEHR	379	sp|P33993|MCM7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=7351	46.608	3	1826.9527	1826.9527	R	L	92	107
PSM	FHDLLSQLDDQYSR	380	sp|P42224-2|STAT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:267	ms_run[2]:scan=8846	56.035	2	1745.8248	1745.8248	R	F	57	71
PSM	FITHAPPGEFNEVFNDVR	381	sp|P52907|CAZA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	18-UNIMOD:267	ms_run[2]:scan=9027	57.169	2	2098.0148	2098.0148	K	L	20	38
PSM	FKGPFTDVVTTNLK	382	sp|Q9P0L0|VAPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=8099	51.32	2	1577.8856	1577.8856	K	L	25	39
PSM	GADSLEDFLYHEGYACTSIHGDR	383	sp|O00571-2|DDX3X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	16-UNIMOD:4	ms_run[2]:scan=9866	62.622	2	2612.1238	2612.1238	K	S	437	460
PSM	GFAFVTFDDHDTVDKIVVQK	384	sp|P51991|ROA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9690	61.455	2	2280.1426	2280.1426	R	Y	168	188
PSM	GLQEFLDRNSQFAGGPLGNPNTTAK	385	sp|O75694-2|NU155_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9438	59.727	2	2631.3041	2631.3041	K	V	657	682
PSM	GVNWAAFHPTMPLIVSGADDR	386	sp|P53621|COPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=11254	71.954	2	2253.1001	2253.1001	R	Q	207	228
PSM	HENVIGLLDVFTPAR	387	sp|Q16539-2|MK14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=11831	75.894	2	1679.8995	1679.8995	K	S	80	95
PSM	HFSTEDGIFQGQR	388	sp|Q6RFH5-2|WDR74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=5341	34.419	2	1520.7008	1520.7008	K	H	69	82
PSM	HGFCGIPITDTGR	389	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=5958	38.147	2	1439.6855	1439.6855	R	M	137	150
PSM	HGGTIPIVPTAEFQDR	390	sp|P00367-2|DHE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=7222	45.826	2	1736.8846	1736.8846	K	I	314	330
PSM	HQTLQGVAFPISR	391	sp|Q12792-4|TWF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	13-UNIMOD:267	ms_run[2]:scan=6632	42.214	2	1462.792	1462.7920	K	E	74	87
PSM	HVFGESDELIGQK	392	sp|P60174-4|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=5495	35.355	2	1457.7151	1457.7151	R	V	19	32
PSM	HVFGESDELIGQK	393	sp|P60174-4|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	13-UNIMOD:188	ms_run[2]:scan=5503	35.403	2	1463.7352	1463.7352	R	V	19	32
PSM	HYCEPYTTWCQETYSQTKPK	394	sp|Q9BUR5|MIC26_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=5872	37.626	3	2606.1206	2606.1206	R	M	69	89
PSM	IGGVQQDTILAEGLHFR	395	sp|Q99623-2|PHB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	17-UNIMOD:267	ms_run[2]:scan=9350	59.191	3	1862.9878	1862.9878	R	I	55	72
PSM	IHFPLATYAPVISAEK	396	sp|Q71U36-2|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	16-UNIMOD:188	ms_run[2]:scan=9319	58.997	2	1761.9761	1761.9761	R	A	230	246
PSM	IHFPLATYAPVISAEK	397	sp|Q71U36-2|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	16-UNIMOD:188	ms_run[2]:scan=9776	62.039	2	1761.9761	1761.9761	R	A	230	246
PSM	IIHDFPQFYPLGIVQHD	398	sp|P35244|RFA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=11334	72.487	2	2038.0312	2038.0312	K	-	105	122
PSM	IITVEKHPDADSLYVEK	399	sp|P54577|SYYC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=5395	34.735	2	1956.0204	1956.0204	K	I	375	392
PSM	IPNIYAIGDVVAGPMLAHK	400	sp|P09622-2|DLDH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=11987	76.999	2	1978.071	1978.0710	K	A	248	267
PSM	ISGASEKDIVHSGLAYTMER	401	sp|P00367-2|DHE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	7-UNIMOD:188,20-UNIMOD:267	ms_run[2]:scan=6984	44.34	2	2179.0914	2175.1033	R	S	330	350
PSM	IVAERPGTNSTGPAPMAPPR	402	sp|Q13263-2|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=4174	27.452	2	2018.0367	2018.0367	K	A	326	346
PSM	IVDKPGDHDPETLEAIAENAK	403	sp|Q96Q11-2|TRNT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=6567	41.817	3	2261.1176	2261.1176	R	G	208	229
PSM	KECENCDCLQGFQLTHSLGGGTGSGMGTLLISK	404	sp|Q13509-2|TBB3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:4,6-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=10013	63.574	3	3554.6262	3554.6262	R	V	50	83
PSM	KFDFDACNEVPPAPK	405	sp|Q15424-2|SAFB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:188,7-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=6255	39.943	2	1745.8486	1745.8486	R	E	287	302
PSM	KIEPELDGSAQVTSHDASTNGLINFIK	406	sp|P06744-2|G6PI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9009	57.06	2	2883.4614	2883.4614	K	Q	535	562
PSM	KQFGAQANVIGPWIQTK	407	sp|P12814-2|ACTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=7994	50.643	2	1897.0613	1897.0613	R	M	633	650
PSM	KQFGAQANVIGPWIQTK	408	sp|P12814-2|ACTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=8062	51.087	2	1885.021	1885.0210	R	M	633	650
PSM	KTQNDVLHAENVK	409	sp|P35241|RADI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=1847	13.618	2	1506.8193	1506.8193	K	A	544	557
PSM	LEHVVEEEKVDISEDGMK	410	sp|P40937-2|RFC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=5484	35.287	3	2084.9936	2084.9936	R	A	165	183
PSM	LHIIEVGTPPTGNQPFPK	411	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=7578	48.006	2	1944.0469	1944.0469	K	K	228	246
PSM	LQVTNVLSQPLTQATVKLEHAK	412	sp|P04844-2|RPN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	17-UNIMOD:188,22-UNIMOD:188	ms_run[2]:scan=9625	60.99	2	2429.4045	2429.4045	R	S	258	280
PSM	LYKEELEQTYHAK	413	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=3781	25.122	2	1650.8253	1650.8253	R	L	259	272
PSM	MGPGAASGGERPNLK	414	sp|Q9H0U4|RAB1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:35	ms_run[2]:scan=1574	12.077	2	1456.7093	1456.7093	R	I	173	188
PSM	NDTKEDVFVHQTAIK	415	sp|P16989-2|YBOX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=4247	27.884	2	1755.9194	1755.9194	R	K	110	125
PSM	NGAPIIMSFPHFYQADER	416	sp|Q14108-2|SCRB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=10426	66.382	2	2091.9836	2091.9836	K	F	188	206
PSM	NIQDTSDLDAIAKDVFQHSQSR	417	sp|Q9NZB2-4|F120A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=10507	66.923	2	2487.199	2487.1990	R	T	292	314
PSM	NKTEDLEATSEHFK	418	sp|Q9BV40|VAMP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=3740	24.873	2	1647.774	1647.7740	R	T	46	60
PSM	NVNAGGHKLGLGLEFQA	419	sp|P21796|VDAC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	8-UNIMOD:188	ms_run[2]:scan=7728	48.916	2	1729.9207	1729.9207	K	-	267	284
PSM	RLTLEDLEDSWDR	420	sp|Q6P2Q9|PRP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9959	63.226	2	1646.79	1646.7900	R	G	1402	1415
PSM	RSLEQNIQLPAALLSR	421	sp|P33993|MCM7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=9440	59.744	2	1828.0434	1828.0434	R	F	499	515
PSM	RTYVTPPGTGFLPGDTAR	422	sp|Q9NPF4|OSGEP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=6881	43.722	2	1904.9745	1904.9745	R	H	30	48
PSM	SGVEKDLDEVLQTHSVFVNVSK	423	sp|Q9Y3A5|SBDS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=10248	65.191	2	2429.2438	2429.2438	R	G	41	63
PSM	SHYADVDPENQNFLLESNLGKK	424	sp|Q96QD8|S38A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=7340	46.543	3	2517.2136	2517.2136	K	K	39	61
PSM	SKEELHQDCLVLATAK	425	sp|Q8TEQ6|GEMI5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:188,9-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=4579	29.858	2	1852.9756	1852.9756	R	H	859	875
PSM	TEELNREVAGHTEQLQMSR	426	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=4991	32.282	3	2227.0651	2227.0651	R	S	275	294
PSM	TKGVDEVTIVNILTNR	427	sp|P07355-2|ANXA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=10322	65.668	2	1770.984	1770.9840	K	S	66	82
PSM	TKPSDEEMLFIYGHYK	428	sp|P07108|ACBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=7734	48.956	2	1956.9291	1956.9292	K	Q	18	34
PSM	TSWAGAPVHLGQGQFLK	429	sp|P48681|NEST_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	17-UNIMOD:188	ms_run[2]:scan=8198	51.943	2	1801.9571	1801.9571	K	F	1589	1606
PSM	TSYEEFTHKDGVWNLQNEVTK	430	sp|Q6P2Q9|PRP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=7687	48.666	2	2524.187	2524.1870	R	E	1202	1223
PSM	TVNKHGDEIITSTTSNYETQTFSSK	431	sp|Q6P2Q9|PRP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=5700	36.594	2	2787.3199	2787.3199	R	T	2046	2071
PSM	TVSLGAGAKDELHIVEAEAMNYEGSPIK	432	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	20-UNIMOD:35	ms_run[2]:scan=10439	66.476	3	2944.4488	2944.4488	R	V	46	74
PSM	TVSLGAGAKDELHIVEAEAMNYEGSPIK	433	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	9-UNIMOD:188,28-UNIMOD:188	ms_run[2]:scan=10939	69.855	3	2940.4941	2940.4941	R	V	46	74
PSM	TYEEGLKHEANNPQLK	434	sp|P31948|STIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=3446	23.095	2	1869.9221	1869.9221	R	E	94	110
PSM	VAPEEHPVLLTEAPLNPK	435	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=7073	44.889	2	1953.0571	1953.0571	R	A	96	114
PSM	VEGIVHPTTAEIDLKEDIGK	436	sp|Q9P0M6|H2AW_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=7068	44.854	3	2163.1423	2163.1423	R	A	212	232
PSM	VKAFGPGLQGGSAGSPAR	437	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=4069	26.838	3	1655.8744	1655.8744	K	F	1070	1088
PSM	VLQHYQESDKGEELGPGNVQK	438	sp|Q9Y6C9|MTCH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=3629	24.218	2	2354.1503	2354.1503	K	E	91	112
PSM	VSHLLGINVTDFTR	439	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9141	57.888	2	1570.8467	1570.8467	K	G	374	388
PSM	FSMPGFKAEGPEVDVNLPK	440	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	3-UNIMOD:35,7-UNIMOD:188,19-UNIMOD:188	ms_run[1]:scan=7595	48.113771666666665	2	2089.055759	2089.059286	K	A	885	904
PSM	QLFHPEQLITGKEDAANNYAR	441	sp|P68363|TBA1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:28	ms_run[1]:scan=9144	57.90376333333333	3	2397.1728	2397.1708	R	G	85	106
PSM	HTGPGILSMANAGPNTNGSQFFICTAK	442	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	9-UNIMOD:35,24-UNIMOD:4	ms_run[1]:scan=8493	53.815038333333334	2	2807.303221	2806.316684	K	T	92	119
PSM	VYAILTHGIFSGPAISR	443	sp|P60891|PRPS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	17-UNIMOD:267	ms_run[1]:scan=9828	62.37671166666667	2	1812.978032	1810.996923	R	I	244	261
PSM	QHNSGPNSKPVVSFIAGLTAPPGR	444	sp|P53597|SUCA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:28,9-UNIMOD:188,24-UNIMOD:267	ms_run[1]:scan=10230	65.06966833333334	2	2429.2789	2429.2781	K	R	272	296
PSM	SPSDEYKDNLHQVSK	445	sp|Q9UKD2|MRT4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	7-UNIMOD:188,15-UNIMOD:188	ms_run[1]:scan=2513	17.414828333333332	2	1758.864490	1757.862301	R	R	80	95
PSM	AQLHDTNMELTDLKLQLEK	446	sp|O14974|MYPT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=8433	53.43623666666667	2	2240.152427	2239.151833	K	A	948	967
PSM	AGAGPGGPPQKPAPSSQR	447	sp|Q9Y5J1|UTP18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=920	8.3005	2	1658.8489	1658.8489	K	K	31	49
PSM	AIVDCGFEHPSEVQHECIPQAILGMDVLCQAK	448	sp|Q13838|DX39B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	5-UNIMOD:4,17-UNIMOD:4,29-UNIMOD:4,32-UNIMOD:188	ms_run[2]:scan=11252	71.942	3	3656.7191	3656.7191	R	S	59	91
PSM	ALCAEADRLQQSHPLSATQIQVK	449	sp|Q13813-3|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:4	ms_run[2]:scan=6452	41.113	2	2563.3177	2563.3177	K	R	313	336
PSM	ALDMSYDHKPEDEVELAR	450	sp|O15355|PPM1G_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=6091	38.934	2	2116.9735	2116.9735	K	I	359	377
PSM	ALEEETKNHEAQIQDMR	451	sp|P35580|MYH10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=4190	27.542	2	2040.9535	2040.9535	K	Q	1182	1199
PSM	ASELGHSLNENVLKPAQEK	452	sp|Q8N6T3-4|ARFG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=5078	32.839	2	2063.0647	2063.0647	K	V	127	146
PSM	ASGNYATVISHNPETKK	453	sp|P62917|RL8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=3091	20.908	2	1815.9115	1815.9115	R	T	129	146
PSM	CLCVDRLPPGFNDVDALCR	454	sp|Q8IY67-2|RAVR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:4,3-UNIMOD:4,18-UNIMOD:4	ms_run[2]:scan=9258	58.615	2	2276.05	2276.0500	R	A	222	241
PSM	DHASIQMNVAEVDKVTGR	455	sp|P63220|RS21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=6594	41.983	3	1968.9687	1968.9687	K	F	28	46
PSM	DNHLLGTFDLTGIPPAPR	456	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	18-UNIMOD:267	ms_run[2]:scan=10300	65.527	2	1943.014	1943.0140	K	G	475	493
PSM	EHSNPNYDKTSAPITCELLNK	457	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	9-UNIMOD:188,16-UNIMOD:4,21-UNIMOD:188	ms_run[2]:scan=5953	38.112	2	2442.1888	2442.1888	R	Q	1984	2005
PSM	ELDTVTLEDIKEHVK	458	sp|O43242|PSMD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	11-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=7619	48.264	2	1779.9657	1779.9657	R	Q	66	81
PSM	EVHIEKNDAETLQK	459	sp|Q9BPX3|CND3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=2389	16.716	2	1664.8772	1664.8772	K	C	546	560
PSM	FCKYEHDDIVSTVSVLSSGTQAVSGSK	460	sp|Q9BQA1|MEP50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:4,3-UNIMOD:188,27-UNIMOD:188	ms_run[2]:scan=8550	54.166	3	2912.4265	2912.4265	K	D	119	146
PSM	FCKYEHDDIVSTVSVLSSGTQAVSGSK	461	sp|Q9BQA1|MEP50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:4	ms_run[2]:scan=8551	54.173	3	2900.3862	2900.3862	K	D	119	146
PSM	FGNQADHFLGSLAFAK	462	sp|Q9H488-2|OFUT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=9479	59.991	2	1721.8526	1721.8526	R	L	44	60
PSM	FSMPGFKGEGPEVDVTLPK	463	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	7-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=9706	61.577	2	2046.0535	2046.0535	K	A	3610	3629
PSM	FVIGGPQGDAGLTGRK	464	sp|P31153-2|METK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=5775	37.032	2	1571.842	1571.8420	R	I	187	203
PSM	GAVEALAAALAHISGATSVDQR	465	sp|Q9NR30-2|DDX21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=12943	84.692	3	2107.1022	2107.1022	K	S	538	560
PSM	GAVTGHEECVDALLQHGAK	466	sp|O15084|ANR28_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	9-UNIMOD:4,19-UNIMOD:188	ms_run[2]:scan=5824	37.335	3	1996.9732	1996.9732	R	C	693	712
PSM	GFAFVTFDDHDTVDKIVVQK	467	sp|P51991|ROA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	15-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=9689	61.449	2	2292.1829	2292.1829	R	Y	168	188
PSM	GFGFITFTNPEHASVAMR	468	sp|P98179|RBM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=10105	64.162	2	1980.9516	1980.9516	R	A	48	66
PSM	GWLRDPSASPGDAGEQAIR	469	sp|P18206-2|VINC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	4-UNIMOD:267,19-UNIMOD:267	ms_run[2]:scan=6154	39.324	2	2001.9771	2001.9771	K	Q	282	301
PSM	HLFGQPNSAYDFK	470	sp|O95347-2|SMC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=6291	40.156	2	1522.7205	1522.7205	R	T	946	959
PSM	HLYTLDGGDIINALCFSPNR	471	sp|P63244|RACK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	15-UNIMOD:4	ms_run[2]:scan=11477	73.46	3	2275.1056	2275.1056	K	Y	226	246
PSM	HQILEQAVEDYAETVHQLSK	472	sp|Q01082-3|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=11287	72.173	3	2337.1601	2337.1601	K	T	1621	1641
PSM	HQTLQGVAFPISR	473	sp|Q12792-4|TWF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=6639	42.255	2	1452.7837	1452.7837	K	E	74	87
PSM	HSQFIGYPITLFVEK	474	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	15-UNIMOD:188	ms_run[2]:scan=11353	72.61	2	1783.9604	1783.9604	K	E	210	225
PSM	HSSVYPTQEELEAVQNMVSHTER	475	sp|Q12906-5|ILF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	23-UNIMOD:267	ms_run[2]:scan=10139	64.402	3	2680.2427	2680.2427	K	A	18	41
PSM	HVVSCSSQDSTHCAENLLK	476	sp|P18887|XRCC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	5-UNIMOD:4,13-UNIMOD:4,19-UNIMOD:188	ms_run[2]:scan=4311	28.271	3	2176.9937	2176.9937	R	A	8	27
PSM	HYCEPYTTWCQETYSQTKPK	477	sp|Q9BUR5|MIC26_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:4,10-UNIMOD:4,18-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=5899	37.789	3	2618.1609	2618.1609	R	M	69	89
PSM	IFRDGEEAGAYDGPR	478	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=4147	27.288	2	1651.759	1651.7590	K	T	105	120
PSM	IFRDGEEAGAYDGPR	479	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:267,15-UNIMOD:267	ms_run[2]:scan=4149	27.3	2	1671.7756	1671.7756	K	T	105	120
PSM	IGNTEDGAPHKEDEPSVGQVAR	480	sp|Q9C0C9|UBE2O_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=3128	21.134	2	2305.0935	2305.0935	R	V	662	684
PSM	ISNTAISISDHTALAQFCKEK	481	sp|P22102|PUR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	18-UNIMOD:4	ms_run[2]:scan=7255	46.025	2	2333.1685	2333.1685	K	K	45	66
PSM	KALVLDCHYPEDEVGQEDEAESDIFSIR	482	sp|Q07021|C1QBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	7-UNIMOD:4	ms_run[2]:scan=9746	61.85	3	3263.4929	3263.4929	K	E	180	208
PSM	KGFIGPGIDVPAPDMSTGER	483	sp|P00367-2|DHE3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=8149	51.636	2	2043.0095	2043.0095	K	E	45	65
PSM	KPGMFFNPEESELDLTYGNR	484	sp|P11413|G6PD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	4-UNIMOD:35	ms_run[2]:scan=8835	55.967	2	2359.0791	2359.0791	K	Y	408	428
PSM	KVLTGVAGEDAECHAAK	485	sp|O95373|IPO7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:188,13-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=2163	15.419	3	1766.9024	1766.9024	K	L	724	741
PSM	KVLTGVAGEDAECHAAK	486	sp|O95373|IPO7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	13-UNIMOD:4	ms_run[2]:scan=2173	15.475	3	1754.8621	1754.8621	K	L	724	741
PSM	LAISEDHVASVKK	487	sp|Q9HC35-2|EMAL4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=2888	19.698	2	1395.7722	1395.7722	R	S	52	65
PSM	LKVLGTAFDPFLGGK	488	sp|Q92598-2|HS105_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=10571	67.342	2	1573.9271	1573.9271	K	N	220	235
PSM	LQMEAPHIIVGTPGR	489	sp|P60842-2|IF4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:35,15-UNIMOD:267	ms_run[2]:scan=5266	33.983	2	1643.8693	1643.8693	K	V	147	162
PSM	LRGDAAAGPGPGAGAGAAAEPEPR	490	sp|Q6DKJ4|NXN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:267,24-UNIMOD:267	ms_run[2]:scan=3067	20.777	3	2135.0623	2135.0623	R	R	60	84
PSM	LSKEETVLATVQALQTASHLSQQADLR	491	sp|P04844-2|RPN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=11523	73.778	3	2936.5567	2936.5567	R	S	120	147
PSM	MFEIVFEDPKIPGEK	492	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:35	ms_run[2]:scan=9390	59.442	2	1793.891	1793.8910	K	Q	1251	1266
PSM	MLETKWSLLQQQK	493	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:35,5-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=6726	42.788	2	1659.9057	1659.9057	K	T	118	131
PSM	NGGLGHMNIALLSDLTK	494	sp|P30048-2|PRDX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=10818	69.035	2	1752.9193	1752.9193	K	Q	132	149
PSM	NIHESCMSQIGWNR	495	sp|P11413|G6PD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:4	ms_run[2]:scan=5717	36.696	2	1730.7617	1730.7617	K	I	153	167
PSM	NLSDSEKELYIQHAK	496	sp|Q00059-2|TFAM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	7-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=4732	30.744	2	1785.93	1785.9300	K	E	159	174
PSM	NLVQCGDFPHLLVYGPSGAGK	497	sp|P40938-2|RFC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	5-UNIMOD:4	ms_run[2]:scan=9911	62.912	2	2228.1048	2228.1048	R	K	28	49
PSM	QHLEETTQKAESQLLECK	498	sp|P12270|TPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	9-UNIMOD:188,17-UNIMOD:4,18-UNIMOD:188	ms_run[2]:scan=5708	36.643	2	2183.0931	2183.0931	R	A	1111	1129
PSM	QISRPSAAGINLMIGSTR	499	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=7449	47.188	2	1871.0047	1871.0047	R	Y	1137	1155
PSM	QKWLLLTGISAQQNR	500	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=8911	56.448	2	1754.9792	1754.9792	K	V	162	177
PSM	QVQHEESTEGEADHSGYAGELGFR	501	sp|Q92890-3|UFD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	24-UNIMOD:267	ms_run[2]:scan=5517	35.488	3	2642.1509	2642.1509	R	A	203	227
PSM	QVQHEESTEGEADHSGYAGELGFR	502	sp|Q92890-3|UFD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	24-UNIMOD:267	ms_run[2]:scan=5522	35.518	2	2642.1509	2642.1509	R	A	203	227
PSM	RGFVLQDTVEQLR	503	sp|P56192-2|SYMC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=8037	50.928	2	1559.842	1559.8420	K	C	376	389
PSM	RIEESAIDEVVVTNTIPHEVQK	504	sp|O60256-4|KPRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=7646	48.421	3	2505.3075	2505.3075	R	L	223	245
PSM	RLTLEDLEDSWDR	505	sp|Q6P2Q9|PRP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=9940	63.1	2	1646.79	1646.7900	R	G	1402	1415
PSM	RNFILDQTNVSAAAQR	506	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=6226	39.773	2	1802.9387	1802.9387	K	R	556	572
PSM	RYWEEETVPTTAGASPGPPR	507	sp|O15213|WDR46_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=5862	37.566	2	2200.0549	2200.0549	R	N	27	47
PSM	SHYADVDPENQNFLLESNLGKK	508	sp|Q96QD8|S38A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=7349	46.597	2	2517.2136	2517.2136	K	K	39	61
PSM	SIEIPRPVDGVEVPGCGK	509	sp|P26368-2|U2AF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	16-UNIMOD:4	ms_run[2]:scan=7359	46.656	2	1907.9775	1907.9775	K	I	410	428
PSM	SKLTFSCLGGSDNFK	510	sp|Q15185-4|TEBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:188,7-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=6852	43.548	2	1671.8329	1671.8329	K	H	34	49
PSM	SLCIPFKPLCELQPGAK	511	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=9949	63.158	2	1957.0165	1957.0165	K	C	1478	1495
PSM	SMQNWHQLENLSNFIK	512	sp|Q99439-2|CNN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	16-UNIMOD:188	ms_run[2]:scan=10780	68.785	2	1993.9776	1993.9776	R	A	78	94
PSM	SNHYDPEEDEEYYRK	513	sp|Q07157-2|ZO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=3605	24.067	2	1972.8075	1972.8075	R	Q	1263	1278
PSM	SPSDEYKDNLHQVSK	514	sp|Q9UKD2|MRT4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=2521	17.464	2	1745.822	1745.8220	R	R	80	95
PSM	SYIYSGSHDGHINYWDSETGENDSFAGK	515	sp|O75083|WDR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=7161	45.445	3	3135.3119	3135.3119	K	G	335	363
PSM	SYIYSGSHDGHINYWDSETGENDSFAGK	516	sp|O75083|WDR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=7169	45.495	2	3135.3119	3135.3119	K	G	335	363
PSM	TEKQLEAIDQLHLEYAK	517	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=7384	46.813	3	2040.093	2040.0930	K	R	519	536
PSM	THLTEDTPKVNADIEK	518	sp|Q15738|NSDHL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	9-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=4007	26.463	2	1821.9511	1821.9511	R	V	16	32
PSM	TKPSDEEMLFIYGHYK	519	sp|P07108|ACBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	8-UNIMOD:35	ms_run[2]:scan=6668	42.434	2	1972.9241	1972.9241	K	Q	18	34
PSM	TKPSDEEMLFIYGHYK	520	sp|P07108|ACBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:188,8-UNIMOD:35,16-UNIMOD:188	ms_run[2]:scan=6667	42.428	2	1984.9643	1984.9643	K	Q	18	34
PSM	TKPSDEEMLFIYGHYK	521	sp|P07108|ACBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=7735	48.961	2	1968.9694	1968.9694	K	Q	18	34
PSM	TLSCLDHVISYYHVASDTEK	522	sp|Q9UPT5-4|EXOC7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	4-UNIMOD:4,20-UNIMOD:188	ms_run[2]:scan=8574	54.319	2	2343.1148	2343.1148	K	I	80	100
PSM	VAEEHAPSIVFIDEIDAIGTKR	523	sp|P62191-2|PRS4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=10980	70.126	3	2409.254	2409.2540	R	Y	200	222
PSM	VDVYTTHSPAGTSVQNMLHWSQAVK	524	sp|P38571-2|LICH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=9152	57.954	3	2755.3388	2755.3388	R	F	221	246
PSM	VGLQVVAVKAPGFGDNR	525	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=7486	47.411	2	1725.9526	1725.9526	K	K	293	310
PSM	VHSPSGALEECYVTEIDQDKYAVR	526	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	11-UNIMOD:4	ms_run[2]:scan=7805	49.403	2	2765.2967	2765.2967	K	F	2360	2384
PSM	VLADPSDDTKGFFDPNTHENLTYR	527	sp|Q15149|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=7950	50.341	3	2751.2776	2751.2776	R	Q	3638	3662
PSM	VLQHYQESDKGEELGPGNVQK	528	sp|Q9Y6C9|MTCH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	10-UNIMOD:188,21-UNIMOD:188	ms_run[2]:scan=3637	24.268	3	2366.1905	2366.1905	K	E	91	112
PSM	VRELLEQISAFDNVPR	529	sp|Q9NX58|LYAR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=9878	62.703	2	1905.0223	1905.0223	K	K	94	110
PSM	VVGFHVLGPNAGEVTQGFAAALK	530	sp|Q16881-5|TRXR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	23-UNIMOD:188	ms_run[2]:scan=11001	70.267	3	2287.242	2287.2420	R	C	435	458
PSM	WGTDEEKFITIFGTR	531	sp|P08758|ANXA5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=10797	68.898	3	1798.889	1798.8890	K	S	187	202
PSM	YFHVVIAGPQDSPFEGGTFK	532	sp|P61088|UBE2N_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=9787	62.108	3	2195.0688	2195.0688	R	L	34	54
PSM	YGGQPLFSEKFPTLWSGAR	533	sp|Q1KMD3|HNRL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=11036	70.501	2	2140.0742	2140.0742	R	S	264	283
PSM	YHALLIPSCPGALTDLASSGSLAR	534	sp|Q8NB37|GALD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	9-UNIMOD:4	ms_run[2]:scan=10677	68.028	3	2469.2686	2469.2686	R	I	86	110
PSM	YLTEHPDPNNENIVGYNNKK	535	sp|Q6P2Q9|PRP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=4544	29.651	3	2358.124	2358.1240	R	C	1113	1133
PSM	GPGNPVPGPLAPLPDYMSEEKLQEK	536	sp|Q6P2Q9|PRP8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=9275	58.72062	3	2663.339139	2662.331254	R	A	9	34
PSM	KEAESCDCLQGFQLTHSLGGGTGSGMGTLLISK	537	sp|P04350|TBB4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	6-UNIMOD:4,8-UNIMOD:4,26-UNIMOD:35	ms_run[1]:scan=8876	56.229483333333334	3	3454.620492	3454.616691	R	I	122	155
PSM	KEAESCDCLQGFQLTHSLGGGTGSGMGTLLISK	538	sp|P04350|TBB4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	1-UNIMOD:188,6-UNIMOD:4,8-UNIMOD:4,26-UNIMOD:35,33-UNIMOD:188	ms_run[1]:scan=8875	56.22329166666666	3	3466.661035	3466.656949	R	I	122	155
PSM	AVEEKIEWLESHQDADIEDFK	539	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	5-UNIMOD:188,21-UNIMOD:188	ms_run[1]:scan=8849	56.05716166666667	3	2542.231468	2542.226622	K	A	597	618
PSM	FITHAPPGEFNEVFNDVR	540	sp|P52907|CAZA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=9089	57.55847833333333	2	2089.010013	2088.006489	K	L	20	38
PSM	NFRPGTENTPMIAGLGK	541	sp|Q96I15|SCLY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	3-UNIMOD:267,17-UNIMOD:188	ms_run[1]:scan=6702	42.63699833333333	2	1818.946352	1817.942901	R	A	291	308
PSM	CTKEEAIEHNYGGHDDDLSVR	542	sp|Q93009|UBP7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=5197	33.55903833333333	3	2427.0381	2427.0392	R	H	488	509
PSM	NKNPAPPIDAVEQILPTLVR	543	sp|P52292|IMA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=12450	80.39761999999999	3	2184.220910	2184.226653	R	L	239	259
PSM	AVEQHNGKTIFAYFTGSK	544	sp|Q9BRA2|TXD17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=9287	58.79852833333333	2	1997.987969	1997.000676	R	D	18	36
PSM	ACVEAPKGNPICSLHDQGAGGNGNVLK	545	sp|O15067|PUR4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=5910	37.854	3	2762.3228	2762.3228	R	E	501	528
PSM	AGGPGLERGEAGVPAEFSIWTR	546	sp|O75369-2|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	8-UNIMOD:267,22-UNIMOD:267	ms_run[2]:scan=9735	61.781	2	2276.1453	2276.1453	R	E	2174	2196
PSM	AKIGLIQFCLSAPK	547	sp|P50991-2|TCPD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:188,9-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=9372	59.33	2	1556.9151	1556.9151	K	T	214	228
PSM	AKLNWLSVDFNNWK	548	sp|Q15185-4|TEBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=11247	71.906	2	1745.9292	1745.9292	R	D	94	108
PSM	ASITPGTILIILTGR	549	sp|Q02878|RL6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	15-UNIMOD:267	ms_run[2]:scan=13544	91.608	2	1534.9322	1534.9322	R	H	142	157
PSM	ATLGPTPTTPPQPPDPSQPPPGPMQH	550	sp|O60927|PP1RB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=6546	41.689	2	2642.2799	2642.2799	R	-	101	127
PSM	ATSLGRPEEEEDELAHR	551	sp|P36551-2|HEM6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:267,17-UNIMOD:267	ms_run[2]:scan=4238	27.825	2	1957.9244	1957.9244	R	C	110	127
PSM	AVHSNPGDPALWSLLSR	552	sp|Q6PGP7|TTC37_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=10133	64.356	2	1818.9377	1818.9377	K	V	1185	1202
PSM	AVQADGQVKECYQSHR	553	sp|Q8WUM4|PDC6I_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	11-UNIMOD:4	ms_run[2]:scan=1761	13.134	2	1874.8693	1874.8693	K	D	502	518
PSM	DLEEDHACIPIKK	554	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	8-UNIMOD:4	ms_run[2]:scan=4183	27.503	2	1566.7712	1566.7712	K	S	560	573
PSM	DLVLGPSGVLQGIRPGK	555	sp|Q49A26-5|GLYR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9273	58.709	2	1704.9887	1704.9887	K	C	258	275
PSM	DNHLLGTFDLTGIPPAPR	556	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	18-UNIMOD:267	ms_run[2]:scan=10604	67.556	2	1943.014	1943.0140	K	G	475	493
PSM	EGDYVLFHHEGGVDVGDVDAK	557	sp|P53396|ACLY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	21-UNIMOD:188	ms_run[2]:scan=7015	44.523	2	2263.0489	2263.0489	R	A	128	149
PSM	EGYAWAEDKEHCEEYGR	558	sp|Q9Y3I0|RTCB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:4	ms_run[2]:scan=4478	29.271	2	2127.8592	2127.8592	R	M	182	199
PSM	EHALLAYTLGVK	559	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7429	47.083	2	1313.7343	1313.7343	R	Q	135	147
PSM	EMEPLGWIHTQPNESPQLSPQDVTTHAK	560	sp|Q6P2Q9|PRP8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=8859	56.119	3	3169.5139	3169.5139	K	I	2171	2199
PSM	EVATRPLTQDLLSHEDCYILDQGGLK	561	sp|P09327-2|VILI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	17-UNIMOD:4	ms_run[2]:scan=9810	62.258	3	2970.4757	2970.4757	R	I	269	295
PSM	EVGGQGAGNTGGLEPVHPASLPDSSLATSAPLCCTLCHER	562	sp|Q7Z5L9-3|I2BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	33-UNIMOD:4,34-UNIMOD:4,37-UNIMOD:4	ms_run[2]:scan=8596	54.456	3	4101.8943	4101.8943	R	L	49	89
PSM	EVVAGSHELGQDYEHVTMLQER	563	sp|Q01082-3|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	22-UNIMOD:267	ms_run[2]:scan=6918	43.957	3	2536.1892	2536.1892	R	F	1705	1727
PSM	FHQFLVSETESGNISR	564	sp|Q08J23-2|NSUN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=6370	40.626	3	1849.8959	1849.8959	K	Q	110	126
PSM	FSMPGFKGEGPEVDMNLPK	565	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=9424	59.642	2	2091.0208	2091.0208	K	A	1518	1537
PSM	GHAVNLLDVPVPVAR	566	sp|O00429-9|DNM1L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	15-UNIMOD:267	ms_run[2]:scan=8541	54.11	2	1565.8917	1565.8917	K	K	596	611
PSM	GHYTEGAELVDSVLDVVR	567	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=12140	78.069	2	1957.9745	1957.9745	K	K	104	122
PSM	GITLHPELFSIDNGLLTPTMK	568	sp|P33121-2|ACSL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	21-UNIMOD:188	ms_run[2]:scan=11944	76.684	2	2302.2338	2302.2338	K	A	645	666
PSM	GYFEYIEENKYSR	569	sp|Q00839-2|HNRPU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7189	45.616	2	1696.7733	1696.7733	R	A	237	250
PSM	HFSTEDGIFQGQR	570	sp|Q6RFH5-2|WDR74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:267	ms_run[2]:scan=5343	34.43	2	1530.7091	1530.7091	K	H	69	82
PSM	HGFCGIPITDTGR	571	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	4-UNIMOD:4	ms_run[2]:scan=5960	38.157	2	1429.6772	1429.6772	R	M	137	150
PSM	HLLSQPLFTESQK	572	sp|Q9GZR7-2|DDX24_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:188	ms_run[2]:scan=6418	40.906	2	1532.8294	1532.8294	R	T	739	752
PSM	HSSVYPTQEELEAVQNMVSHTER	573	sp|Q12906-5|ILF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	23-UNIMOD:267	ms_run[2]:scan=9977	63.342	3	2680.2427	2680.2427	K	A	18	41
PSM	HVIPMNPNTDDLFK	574	sp|P13797-3|PLST_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7409	46.961	2	1639.8028	1639.8028	R	A	100	114
PSM	HVIPMNPNTDDLFK	575	sp|P13797-3|PLST_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	14-UNIMOD:188	ms_run[2]:scan=7413	46.986	2	1645.823	1645.8230	R	A	100	114
PSM	IIHEDGYSEDECKQYK	576	sp|P08754|GNAI3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:4,13-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=2745	18.763	2	2024.9188	2024.9188	K	V	55	71
PSM	IIKDGEQHEDLNEVAK	577	sp|O95831-5|AIFM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=2883	19.669	2	1848.962	1848.9620	K	L	239	255
PSM	IPIGFIPLGETSSLSHTLFAESGNK	578	sp|Q53H12|AGK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=12529	81.092	3	2614.3643	2614.3643	K	V	147	172
PSM	KCLSTHACACPLTDAECVECER	579	sp|Q9Y3S2|ZN330_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:4,8-UNIMOD:4,10-UNIMOD:4,17-UNIMOD:4,20-UNIMOD:4	ms_run[2]:scan=5162	33.347	3	2666.1015	2666.1015	R	G	113	135
PSM	KEYEQELSDDLHVER	580	sp|Q7Z7F7|RM55_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=5987	38.308	3	1888.8803	1888.8803	R	Y	104	119
PSM	KFDFDACNEVPPAPK	581	sp|Q15424-2|SAFB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:4	ms_run[2]:scan=6254	39.937	2	1733.8083	1733.8083	R	E	287	302
PSM	KIEFSLPDLEGR	582	sp|P35998-2|PRS7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9142	57.893	2	1402.7456	1402.7456	R	T	203	215
PSM	KIVFVPGCSIPLTIVK	583	sp|P54136-2|SYRC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	8-UNIMOD:4	ms_run[2]:scan=10058	63.859	2	1770.0477	1770.0477	R	S	290	306
PSM	KLPVGFTFSFPCQQSK	584	sp|P19367-4|HXK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:188,12-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=9552	60.467	2	1881.985	1881.9850	K	I	135	151
PSM	KPGMFFNPEESELDLTYGNR	585	sp|P11413|G6PD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9700	61.532	2	2343.0841	2343.0841	K	Y	408	428
PSM	KTQTVCNFTDGALVQHQEWDGK	586	sp|Q01469|FABP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:4	ms_run[2]:scan=6733	42.829	2	2561.1969	2561.1969	R	E	82	104
PSM	KVAEPELMGTPDGTCYPPPPVPR	587	sp|P27708|PYR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	15-UNIMOD:4	ms_run[2]:scan=7361	46.669	2	2507.2189	2507.2189	R	Q	1875	1898
PSM	KVLIIGGGDGGVLR	588	sp|P19623|SPEE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=6514	41.493	2	1352.814	1352.8140	R	E	96	110
PSM	LAGATLLIFANKQDLPGALSSNAIR	589	sp|P36404|ARL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=11617	74.419	3	2553.4279	2553.4279	R	E	115	140
PSM	LEEQAAQHKADIEER	590	sp|Q15149|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=1809	13.401	2	1765.8595	1765.8595	R	L	2017	2032
PSM	LFDHPESPTPNPTEPLFLAQAEVYK	591	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	25-UNIMOD:188	ms_run[2]:scan=10964	70.023	3	2845.427	2845.4270	R	E	968	993
PSM	LHPVILASIVDSYER	592	sp|O00303|EIF3F_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	15-UNIMOD:267	ms_run[2]:scan=10278	65.381	2	1720.9387	1720.9387	R	R	94	109
PSM	LIALLEVLSQKK	593	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	11-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=11279	72.12	2	1365.8998	1365.8998	R	M	77	89
PSM	LIQESDQHLKDVEK	594	sp|O14776-2|TCRG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=3133	21.169	2	1680.8683	1680.8683	K	I	1015	1029
PSM	LQVTNVLSQPLTQATVKLEHAK	595	sp|P04844-2|RPN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9659	61.24	2	2417.3642	2417.3642	R	S	258	280
PSM	MFNGEKINYTEGR	596	sp|P06744-2|G6PI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:35	ms_run[2]:scan=3993	26.375	2	1573.7195	1573.7195	R	A	123	136
PSM	NFEATLGWLQEHACSR	597	sp|Q9P2J5|SYLC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	14-UNIMOD:4	ms_run[2]:scan=10334	65.754	2	1917.8792	1917.8792	R	T	560	576
PSM	NPPGFAFVEFEDPRDAADAVR	598	sp|P84103-2|SRSF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	14-UNIMOD:267,21-UNIMOD:267	ms_run[2]:scan=10579	67.391	2	2339.1085	2339.1085	R	E	44	65
PSM	PGHLQEGFGCVVTNR	599	sp|Q8NC51-4|PAIRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	10-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=5311	34.248	3	1679.8077	1679.8077	M	F	2	17
PSM	QCPLKVSYGIGDEEHDQEGR	600	sp|P27695|APEX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:4	ms_run[2]:scan=5010	32.395	3	2316.0441	2316.0441	R	V	137	157
PSM	RFSFCCSPEPEAEAEAAAGPGPCER	601	sp|Q13501|SQSTM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:267,5-UNIMOD:4,6-UNIMOD:4,23-UNIMOD:4,25-UNIMOD:267	ms_run[2]:scan=6927	44.014	3	2801.1747	2801.1747	R	L	22	47
PSM	RIGIFGQDEDVTSK	602	sp|P16615-5|AT2A2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=6039	38.628	2	1563.7893	1563.7893	R	A	637	651
PSM	RQELDAFLAQALSPK	603	sp|Q9NZB2-4|F120A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=10628	67.71	2	1685.9101	1685.9101	R	L	733	748
PSM	RTIQFVDWCPTGFK	604	sp|Q71U36-2|TBA1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	9-UNIMOD:4	ms_run[2]:scan=9315	58.976	2	1753.861	1753.8610	K	V	304	318
PSM	SGNLTEDDKHNNAK	605	sp|P13797-3|PLST_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=550	6.2403	2	1541.707	1541.7070	K	Y	529	543
PSM	SKLTFSCLGGSDNFK	606	sp|Q15185-4|TEBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:4	ms_run[2]:scan=6855	43.564	2	1659.7927	1659.7927	K	H	34	49
PSM	SKVEETTEHLVTK	607	sp|P52732|KIF11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=2893	19.731	2	1511.8234	1511.8234	R	S	1033	1046
PSM	SLGELGLEHFQAPLVR	608	sp|Q9NZT2-2|OGFR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	16-UNIMOD:267	ms_run[2]:scan=9584	60.677	2	1774.9605	1774.9605	K	F	219	235
PSM	SYIYSGSHDGHINYWDSETGENDSFAGK	609	sp|O75083|WDR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	28-UNIMOD:188	ms_run[2]:scan=7182	45.573	2	3141.332	3141.3320	K	G	335	363
PSM	TKDGQILPVPNVVVR	610	sp|Q9P258|RCC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7477	47.356	2	1633.9515	1633.9515	K	D	319	334
PSM	TKENDAHLVEVNLNNIK	611	sp|Q9NYL9|TMOD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=6323	40.346	3	1962.0573	1962.0573	R	N	193	210
PSM	TNVLGHLQQGGAPTPFDR	612	sp|P17858|PFKAL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7178	45.551	3	1906.965	1906.9650	R	N	655	673
PSM	TQIAICPNNHEVHIYEK	613	sp|O15143|ARC1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:4	ms_run[2]:scan=5565	35.773	2	2065.0051	2065.0051	R	S	21	38
PSM	TVGFGTNNSEHITYLEHNPYEK	614	sp|Q99459|CDC5L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=6769	43.048	2	2549.1823	2549.1823	K	F	602	624
PSM	VAAGLPPILVHTDAAQALGK	615	sp|Q96I15-2|SCLY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9126	57.795	2	1941.1047	1941.1047	R	Q	221	241
PSM	VEDMAELTCLNEASVLHNLKER	616	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	9-UNIMOD:4	ms_run[2]:scan=9759	61.934	3	2570.2469	2570.2469	K	Y	83	105
PSM	VLEENQEHYHIVQK	617	sp|P57740-3|NU107_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	14-UNIMOD:188	ms_run[2]:scan=3061	20.743	2	1770.8996	1770.8996	R	F	353	367
PSM	VLHEAEGHIVTCETNTGEVYR	618	sp|P62318-2|SMD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:4	ms_run[2]:scan=4607	30.02	3	2413.1332	2413.1332	K	G	9	30
PSM	VLQHYQESDKGEELGPGNVQK	619	sp|Q9Y6C9|MTCH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=3628	24.213	3	2354.1503	2354.1503	K	E	91	112
PSM	VRPCVVYGGADIGQQIR	620	sp|O00571-2|DDX3X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	4-UNIMOD:4	ms_run[2]:scan=6235	39.826	3	1886.9785	1886.9785	R	D	279	296
PSM	YGEAGEGPGWGGAHPR	621	sp|P26640|SYVC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	16-UNIMOD:267	ms_run[2]:scan=3701	24.639	2	1606.7152	1606.7152	R	I	24	40
PSM	YHALLIPSCPGALTDLASSGSLAR	622	sp|Q8NB37|GALD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	9-UNIMOD:4,24-UNIMOD:267	ms_run[2]:scan=10684	68.075	2	2479.2769	2479.2769	R	I	86	110
PSM	HIYYITGETKDQVANSAFVER	623	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=6357	40.544731666666664	2	2441.188883	2440.202289	K	L	490	511
PSM	TRLAFLNVQAAEEALPR	624	sp|P43304|GPDM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	2-UNIMOD:267,17-UNIMOD:267	ms_run[1]:scan=10295	65.49265	2	1918.066311	1918.053934	R	I	556	573
PSM	VLEENQEHYHIVQK	625	sp|P57740|NU107_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=3062	20.749325	2	1764.882502	1764.879498	R	F	504	518
PSM	HVQTHFDQNVLNFD	626	sp|Q86VP1|TAXB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=7423	47.04522166666667	2	1712.791384	1712.790683	R	-	776	790
PSM	HQTLQGLAFPLQPEAQR	627	sp|Q6IBS0|TWF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=8368	53.029959999999996	2	1934.013821	1933.016995	K	A	172	189
PSM	AEHDSILAEKAEK	628	sp|P26639|SYTC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=1793	13.311	2	1439.7256	1439.7256	K	D	66	79
PSM	AKLDNLDEEWATEHACQVSR	629	sp|Q5SWX8-3|ODR4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	16-UNIMOD:4	ms_run[2]:scan=6282	40.104	3	2371.0863	2371.0863	K	M	62	82
PSM	AKLNWLSVDFNNWK	630	sp|Q15185-4|TEBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=11246	71.9	2	1733.8889	1733.8889	R	D	94	108
PSM	AKVDEFPLCGHMVSDEYEQLSSEALEAAR	631	sp|P27635|RL10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:4,12-UNIMOD:35	ms_run[2]:scan=10647	67.832	3	3296.4966	3296.4966	K	I	41	70
PSM	ASELGHSLNENVLKPAQEK	632	sp|Q8N6T3-4|ARFG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=5086	32.887	2	2075.105	2075.1050	K	V	127	146
PSM	DDKHGSYEDAVHSGALND	633	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:188	ms_run[2]:scan=3886	25.733	2	1934.8338	1934.8338	K	-	539	557
PSM	DHASIQMNVAEVDKVTGR	634	sp|P63220|RS21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:35	ms_run[2]:scan=5680	36.473	3	1984.9636	1984.9636	K	F	28	46
PSM	DSKCEYPAACNALETLLIHR	635	sp|P54886-2|P5CS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	4-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=10650	67.855	2	2360.1253	2360.1253	R	D	601	621
PSM	DYSHYYTTIQDLRDK	636	sp|P08727|K1C19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=7119	45.179	2	1916.8905	1916.8905	R	I	126	141
PSM	ELLLPNWQGSGSHGLTIAQR	637	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9455	59.838	2	2176.1389	2176.1389	R	D	9	29
PSM	ENQKHIYYITGETK	638	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=3272	22.035	2	1722.8577	1722.8577	K	D	486	500
PSM	EVSSSFDHVIKETTR	639	sp|Q9Y6C9|MTCH2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5448	35.065	2	1733.8584	1733.8584	K	E	112	127
PSM	FKGQILMPNIGYGSNK	640	sp|P62910|RL32_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=7554	47.853	2	1765.9185	1765.9185	R	K	49	65
PSM	FSHQGVQLIDFSPCER	641	sp|P55884|EIF3B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=8074	51.16	2	1928.9078	1928.9079	R	Y	371	387
PSM	FSMPGFKGEGPDVDVSLPK	642	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=9453	59.827	2	2018.0222	2018.0222	K	A	4788	4807
PSM	GADSLEDFLYHEGYACTSIHGDR	643	sp|O00571-2|DDX3X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	16-UNIMOD:4,23-UNIMOD:267	ms_run[2]:scan=9862	62.593	2	2622.132	2622.1320	K	S	437	460
PSM	GAEILEVLHSLPAVR	644	sp|Q15008-3|PSMD6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	15-UNIMOD:267	ms_run[2]:scan=11571	74.109	2	1612.9176	1612.9176	K	Q	204	219
PSM	GGKIGLFGGAGVGK	645	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5727	36.756	2	1216.6928	1216.6928	K	T	199	213
PSM	GGKIGLFGGAGVGK	646	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=5728	36.761	2	1228.7331	1228.7331	K	T	199	213
PSM	GGPNIITLADIVKDPVSR	647	sp|Q8NEV1|CSK23_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=11131	71.128	2	1864.0418	1864.0418	R	T	90	108
PSM	GHAVNLLDVPVPVAR	648	sp|O00429-9|DNM1L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8538	54.092	2	1555.8835	1555.8835	K	K	596	611
PSM	GHWDDVFLDSTQR	649	sp|Q9H6T3-3|RPAP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8064	51.097	2	1574.7114	1574.7114	K	Q	242	255
PSM	GKFLEMCNDLLAR	650	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:4	ms_run[2]:scan=8231	52.15	2	1565.7694	1565.7694	R	V	304	317
PSM	GVDEVTIVNILTNR	651	sp|P07355-2|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:267	ms_run[2]:scan=11686	74.897	2	1551.8496	1551.8496	K	S	68	82
PSM	HASPILPITEFSDIPR	652	sp|P42167|LAP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10092	64.075	2	1791.9519	1791.9519	K	R	304	320
PSM	HENVIGLLDVFTPAR	653	sp|Q16539-2|MK14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	15-UNIMOD:267	ms_run[2]:scan=11806	75.723	2	1689.9078	1689.9078	K	S	80	95
PSM	HESGASIKIDEPLEGSEDR	654	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=4945	31.999	3	2067.9709	2067.9709	R	I	391	410
PSM	HEVTICNYEASANPADHR	655	sp|Q9GZP4-2|PITH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	6-UNIMOD:4	ms_run[2]:scan=4336	28.424	3	2082.9178	2082.9178	R	V	181	199
PSM	HIMGQNVADYMR	656	sp|P46777|RL5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5843	37.452	2	1433.6544	1433.6544	K	Y	198	210
PSM	ICDQWDALGSLTHSR	657	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=8542	54.115	3	1767.8238	1767.8238	K	R	498	513
PSM	IFVGGIPHNCGETELR	658	sp|Q96EP5-2|DAZP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	10-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=6356	40.539	2	1807.8915	1807.8915	K	E	115	131
PSM	IISFLLPPDESLHSLQSR	659	sp|O15111|IKKA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10930	69.796	3	2051.1051	2051.1051	K	I	323	341
PSM	ISGASEKDIVHSGLAYTMER	660	sp|P00367-2|DHE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6974	44.284	3	2163.063	2163.0630	R	S	330	350
PSM	KGLTPSQIGVILR	661	sp|P62277|RS13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=7439	47.136	2	1380.8453	1380.8453	K	D	43	56
PSM	KIEPELDGSAQVTSHDASTNGLINFIK	662	sp|P06744-2|G6PI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9088	57.552	2	2883.4614	2883.4614	K	Q	535	562
PSM	KIWCFGPDGTGPNILTDITK	663	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	4-UNIMOD:4	ms_run[2]:scan=11374	72.745	2	2232.1249	2232.1249	R	G	648	668
PSM	KSDIYVCMISYAHNVAAQGK	664	sp|P31150|GDIA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:4	ms_run[2]:scan=9154	57.965	3	2254.0875	2254.0875	R	Y	329	349
PSM	KSLEGADLPNLLFYGPPGTGK	665	sp|P35249-2|RFC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10796	68.892	2	2173.1419	2173.1419	K	T	64	85
PSM	KYEDICPSTHNMDVPNIK	666	sp|P63241|IF5A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	6-UNIMOD:4,12-UNIMOD:35	ms_run[2]:scan=4604	30.005	2	2175.9929	2175.9929	K	R	68	86
PSM	KYEDICPSTHNMDVPNIK	667	sp|P63241|IF5A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	6-UNIMOD:4	ms_run[2]:scan=5806	37.225	3	2159.998	2159.9980	K	R	68	86
PSM	LAILGIHNEVSK	668	sp|P12814-2|ACTN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	12-UNIMOD:188	ms_run[2]:scan=6435	41.011	2	1298.7654	1298.7654	R	I	566	578
PSM	LELLPDPLLRPSPLLATGQPAGSEDLTK	669	sp|Q9Y618-5|NCOR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=12026	77.274	3	2940.6172	2940.6172	R	D	110	138
PSM	LGETYKDHENIVIAK	670	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=4354	28.534	2	1728.9046	1728.9046	K	M	410	425
PSM	LLVSMCQGNRDENQSINHQMAQEDAQR	671	sp|P20073-2|ANXA7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	6-UNIMOD:4,10-UNIMOD:267,27-UNIMOD:267	ms_run[2]:scan=5600	35.992	3	3191.4409	3191.4410	R	L	300	327
PSM	LQLEETDHQKNLLDEELQR	672	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=7213	45.771	3	2350.1765	2350.1765	R	L	2330	2349
PSM	LQMEAPHIIVGTPGR	673	sp|P60842-2|IF4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:35	ms_run[2]:scan=5269	33.999	2	1633.861	1633.8610	K	V	147	162
PSM	LVLDEDEETKEPLVQVHR	674	sp|P46100-2|ATRX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6260	39.977	3	2148.1063	2148.1063	K	N	1333	1351
PSM	MMITSQDVLHSWAVPTLGLK	675	sp|P00403|COX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:35,2-UNIMOD:35	ms_run[2]:scan=11045	70.561	3	2258.1439	2258.1439	R	T	152	172
PSM	MQHNLEQQIQAR	676	sp|Q13813-3|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:35,12-UNIMOD:267	ms_run[2]:scan=3100	20.961	2	1520.7393	1520.7393	R	N	2284	2296
PSM	MTIGHLIECLQGK	677	sp|P30876|RPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:4	ms_run[2]:scan=10452	66.56	2	1498.7636	1498.7636	R	V	976	989
PSM	NDTKEDVFVHQTAIK	678	sp|P16989-2|YBOX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=4254	27.929	3	1743.8792	1743.8792	R	K	110	125
PSM	NNGAGYFLEHLAFK	679	sp|P31930|QCR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:188	ms_run[2]:scan=10475	66.714	2	1585.7985	1585.7985	K	G	86	100
PSM	NNPAIVIIGNNGQIHYDHQNDGASQALASCQR	680	sp|P49257|LMAN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	30-UNIMOD:4,32-UNIMOD:267	ms_run[2]:scan=7153	45.394	3	3484.653	3484.6530	K	D	161	193
PSM	PSKGPLQSVQVFGR	681	sp|P62249|RS16_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6633	42.219	2	1498.8256	1498.8256	M	K	2	16
PSM	QMEKDETVSDCSPHIANIGR	682	sp|P47756-2|CAPZB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	11-UNIMOD:4	ms_run[2]:scan=4608	30.026	2	2286.0369	2286.0369	R	L	196	216
PSM	QVQHEESTEGEADHSGYAGELGFR	683	sp|Q92890-3|UFD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5518	35.494	3	2632.1426	2632.1426	R	A	203	227
PSM	QVQHEESTEGEADHSGYAGELGFR	684	sp|Q92890-3|UFD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5519	35.501	2	2632.1426	2632.1426	R	A	203	227
PSM	RFSFCCSPEPEAEAEAAAGPGPCER	685	sp|Q13501|SQSTM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:267,5-UNIMOD:4,6-UNIMOD:4,23-UNIMOD:4,25-UNIMOD:267	ms_run[2]:scan=6922	43.98	2	2801.1747	2801.1747	R	L	22	47
PSM	RGPCIIYNEDNGIIK	686	sp|P36578|RL4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	4-UNIMOD:4	ms_run[2]:scan=6425	40.95	2	1760.888	1760.8880	R	A	205	220
PSM	RGPFELEAFYSDPQGVPYPEAK	687	sp|Q92598-2|HS105_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10266	65.309	2	2496.1961	2496.1961	R	I	437	459
PSM	RIALTDNALIAR	688	sp|P18124|RL7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6324	40.351	2	1325.7779	1325.7779	K	S	166	178
PSM	RSPFLQVFNNSPDESSYYR	689	sp|Q15437|SC23B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8951	56.697	3	2305.0764	2305.0764	R	H	588	607
PSM	SISDAPAPAYHDPLYLEDQVSHR	690	sp|Q9H6H4|REEP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	23-UNIMOD:267	ms_run[2]:scan=7387	46.83	3	2590.2327	2590.2327	R	R	158	181
PSM	SIYGEKFEDENFILK	691	sp|P62937|PPIA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8679	54.977	2	1830.904	1830.9040	K	H	77	92
PSM	SKTEDHEEAGPLPTK	692	sp|Q9BXS4|TMM59_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=1309	10.385	2	1649.8299	1649.8299	R	V	301	316
PSM	SNHYDPEEDEEYYRK	693	sp|Q07157-2|ZO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=3604	24.06	3	1972.8075	1972.8075	R	Q	1263	1278
PSM	SPALQILLTNTKVPR	694	sp|Q03426|KIME_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9007	57.044	3	1649.9828	1649.9828	R	N	227	242
PSM	SPLLQLPHIEEDNLR	695	sp|Q9UGP8|SEC63_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	15-UNIMOD:267	ms_run[2]:scan=9224	58.395	2	1782.9504	1782.9504	K	R	382	397
PSM	TEKQLEAIDQLHLEYAK	696	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=7390	46.846	3	2028.0528	2028.0528	K	R	519	536
PSM	THLPGFVEQAEALK	697	sp|P30044-2|PRDX5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=7676	48.606	2	1538.8093	1538.8093	K	A	51	65
PSM	TKPSDEEMLFIYGHYK	698	sp|P07108|ACBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=7736	48.967	3	1968.9694	1968.9694	K	Q	18	34
PSM	TYILTCEHDVLRDDGIMYAK	699	sp|Q6PIU2-3|NCEH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	6-UNIMOD:4	ms_run[2]:scan=8383	53.118	3	2412.1454	2412.1454	K	R	207	227
PSM	VEDMAELTCLNEASVLHNLKER	700	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:4	ms_run[2]:scan=9762	61.95	2	2570.2469	2570.2469	K	Y	83	105
PSM	VEYSEEELKTHISK	701	sp|P12956-2|XRCC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=4321	28.334	2	1690.8414	1690.8414	K	G	516	530
PSM	VHAPGLNLSGVGGK	702	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:188	ms_run[2]:scan=5490	35.327	2	1310.7402	1310.7402	K	M	5324	5338
PSM	VIECDVVKDYAFVHMEK	703	sp|Q96PK6-2|RBM14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	4-UNIMOD:4,8-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=8031	50.888	3	2093.0364	2093.0364	R	E	105	122
PSM	VKELEEQLENETLHK	704	sp|A0MZ66-2|SHOT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5710	36.654	3	1837.9422	1837.9422	K	E	287	302
PSM	VLADPSDDTKGFFDPNTHENLTYLQLLER	705	sp|Q15149|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=11512	73.706	3	3347.631	3347.6310	R	C	2979	3008
PSM	VLKGNTAEGCVHETQEK	706	sp|Q9BQG0|MBB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	10-UNIMOD:4	ms_run[2]:scan=1219	9.9151	3	1898.9156	1898.9156	R	Q	933	950
PSM	VNEHLQVEGHSNVYAIGDCADVR	707	sp|Q9BRQ8-2|FSP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	19-UNIMOD:4	ms_run[2]:scan=5923	37.936	3	2581.1979	2581.1979	R	T	231	254
PSM	VNPLGGAVALGHPLGCTGAR	708	sp|P09110-2|THIK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	16-UNIMOD:4	ms_run[2]:scan=7497	47.477	2	1916.005	1916.0050	K	Q	273	293
PSM	VSHLLGINVTDFTR	709	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:267	ms_run[2]:scan=9140	57.883	2	1580.855	1580.8550	K	G	374	388
PSM	VYSPHVLNLTLIDLPGITK	710	sp|Q9UQ16-5|DYN3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=12199	78.468	2	2092.1932	2092.1932	R	V	124	143
PSM	YATTGKCELENCQPFVVETLHGK	711	sp|Q06203|PUR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=7170	45.501	3	2680.2625	2680.2625	R	I	94	117
PSM	YGGQPLFSEKFPTLWSGAR	712	sp|Q1KMD3|HNRL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=11033	70.478	3	2140.0742	2140.0742	R	S	264	283
PSM	YNEQHVPGSPFTAR	713	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:267	ms_run[2]:scan=4723	30.691	2	1611.7669	1611.7669	K	V	1930	1944
PSM	HIYYITGETKDQVANSAFVER	714	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=6338	40.42660333333333	3	2441.187327	2440.202289	K	L	490	511
PSM	KLFIGGLSFETTEESLR	715	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	1-UNIMOD:188,17-UNIMOD:267	ms_run[1]:scan=10300	65.52748333333334	2	1942.040468	1942.038242	R	N	22	39
PSM	HTGPGILSMANAGPNTNGSQFFICTAK	716	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	24-UNIMOD:4	ms_run[1]:scan=10004	63.515658333333334	2	2791.306156	2790.321769	K	T	92	119
PSM	NGQTREHALLAYTLGVK	717	sp|P68104|EF1A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=8054	51.03586833333333	2	1870.991409	1870.006095	K	Q	130	147
PSM	LYKEELEQTYHAK	718	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	3-UNIMOD:188,13-UNIMOD:188	ms_run[1]:scan=3790	25.17613	2	1662.876210	1662.865595	R	L	259	272
PSM	QDNCVHDLQAHNKEIYTIK	719	sp|Q9BZK7|TBL1R_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:28,4-UNIMOD:4,13-UNIMOD:188,19-UNIMOD:188	ms_run[1]:scan=5712	36.664228333333334	2	2320.1378	2320.1304	K	W	380	399
PSM	CGESGHLAKDCDLQEDACYNCGR	720	sp|P62633|CNBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:385,1-UNIMOD:4,11-UNIMOD:4,18-UNIMOD:4,21-UNIMOD:4	ms_run[1]:scan=5088	32.89796333333334	3	2697.0302	2697.0307	R	G	57	80
PSM	CGESGHLAKDCDLQEDACYNCGR	721	sp|P62633|CNBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:385,1-UNIMOD:4,9-UNIMOD:188,11-UNIMOD:4,18-UNIMOD:4,21-UNIMOD:4,23-UNIMOD:267	ms_run[1]:scan=5099	32.96440166666667	3	2713.0576	2713.0591	R	G	57	80
PSM	YGKDATNVGDEGGFAPNILENNEALELLK	722	sp|P13929|ENOB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=10275	65.365445	3	3090.554386	3090.514575	K	T	200	229
PSM	VIECDVVKDYAFVHMEK	723	sp|Q96PK6|RBM14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	4-UNIMOD:4	ms_run[1]:scan=8024	50.84265333333333	3	2080.980779	2080.996184	R	E	105	122
PSM	KVGWIFTDLVSEDTR	724	sp|Q8TAT6|NPL4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=11237	71.84067666666667	2	1765.903046	1764.904650	R	K	307	322
PSM	GFAFVEFSHLQDATR	725	sp|P98175|RBM10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=9796	62.16424666666667	2	1723.832760	1723.831819	R	W	172	187
PSM	CLANLRPLLDSGTMGTK	726	sp|A0AVT1|UBA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:385,1-UNIMOD:4,6-UNIMOD:267,17-UNIMOD:188	ms_run[1]:scan=11801	75.687085	2	1844.9386	1844.9454	R	G	581	598
PSM	AAQASDLEKIHLDEK	727	sp|P37837|TALDO_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	9-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=4942	31.978	2	1678.8929	1678.8929	K	S	278	293
PSM	AFAAVPTSHPPEDAPAQPPTPGPAASPEQLSFR	728	sp|Q14160-2|SCRIB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	33-UNIMOD:267	ms_run[2]:scan=8027	50.859	3	3347.645	3347.6450	R	E	1242	1275
PSM	AFQYVETHGEVCPANWTPDSPTIKPSPAASK	729	sp|P30048-2|PRDX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:4	ms_run[2]:scan=7536	47.734	3	3384.6085	3384.6085	K	E	200	231
PSM	AIVDCGFEHPSEVQHECIPQAILGMDVLCQAK	730	sp|Q13838|DX39B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	5-UNIMOD:4,17-UNIMOD:4,29-UNIMOD:4	ms_run[2]:scan=11243	71.882	3	3650.699	3650.6990	R	S	59	91
PSM	AKYIYDSAFHPDTGEK	731	sp|Q9H9B4|SFXN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5047	32.64	2	1840.8632	1840.8632	R	M	71	87
PSM	ALDVIQAGKEYVEHTVK	732	sp|O75937|DNJC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=8955	56.725	3	1899.0102	1899.0102	R	E	119	136
PSM	ALECLPSKEHVDVIAK	733	sp|Q14690|RRP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:4,8-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=5171	33.405	2	1819.9905	1819.9905	R	F	1751	1767
PSM	ASLHALVGSPIIWGGEPR	734	sp|P49753-2|ACOT2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9445	59.774	2	1859.0054	1859.0054	R	A	252	270
PSM	DFDDEKILIQHQK	735	sp|O43670-3|ZN207_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=5535	35.599	2	1639.8608	1639.8608	R	A	19	32
PSM	DHVFLCEGEEPKSDLK	736	sp|Q9H910-2|JUPI2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:4	ms_run[2]:scan=4950	32.027	2	1901.8829	1901.8829	K	A	97	113
PSM	DHVFLCEGEEPKSDLK	737	sp|Q9H910-2|JUPI2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:4,12-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=4956	32.066	2	1913.9232	1913.9232	K	A	97	113
PSM	DIFNKGFGFGLVK	738	sp|P45880-2|VDAC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=10614	67.622	2	1440.7765	1440.7765	R	L	16	29
PSM	EGVKTENDHINLK	739	sp|P55854|SUMO3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=2248	15.902	2	1507.8033	1507.8033	K	V	8	21
PSM	EGVKTENNDHINLK	740	sp|P61956-2|SUMO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=2042	14.704	2	1621.8463	1621.8463	K	V	8	22
PSM	ERVEAVNMAEGIIHDTETK	741	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=8700	55.103	3	2141.0423	2141.0423	K	M	577	596
PSM	ERVEAVNMAEGIIHDTETK	742	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=8708	55.152	2	2141.0423	2141.0423	K	M	577	596
PSM	FLSQPFQVAEVFTGHMGK	743	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	16-UNIMOD:35,18-UNIMOD:188	ms_run[2]:scan=10814	69.006	2	2044.0184	2044.0184	R	L	463	481
PSM	FLSQPFQVAEVFTGHMGK	744	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=11815	75.783	2	2022.0033	2022.0033	R	L	463	481
PSM	FSMPGFKGEGPDVDVNLPK	745	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	7-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=9234	58.463	2	2045.0331	2045.0331	K	A	3030	3049
PSM	GAEHITTYTFNTHK	746	sp|Q7Z7K6-2|CENPV_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=3945	26.094	2	1618.774	1618.7740	K	A	40	54
PSM	GFAFVEFSHLQDATR	747	sp|P98175-4|RBM10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9833	62.407	2	1723.8318	1723.8318	R	W	95	110
PSM	GFAFVEFSHLQDATR	748	sp|P98175-4|RBM10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	15-UNIMOD:267	ms_run[2]:scan=9834	62.413	2	1733.8401	1733.8401	R	W	95	110
PSM	GFKLNIWDVGGQK	749	sp|P36404|ARL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=9192	58.198	2	1472.8179	1472.8179	R	S	59	72
PSM	GHNQPCLLVGSGR	750	sp|P27708|PYR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=3811	25.303	2	1403.6967	1403.6967	R	C	275	288
PSM	GHTEESMTNDKTAK	751	sp|P46013-2|KI67_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	11-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=627	6.6749	2	1559.7288	1559.7288	R	V	1239	1253
PSM	GHWDDVFLDSTQR	752	sp|Q9H6T3-3|RPAP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:267	ms_run[2]:scan=8049	51.003	2	1584.7196	1584.7196	K	Q	242	255
PSM	GLKAPPAPLAASEVTNSNSAER	753	sp|Q9Y2U8|MAN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5623	36.133	3	2179.1233	2179.1233	R	R	169	191
PSM	GPVREGDVLTLLESER	754	sp|P62857|RS28_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=9559	60.513	2	1788.9485	1788.9485	K	E	48	64
PSM	GVDEVTIVNILTNR	755	sp|P07355-2|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=11688	74.909	2	1541.8413	1541.8413	K	S	68	82
PSM	GVNWAAFHPTMPLIVSGADDR	756	sp|P53621|COPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	21-UNIMOD:267	ms_run[2]:scan=11256	71.966	2	2263.1083	2263.1083	R	Q	207	228
PSM	HASPILPITEFSDIPR	757	sp|P42167|LAP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	16-UNIMOD:267	ms_run[2]:scan=10094	64.087	3	1801.9602	1801.9602	K	R	304	320
PSM	HEILDADGICSPGEKVENK	758	sp|Q9NW08-2|RPC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	10-UNIMOD:4	ms_run[2]:scan=5109	33.026	3	2110.0001	2110.0001	R	Q	748	767
PSM	HLGVCISVANNR	759	sp|O43390-3|HNRPR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	5-UNIMOD:4	ms_run[2]:scan=4597	29.962	2	1338.6827	1338.6827	K	L	198	210
PSM	HLIIENFIPLEEK	760	sp|O15066-2|KIF3B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:188	ms_run[2]:scan=11182	71.468	2	1599.8968	1599.8968	K	S	210	223
PSM	HNSSGSILFLGR	761	sp|P30740|ILEU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6958	44.194	2	1286.6731	1286.6731	R	F	364	376
PSM	HQQALEVVNNNEEKAK	762	sp|Q0VDG4-2|SCRN3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=2135	15.256	3	1861.9685	1861.9685	K	I	346	362
PSM	IVAERPGTNSTGPAPMAPPR	763	sp|Q13263-2|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	5-UNIMOD:267,20-UNIMOD:267	ms_run[2]:scan=4180	27.489	3	2038.0533	2038.0533	K	A	326	346
PSM	IWDPTPSHTPAGAATPGR	764	sp|O75533|SF3B1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=4842	31.401	3	1830.9013	1830.9013	K	G	253	271
PSM	IYQNIQDGSLDLNAAESGVQHKPSAPQGGR	765	sp|P61106|RAB14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6495	41.378	4	3149.549	3149.5490	K	L	172	202
PSM	KDDEENYLDLFSHK	766	sp|Q07666|KHDR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=8107	51.368	3	1751.8002	1751.8002	K	N	139	153
PSM	KLFIGGLSFETTDESLR	767	sp|P09651-3|ROA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9975	63.331	3	1911.9942	1911.9942	R	S	15	32
PSM	KYEDICPSTHNMDVPNIK	768	sp|P63241|IF5A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:4,12-UNIMOD:35	ms_run[2]:scan=4588	29.909	3	2175.9929	2175.9929	K	R	68	86
PSM	LAASIAPEIYGHEDVKK	769	sp|P33993|MCM7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	16-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=5594	35.955	2	1852.0133	1852.0133	K	A	336	353
PSM	LAGDKANYWWLR	770	sp|P31939|PUR9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=8532	54.053	2	1491.7623	1491.7623	R	H	457	469
PSM	LIAHAGSLLNLAK	771	sp|Q9Y2X3|NOP58_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:188	ms_run[2]:scan=7144	45.339	2	1325.8126	1325.8126	R	H	298	311
PSM	LLVSMCQGNRDENQSINHQMAQEDAQR	772	sp|P20073-2|ANXA7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:4	ms_run[2]:scan=5599	35.987	3	3171.4244	3171.4244	R	L	300	327
PSM	LQDLQGEKDALHSEK	773	sp|O60610-2|DIAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	8-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=3322	22.328	2	1721.8987	1721.8987	K	Q	504	519
PSM	LQMEAPHIIVGTPGR	774	sp|P60842-2|IF4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	15-UNIMOD:267	ms_run[2]:scan=7038	44.67	2	1627.8744	1627.8744	K	V	147	162
PSM	LQVTNVLSQPLTQATVKLEHAK	775	sp|P04844-2|RPN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	17-UNIMOD:188,22-UNIMOD:188	ms_run[2]:scan=9599	60.781	3	2429.4045	2429.4045	R	S	258	280
PSM	LTQIQESQVTSHNKER	776	sp|Q92541|RTF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=2070	14.87	2	1896.9654	1896.9654	K	R	252	268
PSM	LYGPTNFSPIINHVAR	777	sp|O75131|CPNE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	16-UNIMOD:267	ms_run[2]:scan=8583	54.375	2	1807.9609	1807.9609	K	F	391	407
PSM	MIPCDFLIPVQTQHPIR	778	sp|P06744-2|G6PI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=10075	63.963	2	2074.0731	2074.0731	K	K	412	429
PSM	MQKEITALAPSTMK	779	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:35,3-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=4689	30.502	2	1575.8403	1575.8403	R	I	313	327
PSM	NGGLGHMNIALLSDLTK	780	sp|P30048-2|PRDX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	17-UNIMOD:188	ms_run[2]:scan=10822	69.06	2	1758.9394	1758.9394	K	Q	132	149
PSM	NIDNPALADIYTEHAHQVVVAK	781	sp|O75083|WDR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7462	47.262	2	2417.2339	2417.2339	R	Y	44	66
PSM	NIHESCMSQIGWNR	782	sp|P11413|G6PD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=5718	36.702	2	1740.77	1740.7700	K	I	153	167
PSM	NKPGPYSSVPPPSAPPPK	783	sp|Q14978|NOLC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=3403	22.831	2	1815.9519	1815.9519	K	K	284	302
PSM	NMVHPNVICDGCNGPVVGTR	784	sp|Q13501|SQSTM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	9-UNIMOD:4,12-UNIMOD:4,20-UNIMOD:267	ms_run[2]:scan=5758	36.928	3	2205.0117	2205.0117	R	Y	120	140
PSM	NNGAGYFLEHLAFK	785	sp|P31930|QCR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=10487	66.795	2	1579.7783	1579.7783	K	G	86	100
PSM	NPPGFAFVEFEDPRDAADAVR	786	sp|P84103-2|SRSF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=10578	67.385	2	2319.092	2319.0920	R	E	44	65
PSM	QHLEETTQKAESQLLECK	787	sp|P12270|TPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	17-UNIMOD:4	ms_run[2]:scan=5706	36.632	2	2171.0528	2171.0528	R	A	1111	1129
PSM	SRVGIQQGLLSQSTR	788	sp|Q9BY77-2|PDIP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5052	32.672	2	1628.8958	1628.8958	R	T	32	47
PSM	SSFDWLTGSSTDPLVDHTSPSSDSLLFAHK	789	sp|P78527-2|PRKDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	30-UNIMOD:188	ms_run[2]:scan=11451	73.272	3	3239.5354	3239.5354	R	R	2654	2684
PSM	TEELNREVAGHTEQLQMSR	790	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:267,17-UNIMOD:35,19-UNIMOD:267	ms_run[2]:scan=4272	28.039	3	2263.0766	2263.0766	R	S	275	294
PSM	TEELNREVAGHTEQLQMSR	791	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:267,19-UNIMOD:267	ms_run[2]:scan=4990	32.276	2	2247.0817	2247.0817	R	S	275	294
PSM	TEELNREVAGHTEQLQMSR	792	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:267,19-UNIMOD:267	ms_run[2]:scan=4999	32.332	3	2247.0817	2247.0817	R	S	275	294
PSM	TFVNITPAEVGVLVGKDR	793	sp|P07737|PROF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=10387	66.104	2	1914.0575	1914.0575	K	S	39	57
PSM	TKENDAHLVEVNLNNIK	794	sp|Q9NYL9|TMOD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6318	40.314	3	1950.0171	1950.0171	R	N	193	210
PSM	TLEEEAKTHEAQIQEMR	795	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5994	38.35	3	2041.9739	2041.9739	K	Q	1175	1192
PSM	TVDATGKEIELTHR	796	sp|O43395|PRPF3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=3437	23.041	2	1568.8158	1568.8158	R	M	264	278
PSM	VEYSEEELKTHISK	797	sp|P12956-2|XRCC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	9-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=4313	28.284	2	1702.8816	1702.8816	K	G	516	530
PSM	VREFSITDVVPYPISLR	798	sp|P34932|HSP74_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:267,17-UNIMOD:267	ms_run[2]:scan=11671	74.796	2	2010.1053	2010.1053	K	W	389	406
PSM	VRGLPWSCSADEVQR	799	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	8-UNIMOD:4	ms_run[2]:scan=6211	39.68	3	1758.8472	1758.8472	K	F	15	30
PSM	VRGLPWSCSADEVQR	800	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:267,8-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=6219	39.729	2	1778.8637	1778.8637	K	F	15	30
PSM	VRPCVVYGGADIGQQIR	801	sp|O00571-2|DDX3X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:267,4-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=6242	39.87	3	1906.995	1906.9950	R	D	279	296
PSM	YATTGKCELENCQPFVVETLHGK	802	sp|Q06203|PUR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	7-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=7175	45.53	2	2680.2625	2680.2625	R	I	94	117
PSM	YDCYKVPEWCLDDWHPSEK	803	sp|Q9Y6M9|NDUB9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=8953	56.709	2	2526.062	2526.0620	R	A	94	113
PSM	YGEAGEGPGWGGAHPR	804	sp|P26640|SYVC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=3667	24.444	3	1596.707	1596.7070	R	I	24	40
PSM	YHALLIPSCPGALTDLASSGSLAR	805	sp|Q8NB37|GALD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	9-UNIMOD:4	ms_run[2]:scan=10680	68.047	2	2469.2686	2469.2686	R	I	86	110
PSM	YQILPLHSQIPR	806	sp|Q08211|DHX9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:267	ms_run[2]:scan=7013	44.513	2	1473.8332	1473.8332	R	E	681	693
PSM	GGPEVQQVPAGERPLWFICSGMGTQWR	807	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	19-UNIMOD:4	ms_run[1]:scan=11860	76.10004333333333	3	3043.448844	3042.459266	R	G	478	505
PSM	IHFPLATYAPVISAEK	808	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=9303	58.897243333333336	2	1755.957413	1755.955957	R	A	265	281
PSM	QGGLGPMNIPLVSDPKR	809	sp|Q06830|PRDX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:28	ms_run[1]:scan=8395	53.19403166666667	2	1760.9238	1760.9238	K	T	94	111
PSM	QGGLGPMNIPLVSDPKR	810	sp|Q06830|PRDX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:28,16-UNIMOD:188,17-UNIMOD:267	ms_run[1]:scan=9871	62.65207666666667	2	1776.9531	1776.9522	K	T	94	111
PSM	AYVKDHYSNGFCTVYAK	811	sp|P52907|CAZA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	4-UNIMOD:188,12-UNIMOD:4,17-UNIMOD:188	ms_run[1]:scan=5164	33.358785	2	2035.957413	2033.970806	R	T	130	147
PSM	IVAERPGTNSTGPAPMAPPR	812	sp|Q13263|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	5-UNIMOD:267,20-UNIMOD:267	ms_run[1]:scan=4457	29.14323333333333	3	2039.038089	2038.053282	K	A	408	428
PSM	HVIPMNPNTNDLFNAVGDGIVLCK	813	sp|P13796|PLSL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	5-UNIMOD:35,23-UNIMOD:4	ms_run[1]:scan=10467	66.66047666666667	2	2653.302369	2653.299243	R	M	142	166
PSM	YHALLIPSCPGALTDLASSGSLAR	814	sp|Q8NB37|GALD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	9-UNIMOD:4	ms_run[1]:scan=10709	68.275145	3	2471.285830	2469.268595	R	I	86	110
PSM	KVPQVSTPTLVEVSR	815	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=6276	40.06762833333333	2	1638.929984	1638.930471	K	N	438	453
PSM	AGQVMCVAQGSGHTHSVGTVCCSR	816	sp|Q12788|TBL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	6-UNIMOD:4,21-UNIMOD:4,22-UNIMOD:4,24-UNIMOD:267	ms_run[2]:scan=3595	24.005	3	2555.1125	2555.1125	K	L	408	432
PSM	AIVDCGFEHPSEVQHECIPQAILGMDVLCQAK	817	sp|Q13838|DX39B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	5-UNIMOD:4,17-UNIMOD:4,25-UNIMOD:35,29-UNIMOD:4	ms_run[2]:scan=9890	62.778	3	3666.6939	3666.6939	R	S	59	91
PSM	ALCAEADRLQQSHPLSATQIQVK	818	sp|Q13813-3|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	3-UNIMOD:4	ms_run[2]:scan=6446	41.075	3	2563.3177	2563.3177	K	R	313	336
PSM	ALDVIQAGKEYVEHTVK	819	sp|O75937|DNJC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	9-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=8933	56.584	3	1911.0504	1911.0504	R	E	119	136
PSM	ALECLPSKEHVDVIAK	820	sp|Q14690|RRP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	4-UNIMOD:4	ms_run[2]:scan=5172	33.411	2	1807.9502	1807.9502	R	F	1751	1767
PSM	ALPGQLKPFETLLSQNQGGK	821	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10195	64.823	3	2125.1532	2125.1532	K	T	122	142
PSM	APHYPGIGPVDESGIPTAIR	822	sp|O94875-9|SRBS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8071	51.142	3	2046.0534	2046.0534	K	T	155	175
PSM	ASGNYATVISHNPETKK	823	sp|P62917|RL8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	16-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=3116	21.06	2	1827.9518	1827.9518	R	T	129	146
PSM	ATSLGRPEEEEDELAHR	824	sp|P36551-2|HEM6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	6-UNIMOD:267,17-UNIMOD:267	ms_run[2]:scan=4217	27.695	3	1957.9244	1957.9244	R	C	110	127
PSM	AYVKEHYPNGVCTVYGK	825	sp|P47755|CAZA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:4	ms_run[2]:scan=4283	28.105	2	1983.9513	1983.9513	R	K	130	147
PSM	CLCVDRLPPGFNDVDALCR	826	sp|Q8IY67-2|RAVR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:4,3-UNIMOD:4,18-UNIMOD:4	ms_run[2]:scan=9228	58.424	3	2276.05	2276.0500	R	A	222	241
PSM	DFDDEKILIQHQK	827	sp|O43670-3|ZN207_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5528	35.555	2	1627.8206	1627.8206	R	A	19	32
PSM	DIHDDQDYLHSLGK	828	sp|O75955-2|FLOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5856	37.527	2	1654.7587	1654.7587	K	A	105	119
PSM	DNHLLGTFDLTGIPPAPR	829	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	18-UNIMOD:267	ms_run[2]:scan=10903	69.611	2	1943.014	1943.0140	K	G	475	493
PSM	DVAPQAPVHFLVIPK	830	sp|Q9BX68|HINT2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9023	57.143	2	1629.9243	1629.9243	R	K	80	95
PSM	DVYKEHFQDDVFNEK	831	sp|P43490|NAMPT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6201	39.619	3	1911.8639	1911.8639	K	G	85	100
PSM	DYIQKHPELNISEEGITK	832	sp|P17480-2|UBF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6261	39.982	3	2113.0691	2113.0691	R	S	225	243
PSM	EHALLAYTLGVK	833	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:188	ms_run[2]:scan=7430	47.087	2	1319.7545	1319.7545	R	Q	135	147
PSM	EKDILVLPLDLTDTGSHEAATK	834	sp|Q9Y394-2|DHRS7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9581	60.66	3	2365.2377	2365.2377	K	A	52	74
PSM	ENTQTTIKLFQECCPHSTDR	835	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=5926	37.954	3	2464.1111	2464.1111	R	V	148	168
PSM	EVGGQGAGNTGGLEPVHPASLPDSSLATSAPLCCTLCHER	836	sp|Q7Z5L9-3|I2BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	33-UNIMOD:4,34-UNIMOD:4,37-UNIMOD:4,40-UNIMOD:267	ms_run[2]:scan=8610	54.541	3	4111.9025	4111.9025	R	L	49	89
PSM	FHQLDIDDLQSIR	837	sp|P16152|CBR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8501	53.864	2	1598.8053	1598.8053	R	A	59	72
PSM	FIESAHTELAKDDAAPAPPVADAK	838	sp|Q92667-2|AKAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5225	33.729	3	2463.2282	2463.2282	R	A	271	295
PSM	FRDTEGLIQEINDLR	839	sp|Q86W92-3|LIPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	2-UNIMOD:267,15-UNIMOD:267	ms_run[2]:scan=10296	65.499	2	1837.9437	1837.9437	K	L	44	59
PSM	FREALGDAQQSVR	840	sp|Q99615-2|DNJC7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	2-UNIMOD:267,13-UNIMOD:267	ms_run[2]:scan=3749	24.927	2	1495.7646	1495.7646	R	L	22	35
PSM	FSMPGFKAEGPEVDVNLPK	841	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	7-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=9441	59.75	2	2073.0644	2073.0644	K	A	885	904
PSM	FSMPGFKGEGPDVDVNLPK	842	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9276	58.727	2	2032.9928	2032.9928	K	A	3030	3049
PSM	FTPGTFTNQIQAAFREPR	843	sp|P08865|RSSA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10280	65.393	2	2080.049	2080.0490	R	L	103	121
PSM	GADSLEDFLYHEGYACTSIHGDR	844	sp|O00571-2|DDX3X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	16-UNIMOD:4	ms_run[2]:scan=9857	62.564	3	2612.1238	2612.1238	K	S	437	460
PSM	GKVAAQCSHAAVSAYK	845	sp|Q9Y3E5|PTH2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	7-UNIMOD:4	ms_run[2]:scan=1346	10.598	2	1646.8199	1646.8199	K	Q	80	96
PSM	GRTFDEIASGFR	846	sp|P11166|GTR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	2-UNIMOD:267,12-UNIMOD:267	ms_run[2]:scan=6963	44.226	2	1374.6795	1374.6795	K	Q	457	469
PSM	GTADVTHDLQEMKEESR	847	sp|P11166|GTR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5735	36.803	3	1944.8847	1944.8847	R	Q	233	250
PSM	GVGGKLPNFGFVVFDDSEPVQR	848	sp|Q9UN86-2|G3BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11296	72.232	3	2363.191	2363.1910	K	I	333	355
PSM	GVTIIGPATVGGIKPGCFK	849	sp|P53396|ACLY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	17-UNIMOD:4	ms_run[2]:scan=8460	53.605	2	1871.0339	1871.0339	K	I	617	636
PSM	HFSVEGQLEFR	850	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6866	43.631	2	1347.6571	1347.6571	K	A	328	339
PSM	HFVALSTNTTK	851	sp|P06744-2|G6PI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:188	ms_run[2]:scan=2988	20.306	2	1223.6606	1223.6606	K	V	253	264
PSM	HIEIFTDLSSR	852	sp|P13010|XRCC5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:267	ms_run[2]:scan=7186	45.601	2	1326.6807	1326.6807	R	F	131	142
PSM	HLAGLGLTEAIDK	853	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:188	ms_run[2]:scan=6687	42.543	2	1342.7552	1342.7552	K	N	320	333
PSM	HLEAAALLSER	854	sp|Q9UJA5-2|TRM6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6032	38.583	2	1208.6513	1208.6513	R	N	357	368
PSM	HLSVNDLPVGR	855	sp|P30048-2|PRDX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5361	34.532	2	1205.6517	1205.6517	K	S	179	190
PSM	HLSVNDLPVGR	856	sp|P30048-2|PRDX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:267	ms_run[2]:scan=5364	34.551	2	1215.6599	1215.6599	K	S	179	190
PSM	HPHDIIDDINSGAVECPAS	857	sp|P30050-2|RL12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	16-UNIMOD:4	ms_run[2]:scan=7159	45.434	3	2045.9113	2045.9113	R	-	114	133
PSM	HSSVYPTQEELEAVQNMVSHTER	858	sp|Q12906-5|ILF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10150	64.502	2	2670.2344	2670.2344	K	A	18	41
PSM	ICDQWDALGSLTHSR	859	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	2-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=8548	54.155	2	1767.8238	1767.8238	K	R	498	513
PSM	IDASKNEEDEGHSNSSPR	860	sp|Q14103-3|HNRPD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=684	6.9968	2	1970.8566	1970.8566	K	H	68	86
PSM	KGTVVYGEPITASLGTDGSHYWSK	861	sp|Q16555-2|DPYL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7962	50.415	2	2552.2547	2552.2547	K	N	234	258
PSM	KIWCFGPDGTGPNILTDITK	862	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:188,4-UNIMOD:4,20-UNIMOD:188	ms_run[2]:scan=11370	72.721	3	2244.1651	2244.1651	R	G	648	668
PSM	KLFIGGLSFETTDESLR	863	sp|P09651-3|ROA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:188,17-UNIMOD:267	ms_run[2]:scan=10002	63.504	2	1928.0226	1924.0345	R	S	15	32
PSM	KLGPEGELLIR	864	sp|Q15758-3|AAAT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6269	40.032	2	1223.7238	1223.7238	R	F	19	30
PSM	KQGGLGPMNIPLVSDPK	865	sp|Q06830|PRDX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=8215	52.047	2	1761.985	1761.9850	K	R	93	110
PSM	LAISEDHVASVKK	866	sp|Q9HC35-2|EMAL4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=2887	19.692	2	1407.8124	1407.8124	R	S	52	65
PSM	LCPPGIPTPGSGLPPPR	867	sp|P27708|PYR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	2-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=7511	47.562	2	1721.9162	1721.9162	R	K	378	395
PSM	LDGQTPHDERQDSINAYNEPNSTK	868	sp|O60264|SMCA5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=3317	22.298	3	2728.2325	2728.2325	R	F	529	553
PSM	LHNQVNGTEWSWK	869	sp|O14980|XPO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:188	ms_run[2]:scan=6079	38.866	2	1603.7839	1603.7839	K	N	480	493
PSM	LHNQVNGTEWSWK	870	sp|O14980|XPO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6098	38.978	2	1597.7637	1597.7637	K	N	480	493
PSM	LKVFDGIPPPYDK	871	sp|P40429|RL13A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	2-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=7354	46.625	2	1499.8427	1499.8427	R	K	102	115
PSM	LNWQKLPSNVAR	872	sp|Q27J81-2|INF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6220	39.735	2	1424.7888	1424.7888	K	E	567	579
PSM	LQDLQGEKDALHSEK	873	sp|O60610-2|DIAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=3329	22.372	2	1709.8584	1709.8584	K	Q	504	519
PSM	LQMEAPHIIVGTPGR	874	sp|P60842-2|IF4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7064	44.831	2	1617.8661	1617.8661	K	V	147	162
PSM	LRECELSPGVNR	875	sp|Q9BXP5-5|SRRT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	2-UNIMOD:267,4-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=3206	21.619	2	1448.7309	1448.7309	R	D	450	462
PSM	LTDISVTDPEKYPHMLSVK	876	sp|Q9Y333|LSM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7806	49.409	2	2172.1137	2172.1137	K	N	40	59
PSM	MDSTANEVEAVKVHSFPTLK	877	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7262	46.069	2	2202.0991	2202.0991	K	F	425	445
PSM	MFVGGLSWDTSKK	878	sp|Q99729-3|ROAA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:35,12-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=6671	42.449	2	1482.758	1482.7580	K	D	72	85
PSM	MGAGLGHGMDR	879	sp|P52272-2|HNRPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:35,11-UNIMOD:267	ms_run[2]:scan=1413	11.031	2	1126.4887	1126.4887	R	V	380	391
PSM	MLITILGTVKPNANR	880	sp|P17931|LEG3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8716	55.201	2	1639.9443	1639.9443	R	I	130	145
PSM	MRYVASYLLAALGGNSSPSAK	881	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	2-UNIMOD:267,21-UNIMOD:188	ms_run[2]:scan=11489	73.544	2	2171.138	2167.1498	-	D	1	22
PSM	NFAALEVLREEEFSPLK	882	sp|Q3KQV9|UAP1L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11354	72.616	3	1991.0364	1991.0364	K	N	394	411
PSM	NFRPGTENTPMIAGLGK	883	sp|Q96I15-2|SCLY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6699	42.614	2	1801.9145	1801.9145	R	V	291	308
PSM	NILAFRDQNILLGTTYR	884	sp|P78527-2|PRKDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10057	63.853	2	2007.0902	2007.0902	K	I	3319	3336
PSM	NKTEDLEATSEHFK	885	sp|Q9BV40|VAMP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	2-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=3730	24.814	2	1659.8143	1659.8143	R	T	46	60
PSM	NLDAVHDITVAYPHNIPQSEK	886	sp|Q6UWP7-3|LCLT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	21-UNIMOD:188	ms_run[2]:scan=7098	45.048	3	2366.1962	2366.1962	K	H	212	233
PSM	NLRDIDEVSSLLR	887	sp|P50990|TCPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	3-UNIMOD:267,13-UNIMOD:267	ms_run[2]:scan=9145	57.909	2	1548.8375	1548.8375	K	T	153	166
PSM	NTNAAEESLPEIQKEHR	888	sp|Q9NTJ3|SMC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=4056	26.758	2	1964.9552	1964.9552	K	N	975	992
PSM	NVHGINFVSPVR	889	sp|P53634|CATC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6265	40.004	2	1337.7204	1337.7204	R	N	239	251
PSM	NVSNLKPVPLIGPK	890	sp|Q8NBX0|SCPDL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6332	40.396	2	1474.8871	1474.8871	R	L	215	229
PSM	QLPFRGDDGIFDDNFIEER	891	sp|O60493-2|SNX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10618	67.645	2	2282.0604	2282.0604	R	K	68	87
PSM	RGGPNYQEGLR	892	sp|P53396|ACLY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=2086	14.968	2	1245.6214	1245.6214	R	V	379	390
PSM	RIDMVPELLSSNLCSLK	893	sp|Q9Y2L1-2|RRP44_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	14-UNIMOD:4	ms_run[2]:scan=11110	70.992	2	1974.0278	1974.0278	K	C	506	523
PSM	RMGESDDSILR	894	sp|P63220|RS21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:267,11-UNIMOD:267	ms_run[2]:scan=3710	24.693	2	1297.6199	1297.6199	R	L	61	72
PSM	SADGVIVSGVKDVDDFFEHER	895	sp|Q9UNH7-2|SNX6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=12023	77.255	3	2320.0972	2320.0972	K	T	78	99
PSM	SGNLTEDDKHNNAK	896	sp|P13797-3|PLST_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	9-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=551	6.2459	2	1553.7473	1553.7473	K	Y	529	543
PSM	SKVEETTEHLVTK	897	sp|P52732|KIF11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=2892	19.725	3	1499.7831	1499.7831	R	S	1033	1046
PSM	SKVEETTEHLVTK	898	sp|P52732|KIF11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=2900	19.776	2	1499.7831	1499.7831	R	S	1033	1046
PSM	TEELNREVAGHTEQLQMSR	899	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	17-UNIMOD:35	ms_run[2]:scan=4273	28.044	3	2243.0601	2243.0601	R	S	275	294
PSM	TKVVVTMEHSAK	900	sp|P55809-2|SCOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	2-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=1682	12.677	2	1340.7525	1340.7525	K	G	38	50
PSM	TQIAICPNNHEVHIYEK	901	sp|O15143|ARC1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	6-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=5568	35.791	2	2071.0252	2071.0252	R	S	21	38
PSM	TSYEEFTHKDGVWNLQNEVTK	902	sp|Q6P2Q9|PRP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	9-UNIMOD:188,21-UNIMOD:188	ms_run[2]:scan=7684	48.651	3	2536.2273	2536.2273	R	E	1202	1223
PSM	TTGIVMDSGDGVTHTVPIYEGYALPHAILR	903	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	30-UNIMOD:267	ms_run[2]:scan=10465	66.649	3	3192.6153	3192.6153	R	L	148	178
PSM	TVSLGAGAKDELHIVEAEAMNYEGSPIK	904	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10941	69.868	3	2928.4539	2928.4539	R	V	46	74
PSM	TYILTCEHDVLRDDGIMYAK	905	sp|Q6PIU2-3|NCEH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	6-UNIMOD:4,17-UNIMOD:35	ms_run[2]:scan=7561	47.9	2	2428.1403	2428.1403	K	R	207	227
PSM	VGNPWDPNVLYGPLHTK	906	sp|P49419-2|AL7A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9382	59.391	2	1905.9737	1905.9737	R	Q	331	348
PSM	VHLVGIDIFTGK	907	sp|P63241|IF5A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:188	ms_run[2]:scan=9413	59.581	2	1303.7596	1303.7596	K	K	56	68
PSM	VHLVGIDIFTGK	908	sp|P63241|IF5A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9415	59.589	2	1297.7394	1297.7394	K	K	56	68
PSM	VKDTFNGNLPFLFK	909	sp|P34949-2|MPI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	2-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=10511	66.947	2	1650.9172	1650.9172	K	V	86	100
PSM	VLLKEILEQGLFSK	910	sp|Q9BUP3-2|HTAI2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	4-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=11634	74.542	2	1627.9952	1627.9952	R	V	33	47
PSM	VPAPVTMDSFFFGCELSGHTR	911	sp|O75607|NPM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	14-UNIMOD:4,21-UNIMOD:267	ms_run[2]:scan=11788	75.601	3	2364.0906	2364.0906	R	S	28	49
PSM	YFHVVIAGPQDSPFEGGTFK	912	sp|P61088|UBE2N_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9816	62.294	2	2195.0688	2195.0688	R	L	34	54
PSM	YGEAGEGPGWGGAHPR	913	sp|P26640|SYVC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	16-UNIMOD:267	ms_run[2]:scan=3671	24.466	3	1606.7152	1606.7152	R	I	24	40
PSM	HGFCGIPITDTGR	914	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	4-UNIMOD:4,13-UNIMOD:267	ms_run[1]:scan=5952	38.107405	2	1439.684578	1439.685502	R	M	137	150
PSM	VVCDENGSKGYGFVHFETQEAAER	915	sp|P11940|PABP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:4	ms_run[1]:scan=7133	45.27048666666666	3	2729.202180	2728.218744	K	A	130	154
PSM	ERIPEAPAGPPSDFGLFLSDDDPK	916	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	2-UNIMOD:267,24-UNIMOD:188	ms_run[1]:scan=10497	66.85923333333334	3	2586.282007	2585.262047	R	K	34	58
PSM	MGPLGLDHMASSIER	917	sp|P52272|HNRPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=7831	49.57911	2	1612.767249	1612.770147	R	M	457	472
PSM	IVAERPGTNSTGPAPMAPPR	918	sp|Q13263|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=4466	29.197053333333333	3	2019.021295	2018.036744	K	A	408	428
PSM	KLFIGGLSFETTDESLR	919	sp|Q32P51|RA1L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0		ms_run[1]:scan=10137	64.38502333333332	2	1911.9889	1911.9937	R	S	15	32
PSM	ASVKEQDYLCHVYVR	920	sp|O15498|YKT6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	10-UNIMOD:4	ms_run[1]:scan=5649	36.28986833333334	2	1865.918162	1865.909418	R	N	57	72
PSM	YGKDATNVGDEGGFAPNILENNEALELLK	921	sp|P13929|ENOB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=10273	65.35572333333333	4	3090.554459	3090.514575	K	T	200	229
PSM	QHKPSIIFIDEVDSLCGSR	922	sp|Q9UN37|VPS4A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:28,16-UNIMOD:4	ms_run[1]:scan=10563	67.29166333333333	3	2183.0701	2183.0676	R	N	218	237
PSM	AVEQHNGKTIFAYFTGSK	923	sp|Q9BRA2|TXD17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	8-UNIMOD:188,18-UNIMOD:188	ms_run[1]:scan=9300	58.879	2	2010.026827	2009.040934	R	D	18	36
PSM	ARFEELCSDLFR	924	sp|P0DMV8|HS71A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	2-UNIMOD:267,7-UNIMOD:4,12-UNIMOD:267	ms_run[1]:scan=8697	55.08687	2	1561.748705	1561.746201	R	S	300	312
PSM	HLEIIYAINQR	925	sp|P11216|PYGB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=6978	44.305085	2	1369.760407	1368.751384	R	H	400	411
PSM	RFQGSTLPAEAANR	926	sp|Q96Q05|TPPC9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	1-UNIMOD:267,14-UNIMOD:267	ms_run[1]:scan=3463	23.20006	2	1536.791451	1536.791177	R	H	270	284
PSM	AATSDLEHYDKTR	927	sp|P80303-2|NUCB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=2415	16.869	2	1505.711	1505.7110	K	H	161	174
PSM	AEVEGKDLPEHAVLK	928	sp|Q00839-2|HNRPU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=4194	27.562	2	1633.8675	1633.8675	K	M	602	617
PSM	AFQYVETHGEVCPANWTPDSPTIKPSPAASK	929	sp|P30048-2|PRDX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:4,24-UNIMOD:188,31-UNIMOD:188	ms_run[2]:scan=7576	47.994	2	3396.6487	3396.6487	K	E	200	231
PSM	AGLGSGLSLSGLVHPELSR	930	sp|P49748-2|ACADV_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10033	63.703	3	1849.0058	1849.0058	R	S	491	510
PSM	AQHEDQVEQYKK	931	sp|P02545-5|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=864	7.9971	2	1501.7161	1501.7161	R	E	151	163
PSM	ARFEELCSDLFR	932	sp|P48741|HSP77_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	7-UNIMOD:4	ms_run[2]:scan=8699	55.098	2	1541.7297	1541.7297	R	S	302	314
PSM	CLCVDRLPPGFNDVDALCR	933	sp|Q8IY67-2|RAVR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:4,3-UNIMOD:4,6-UNIMOD:267,18-UNIMOD:4,19-UNIMOD:267	ms_run[2]:scan=9245	58.532	3	2296.0666	2296.0666	R	A	222	241
PSM	DGVVEITGKHEER	934	sp|P04792|HSPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=2263	15.992	2	1467.7318	1467.7318	K	Q	115	128
PSM	DIFNKGFGFGLVK	935	sp|P45880-2|VDAC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	5-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=10617	67.64	2	1452.8168	1452.8168	R	L	16	29
PSM	DIHDDQDYLHSLGK	936	sp|O75955-2|FLOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	14-UNIMOD:188	ms_run[2]:scan=5860	37.555	2	1660.7788	1660.7788	K	A	105	119
PSM	DLESLREYVESQLQR	937	sp|Q8NBS9-2|TXND5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	6-UNIMOD:267,15-UNIMOD:267	ms_run[2]:scan=11916	76.494	3	1883.9492	1883.9492	R	T	174	189
PSM	DNHLLGTFDLTGIPPAPR	938	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10303	65.546	3	1933.0058	1933.0058	K	G	475	493
PSM	DTGKTPVEPEVAIHR	939	sp|P60866|RS20_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=3828	25.402	2	1647.858	1647.8580	K	I	5	20
PSM	DVIVKVDQICHK	940	sp|Q9UBE0|SAE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	5-UNIMOD:188,10-UNIMOD:4,12-UNIMOD:188	ms_run[2]:scan=4612	30.052	2	1464.8161	1464.8161	R	N	137	149
PSM	EDAMAMVDHCLKK	941	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	10-UNIMOD:4,12-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=6099	38.984	2	1558.7345	1558.7345	R	A	543	556
PSM	EDAMAMVDHCLKK	942	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	10-UNIMOD:4	ms_run[2]:scan=6100	38.99	2	1546.6942	1546.6942	R	A	543	556
PSM	ENQKHIYYITGETK	943	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	4-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=3262	21.977	2	1734.898	1734.8980	K	D	486	500
PSM	ENTQTTIKLFQECCPHSTDR	944	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=5928	37.966	2	2464.1111	2464.1111	R	V	148	168
PSM	EVATRPLTQDLLSHEDCYILDQGGLK	945	sp|P09327-2|VILI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	17-UNIMOD:4	ms_run[2]:scan=9821	62.33	2	2970.4757	2970.4757	R	I	269	295
PSM	FDASFFGVHPK	946	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:188	ms_run[2]:scan=7898	50.013	2	1256.6285	1256.6285	R	Q	60	71
PSM	FGNQADHFLGSLAFAK	947	sp|Q9H488-2|OFUT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	16-UNIMOD:188	ms_run[2]:scan=9471	59.94	2	1727.8727	1727.8727	R	L	44	60
PSM	FHQLDIDDLQSIR	948	sp|P16152|CBR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:267	ms_run[2]:scan=8496	53.833	2	1608.8135	1608.8135	R	A	59	72
PSM	FHQLLDDESDPFDILR	949	sp|Q5JVS0-2|HABP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	16-UNIMOD:267	ms_run[2]:scan=11430	73.128	3	1968.9457	1968.9457	R	E	28	44
PSM	FIESAHTELAKDDAAPAPPVADAK	950	sp|Q92667-2|AKAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5227	33.741	2	2463.2282	2463.2282	R	A	271	295
PSM	FNFLNPNDPYHAYYR	951	sp|Q15459-2|SF3A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8851	56.069	2	1929.8798	1929.8798	K	H	81	96
PSM	FNFLNPNDPYHAYYR	952	sp|Q15459-2|SF3A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	15-UNIMOD:267	ms_run[2]:scan=8872	56.202	2	1939.8881	1939.8881	K	H	81	96
PSM	GFGGITHGPPEK	953	sp|P49748-2|ACADV_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=3281	22.09	2	1195.5986	1195.5986	R	K	265	277
PSM	GFQIYDGPIHLTR	954	sp|Q9UHN6-2|CEIP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8488	53.782	2	1515.7834	1515.7834	R	S	807	820
PSM	GHNGWVTQIATTPQFPDMILSASR	955	sp|P63244|RACK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11570	74.103	3	2626.2962	2626.2962	K	D	13	37
PSM	GHTDSVQDISFDHSGK	956	sp|P43034|LIS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=3906	25.857	3	1728.7703	1728.7703	K	L	148	164
PSM	GIPLATGDTSPEPELLPGAPLPPPKEVINGNIK	957	sp|O75821|EIF3G_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	25-UNIMOD:188,33-UNIMOD:188	ms_run[2]:scan=10418	66.328	3	3342.8478	3342.8478	K	T	33	66
PSM	GKFLEMCNDLLAR	958	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	7-UNIMOD:4	ms_run[2]:scan=8233	52.161	3	1565.7694	1565.7694	R	V	304	317
PSM	GLFGVPELSAPEGFHIAQEK	959	sp|Q99797|MIPEP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	20-UNIMOD:188	ms_run[2]:scan=11248	71.912	2	2131.1045	2131.1045	R	A	64	84
PSM	GLFIIDDKGILR	960	sp|Q06830|PRDX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9739	61.804	2	1358.7922	1358.7922	R	Q	129	141
PSM	GLFIIDDKGILR	961	sp|Q06830|PRDX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9896	62.819	2	1358.7922	1358.7922	R	Q	129	141
PSM	GLFKDFFPETGTK	962	sp|Q9Y2Z4|SYYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9391	59.447	2	1485.7504	1485.7504	R	I	46	59
PSM	GLGTDEDSLIEIICSR	963	sp|P07355-2|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	14-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=11776	75.522	2	1786.8646	1786.8646	K	T	138	154
PSM	GLRDLEEEIQMLK	964	sp|Q8IUD2-4|RB6I2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11038	70.513	2	1572.8181	1572.8181	R	S	397	410
PSM	GRTFDEIASGFR	965	sp|P11166|GTR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6966	44.24	2	1354.663	1354.6630	K	Q	457	469
PSM	GVLHQVMVLDSEALR	966	sp|Q9NVH1-3|DJC11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9162	58.017	2	1665.8872	1665.8872	R	I	481	496
PSM	HASPILPITEFSDIPR	967	sp|P42167|LAP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	16-UNIMOD:267	ms_run[2]:scan=10086	64.034	2	1801.9602	1801.9602	K	R	304	320
PSM	HAVSEGTKAVTK	968	sp|Q99880|H2B1L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=636	6.7274	2	1226.6619	1226.6619	K	Y	110	122
PSM	HFSGLEEAVYR	969	sp|P50990|TCPQ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:267	ms_run[2]:scan=5734	36.799	2	1316.6389	1316.6389	K	N	21	32
PSM	HGESAWNLENR	970	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:267	ms_run[2]:scan=4096	26.986	2	1321.6039	1321.6039	R	F	11	22
PSM	HGESAWNLENR	971	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=4097	26.991	2	1311.5956	1311.5956	R	F	11	22
PSM	HLALSQPFSFTQQDMPK	972	sp|Q9H4L4|SENP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8908	56.426	2	1973.9669	1973.9669	K	L	542	559
PSM	HLLGVEDLLQK	973	sp|Q01082-3|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:188	ms_run[2]:scan=8616	54.58	2	1269.7388	1269.7388	K	H	546	557
PSM	HLLGVEDLLQK	974	sp|Q01082-3|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:188	ms_run[2]:scan=8634	54.697	2	1269.7388	1269.7388	K	H	546	557
PSM	HLLGVEDLLQK	975	sp|Q01082-3|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8621	54.613	2	1263.7187	1263.7187	K	H	546	557
PSM	HQGVMVGMGQK	976	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	8-UNIMOD:35	ms_run[2]:scan=1060	9.0708	2	1186.5587	1186.5587	R	D	40	51
PSM	HQGVMVGMGQK	977	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=2306	16.244	2	1170.5638	1170.5638	R	D	40	51
PSM	IAILTCPFEPPKPK	978	sp|P48643|TCPE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	6-UNIMOD:4	ms_run[2]:scan=7922	50.166	2	1609.8902	1609.8902	K	T	248	262
PSM	IEINFPAEYPFKPPK	979	sp|P68036-2|UB2L3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9919	62.962	2	1788.9451	1788.9451	R	I	21	36
PSM	IGRPSETGIIGIIDPECR	980	sp|Q16531|DDB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	17-UNIMOD:4	ms_run[2]:scan=9344	59.152	2	1982.0255	1982.0255	R	M	112	130
PSM	IIHEAGYSEEECKQYK	981	sp|P63096-2|GNAI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:4	ms_run[2]:scan=2516	17.431	3	1982.9044	1982.9044	K	A	3	19
PSM	IINEVKPTEIYNLGAQSHVK	982	sp|O60547-2|GMDS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	6-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=6816	43.331	3	2264.2567	2264.2567	K	I	66	86
PSM	IPDIVLWPTCHDDVVK	983	sp|O00116|ADAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	10-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=10137	64.385	2	1911.986	1911.9860	R	I	205	221
PSM	IVAERPGTNSTGPAPMAPPR	984	sp|Q13263-2|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=4165	27.399	3	2018.0367	2018.0367	K	A	326	346
PSM	KGGILAIASLIGVEGGNATR	985	sp|P42345|MTOR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11481	73.484	3	1896.0793	1896.0793	R	I	84	104
PSM	KVGYTPDWIFLLR	986	sp|Q00610-2|CLH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=12225	78.658	2	1606.8871	1606.8871	K	N	507	520
PSM	LAAQENRPVTDHLDEQAVQGLK	987	sp|Q9BTW9-3|TBCD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5619	36.11	3	2431.2456	2431.2455	K	Q	89	111
PSM	LALLHEGTGPR	988	sp|Q9UQE7|SMC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=4441	29.052	2	1162.6459	1162.6459	R	V	62	73
PSM	LGETYKDHENIVIAK	989	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	6-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=4353	28.528	2	1740.9449	1740.9449	K	M	410	425
PSM	LGNPTRSEDLLDYGPFR	990	sp|P04843|RPN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	6-UNIMOD:267,17-UNIMOD:267	ms_run[2]:scan=9177	58.105	2	1968.9808	1968.9808	K	D	188	205
PSM	LHDLVLPLVMGVQQGEVLGSSPYTSSR	991	sp|Q8IZL8|PELP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	27-UNIMOD:267	ms_run[2]:scan=12069	77.574	3	2891.509	2891.5090	R	C	548	575
PSM	LHIIEVGTPPTGNQPFPK	992	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	18-UNIMOD:188	ms_run[2]:scan=7584	48.045	2	1950.067	1950.0670	K	K	228	246
PSM	LIALLEVLSQKK	993	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11281	72.132	2	1353.8595	1353.8595	R	M	77	89
PSM	LIDNISSREEIDHAEYYLYK	994	sp|Q92552|RT27_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8438	53.469	3	2470.2016	2470.2016	R	F	75	95
PSM	LKGPQITGPSLEGDLGLK	995	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=8534	54.065	3	1834.0603	1834.0603	K	G	370	388
PSM	LLIHQSLAGGIIGVK	996	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	15-UNIMOD:188	ms_run[2]:scan=8098	51.315	3	1523.9495	1523.9495	R	G	125	140
PSM	LPLHTLTSSTPVVLVR	997	sp|P17152|TMM11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8284	52.486	2	1732.0247	1732.0247	R	K	146	162
PSM	LRELGPDGEEAEGPGAGDGPPR	998	sp|P18615|NELFE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=4402	28.816	3	2175.0192	2175.0192	R	S	143	165
PSM	LSKEETVLATVQALQTASHLSQQADLR	999	sp|P04844-2|RPN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11529	73.82	2	2936.5567	2936.5567	R	S	120	147
PSM	LTDISVTDPEKYPHMLSVK	1000	sp|Q9Y333|LSM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=7842	49.651	2	2184.1539	2184.1539	K	N	40	59
PSM	LVHPGVAEVVFVK	1001	sp|Q9BY77-2|PDIP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:188	ms_run[2]:scan=7051	44.748	2	1398.8331	1398.8331	R	K	282	295
PSM	LYPFQCFLAHDQAVR	1002	sp|Q8WUA4|TF3C2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	6-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=10512	66.953	2	1873.9173	1873.9173	K	T	603	618
PSM	MGHAGAIIAGGK	1003	sp|P53597|SUCA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:35,12-UNIMOD:188	ms_run[2]:scan=1295	10.307	2	1103.5853	1103.5853	R	G	297	309
PSM	MGHAGAIIAGGK	1004	sp|P53597|SUCA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:35	ms_run[2]:scan=1294	10.302	2	1097.5652	1097.5652	R	G	297	309
PSM	MIAPEGSLVFHEK	1005	sp|P48739|PIPNB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:35	ms_run[2]:scan=5875	37.644	2	1472.7334	1472.7334	R	A	74	87
PSM	MIPCDFLIPVQTQHPIR	1006	sp|P06744-2|G6PI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:35,4-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=9223	58.389	2	2090.0681	2090.0681	K	K	412	429
PSM	MIPCDFLIPVQTQHPIR	1007	sp|P06744-2|G6PI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	4-UNIMOD:4	ms_run[2]:scan=10078	63.981	2	2064.0649	2064.0649	K	K	412	429
PSM	MLFKDDYPSSPPK	1008	sp|P63279|UBC9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:35	ms_run[2]:scan=4843	31.407	2	1539.7279	1539.7279	R	C	62	75
PSM	MQHNLEQQIQAR	1009	sp|Q13813-3|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:35	ms_run[2]:scan=3101	20.967	2	1510.7311	1510.7311	R	N	2284	2296
PSM	MTNYDVEHTIKK	1010	sp|P08133-2|ANXA6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=3154	21.295	2	1489.7638	1489.7638	K	E	537	549
PSM	NATVHPGLELPLMMAK	1011	sp|Q14558|KPRA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	16-UNIMOD:188	ms_run[2]:scan=9425	59.648	2	1726.9206	1726.9206	K	E	221	237
PSM	NLRDIDEVSSLLR	1012	sp|P50990|TCPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9156	57.982	2	1528.8209	1528.8209	K	T	153	166
PSM	NVIDKLAQFVAR	1013	sp|Q8IWX8|CHERP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10631	67.733	2	1372.7827	1372.7827	R	N	14	26
PSM	QHVIDGEKTIIQNPTDQQK	1014	sp|Q9UQ80-2|PA2G4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=4292	28.158	2	2191.1233	2191.1233	K	K	138	157
PSM	QKWLLLTGISAQQNR	1015	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8903	56.398	3	1754.9792	1754.9792	K	V	162	177
PSM	RISISTSGGSFR	1016	sp|P13647|K2C5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:267,12-UNIMOD:267	ms_run[2]:scan=4499	29.393	2	1286.6846	1286.6846	K	N	73	85
PSM	RLEAGAMVLADR	1017	sp|P25205-2|MCM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:267,12-UNIMOD:267	ms_run[2]:scan=5463	35.158	2	1320.7087	1320.7087	R	G	437	449
PSM	RLTAEDLFEAR	1018	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7305	46.334	2	1319.6834	1319.6834	R	I	3783	3794
PSM	RVQELQQGAFGR	1019	sp|Q8TDD1|DDX54_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=3800	25.236	2	1387.732	1387.7320	R	G	857	869
PSM	SKEELHQDCLVLATAK	1020	sp|Q8TEQ6|GEMI5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:188,9-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=4580	29.864	3	1852.9756	1852.9756	R	H	859	875
PSM	SNYNFEKPFLWLAR	1021	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11365	72.687	2	1783.9046	1783.9046	K	K	153	167
PSM	SPLLQLPHIEEDNLR	1022	sp|Q9UGP8|SEC63_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9207	58.29	2	1772.9421	1772.9421	K	R	382	397
PSM	SSTSRPDAYEHTQMK	1023	sp|Q9UHQ4|BAP29_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=1506	11.699	2	1736.7788	1736.7788	K	L	82	97
PSM	TEELNREVAGHTEQLQMSR	1024	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	17-UNIMOD:35	ms_run[2]:scan=4288	28.138	3	2243.0601	2243.0601	R	S	275	294
PSM	TEELNREVAGHTEQLQMSR	1025	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=4992	32.287	2	2227.0651	2227.0651	R	S	275	294
PSM	TKVVVTMEHSAK	1026	sp|P55809-2|SCOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=1673	12.628	2	1328.7122	1328.7122	K	G	38	50
PSM	TLDSWRDEFLIQASPR	1027	sp|P51149|RAB7A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	6-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=9613	60.884	2	1952.9859	1952.9859	K	D	98	114
PSM	TLDSWRDEFLIQASPR	1028	sp|P51149|RAB7A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9621	60.962	2	1932.9694	1932.9694	K	D	98	114
PSM	TLEEEAKTHEAQIQEMR	1029	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	7-UNIMOD:188,17-UNIMOD:267	ms_run[2]:scan=5977	38.248	2	2058.0023	2054.0141	K	Q	1175	1192
PSM	TLENQSHETLERENQECPR	1030	sp|P48681|NEST_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	17-UNIMOD:4	ms_run[2]:scan=2916	19.879	2	2369.0666	2369.0666	K	S	559	578
PSM	TLSCLDHVISYYHVASDTEK	1031	sp|Q9UPT5-4|EXOC7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	4-UNIMOD:4	ms_run[2]:scan=8591	54.424	3	2337.0947	2337.0947	K	I	80	100
PSM	TLSSPSNRPSGETSVPPPPAVGR	1032	sp|Q8WWM7-6|ATX2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	8-UNIMOD:267,23-UNIMOD:267	ms_run[2]:scan=4563	29.764	2	2309.1879	2309.1879	K	M	421	444
PSM	TNLDESDVQPVKEQLAQAMFDHIPVGVGSK	1033	sp|Q9Y3I0|RTCB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10889	69.509	3	3251.6132	3251.6132	R	G	129	159
PSM	TVLGTPEVLLGALPGAGGTQRLPK	1034	sp|P40939|ECHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11073	70.747	2	2344.3478	2344.3478	K	M	167	191
PSM	TVSLGAGAKDELHIVEAEAMNYEGSPIK	1035	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10949	69.922	2	2928.4539	2928.4539	R	V	46	74
PSM	VFEHFLENLDK	1036	sp|P49642|PRI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8718	55.213	2	1389.6929	1389.6929	K	S	394	405
PSM	VKAFGPGLQGGSAGSPAR	1037	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:188,18-UNIMOD:267	ms_run[2]:scan=4068	26.833	2	1671.9028	1667.9146	K	F	1070	1088
PSM	VKDTFNGNLPFLFK	1038	sp|P34949-2|MPI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10510	66.941	2	1638.877	1638.8770	K	V	86	100
PSM	VLKEVEAVIPDHCIFASNTSALPISEIAAVSK	1039	sp|P40939|ECHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:188,13-UNIMOD:4,32-UNIMOD:188	ms_run[2]:scan=11546	73.94	3	3419.8413	3419.8413	R	R	458	490
PSM	VSFELFADKVPK	1040	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8789	55.67	2	1378.7497	1378.7497	R	T	20	32
PSM	YGFIEGHVVIPR	1041	sp|P16070-15|CD44_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:267	ms_run[2]:scan=7431	47.091	2	1395.7538	1395.7538	R	I	79	91
PSM	VVCDENGSKGYGFVHFETQEAAER	1042	sp|P11940|PABP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:4	ms_run[1]:scan=6718	42.74055666666666	3	2729.202216	2728.218744	K	A	130	154
PSM	SNYNFEKPFLWLAR	1043	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=11368	72.71013666666667	3	1783.901609	1783.904590	K	K	153	167
PSM	QSVENDIHGLRK	1044	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:28,11-UNIMOD:267,12-UNIMOD:188	ms_run[1]:scan=4585	29.894759999999998	2	1393.7274	1393.7280	R	V	176	188
PSM	YASICQQNGIVPIVEPEILPDGDHDLKR	1045	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	5-UNIMOD:4	ms_run[1]:scan=9793	62.14731166666667	3	3176.582350	3175.597199	R	C	174	202
PSM	HLEAAALLSER	1046	sp|Q9UJA5|TRM6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	11-UNIMOD:267	ms_run[1]:scan=6034	38.594485	2	1219.661840	1218.659605	R	N	357	368
PSM	TAFPSLPDTDDHKTDNTGTLPEDVAFR	1047	sp|A8MXV4|NUD19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	13-UNIMOD:188,27-UNIMOD:267	ms_run[1]:scan=8663	54.87427833333333	3	2976.415415	2975.411958	R	I	99	126
PSM	TNNVSEHEDTDKYR	1048	sp|P53618|COPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=991	8.686438333333333	2	1706.763401	1706.749606	K	Q	367	381
PSM	LYKEELEQTYHAK	1049	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:188,13-UNIMOD:188	ms_run[1]:scan=3826	25.392688333333332	2	1662.876210	1662.865595	R	L	259	272
PSM	LEHVVEEEKVDISEDGMK	1050	sp|P40937|RFC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	9-UNIMOD:188,18-UNIMOD:188	ms_run[1]:scan=5479	35.25508833333333	3	2098.034062	2097.033859	R	A	186	204
PSM	FKGQILMPNIGYGSNK	1051	sp|P62910|RL32_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	2-UNIMOD:188,16-UNIMOD:188	ms_run[1]:scan=7579	48.01179333333334	2	1779.966651	1777.958784	R	K	49	65
PSM	ADARQEEDSYEIFICHANVIR	1052	sp|Q96HS1|PGAM5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	4-UNIMOD:267,15-UNIMOD:4,21-UNIMOD:267	ms_run[1]:scan=8914	56.46615666666666	3	2556.203200	2555.197774	R	Y	215	236
PSM	FKGPFTDVVTTNLK	1053	sp|Q9P0L0|VAPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=8047	50.99113	2	1566.854143	1565.845344	K	L	25	39
PSM	VGAHAGEYGAEALER	1054	sp|P69905|HBA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=4317	28.310391666666668	2	1528.728348	1528.727020	K	M	18	33
PSM	CLANLRPLLDSGTMGTK	1055	sp|A0AVT1|UBA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=11803	75.70523166666666	2	1828.9103	1828.9170	R	G	581	598
PSM	KNPDDYTPVNIDGAHAQR	1056	sp|Q96JH7|VCIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	1-UNIMOD:188,18-UNIMOD:267	ms_run[1]:scan=4277	28.064595	2	2026.965305	2025.983914	K	V	658	676
PSM	KVPQVSTPTLVEVSR	1057	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=6278	40.083065000000005	3	1638.929072	1638.930471	K	N	438	453
PSM	KEWSGLLEELAR	1058	sp|Q01813|PFKAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=9727	61.72853833333333	2	1431.762894	1429.756529	R	N	139	151
PSM	ADHEQQIKDLEQK	1059	sp|Q9Y6D9-3|MD1L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=2742	18.743	2	1580.7794	1580.7794	R	L	127	140
PSM	AEVQVLVLDGRGHLLGR	1060	sp|P40429|RL13A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:1	ms_run[2]:scan=11022	70.405	2	1873.0534	1873.0534	M	L	2	19
PSM	AGGAAVVITEPEHTKER	1061	sp|Q9P258|RCC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=2768	18.92	2	1763.9166	1763.9166	K	V	78	95
PSM	AGLGSGLSLSGLVHPELSR	1062	sp|P49748-2|ACADV_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	19-UNIMOD:267	ms_run[2]:scan=10038	63.737	3	1859.014	1859.0140	R	S	491	510
PSM	AHEEQLKEAQAVPATLPELEATK	1063	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6943	44.109	4	2502.2966	2502.2966	R	A	1244	1267
PSM	ALPGQLKPFETLLSQNQGGK	1064	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	7-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=10218	64.992	3	2137.1934	2137.1934	K	T	122	142
PSM	ALRLDVGNFSWGSECCTR	1065	sp|P62241|RS8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	15-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=9326	59.04	3	2126.9626	2126.9626	R	K	57	75
PSM	APHYPGIGPVDESGIPTAIR	1066	sp|O94875-9|SRBS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8078	51.185	2	2046.0534	2046.0534	K	T	155	175
PSM	APTVHGGAGGAR	1067	sp|Q9C075|K1C23_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:267	ms_run[2]:scan=638	6.7378	2	1059.5449	1059.5449	R	I	31	43
PSM	DDKHGSYEDAVHSGALND	1068	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3874	25.664	2	1928.8137	1928.8137	K	-	539	557
PSM	DHASIQMNVAEVDKVTGR	1069	sp|P63220|RS21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	14-UNIMOD:188,18-UNIMOD:267	ms_run[2]:scan=6590	41.957	2	1984.9971	1981.0090	K	F	28	46
PSM	DLPIHACSYCGIHDPACVVYCNTSK	1070	sp|Q92900-2|RENT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	7-UNIMOD:4,10-UNIMOD:4,17-UNIMOD:4,21-UNIMOD:4,25-UNIMOD:188	ms_run[2]:scan=7696	48.718	3	2942.2915	2942.2915	K	K	117	142
PSM	DTGKTPVEPEVAIHR	1071	sp|P60866|RS20_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3827	25.397	3	1647.858	1647.8580	K	I	5	20
PSM	DVACGANHTLVLDSQKR	1072	sp|Q9P258|RCC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	4-UNIMOD:4	ms_run[2]:scan=3918	25.928	3	1882.9319	1882.9319	R	V	334	351
PSM	DYIQKHPELNISEEGITK	1073	sp|P17480-2|UBF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	5-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=6270	40.037	3	2125.1094	2125.1094	R	S	225	243
PSM	EHAPSIIFMDEIDSIGSSR	1074	sp|P62195-2|PRS8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	19-UNIMOD:267	ms_run[2]:scan=11357	72.634	3	2113.0025	2113.0025	R	L	232	251
PSM	EKLCYVALDFEQEMATAASSSSLEK	1075	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	4-UNIMOD:4	ms_run[2]:scan=12298	79.211	3	2806.3041	2806.3041	K	S	214	239
PSM	ETVFTKSPYQEFTDHLVK	1076	sp|P15880|RS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8698	55.092	2	2168.079	2168.0790	K	T	258	276
PSM	FACNGTVIEHPEYGEVIQLQGDQRK	1077	sp|P41567|EIF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	3-UNIMOD:4	ms_run[2]:scan=7234	45.896	2	2887.3923	2887.3923	K	N	67	92
PSM	FFDKVQDLGR	1078	sp|Q9UHX3-5|AGRE2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6063	38.774	2	1223.6299	1223.6299	R	D	139	149
PSM	FIAHVPVPSQQEIEEALVR	1079	sp|Q9ULR0|ISY1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10848	69.233	3	2161.1532	2161.1532	K	R	239	258
PSM	FKLVFLGEQSVGK	1080	sp|P20340-3|RAB6A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=9052	57.33	2	1462.8587	1462.8587	K	T	14	27
PSM	FLSQPFQVAEVFTGHMGK	1081	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=11812	75.765	3	2022.0033	2022.0033	R	L	463	481
PSM	FLSQPFQVAEVFTGHMGK	1082	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	18-UNIMOD:188	ms_run[2]:scan=11816	75.789	2	2028.0234	2028.0234	R	L	463	481
PSM	FMLGKQEVIR	1083	sp|P62942|FKB1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5765	36.972	2	1219.6747	1219.6747	K	G	49	59
PSM	FPEHELTFDPQR	1084	sp|Q9Y4L1|HYOU1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:267	ms_run[2]:scan=6400	40.796	2	1524.7237	1524.7237	R	Q	120	132
PSM	GAEILEVLHSLPAVR	1085	sp|Q15008-3|PSMD6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=11573	74.121	2	1602.9093	1602.9093	K	Q	204	219
PSM	GFAFVTFDDHDTVDKIVVQK	1086	sp|P51991|ROA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	15-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=9682	61.401	3	2292.1829	2292.1829	R	Y	168	188
PSM	GFGFVYFQNHDAADK	1087	sp|Q13151|ROA0_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8310	52.661	2	1714.774	1714.7740	R	A	140	155
PSM	GFGGITHGPPEK	1088	sp|P49748-2|ACADV_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:188	ms_run[2]:scan=3264	21.988	2	1201.6187	1201.6187	R	K	265	277
PSM	GHAGSVDSIAVDGSGTKFCSGSWDK	1089	sp|Q9GZL7|WDR12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	17-UNIMOD:188,19-UNIMOD:4,25-UNIMOD:188	ms_run[2]:scan=6373	40.641	3	2536.1691	2536.1691	R	M	187	212
PSM	GHNQPCLLVGSGR	1090	sp|P27708|PYR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	6-UNIMOD:4	ms_run[2]:scan=3813	25.314	2	1393.6885	1393.6885	R	C	275	288
PSM	GHNQPCLLVGSGR	1091	sp|P27708|PYR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	6-UNIMOD:4	ms_run[2]:scan=3854	25.544	2	1393.6885	1393.6885	R	C	275	288
PSM	GIHPTIISESFQK	1092	sp|P50991-2|TCPD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6247	39.895	2	1455.7722	1455.7722	K	A	97	110
PSM	GKSPGIIFIPGYLSYMNGTK	1093	sp|Q9NUJ1-3|ABHDA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=11445	73.23	3	2154.1586	2154.1586	K	A	73	93
PSM	GLGTDEDSLIEIICSR	1094	sp|P07355-2|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	14-UNIMOD:4	ms_run[2]:scan=11785	75.583	2	1776.8564	1776.8564	K	T	138	154
PSM	GTADVTHDLQEMKEESR	1095	sp|P11166|GTR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:35	ms_run[2]:scan=3135	21.181	2	1960.8796	1960.8796	R	Q	233	250
PSM	GTADVTHDLQEMKEESR	1096	sp|P11166|GTR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:188,17-UNIMOD:267	ms_run[2]:scan=5733	36.794	2	1960.9131	1956.9250	R	Q	233	250
PSM	GVTECYECHPKPTQR	1097	sp|Q9UBT2-2|SAE2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	5-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=1712	12.848	2	1860.8247	1860.8247	K	T	58	73
PSM	GWLRDPSASPGDAGEQAIR	1098	sp|P18206-2|VINC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6139	39.233	3	1981.9606	1981.9606	K	Q	282	301
PSM	HASPILPITEFSDIPR	1099	sp|P42167|LAP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10097	64.109	3	1791.9519	1791.9519	K	R	304	320
PSM	HAVSEGTKAVTK	1100	sp|Q99880|H2B1L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	8-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=635	6.7219	2	1238.7022	1238.7022	K	Y	110	122
PSM	HELLQPFNVLYEK	1101	sp|Q9UQ80-2|PA2G4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9513	60.216	2	1628.8562	1628.8562	K	E	245	258
PSM	HGGTIPIVPTAEFQDR	1102	sp|P00367-2|DHE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7224	45.837	3	1736.8846	1736.8846	K	I	314	330
PSM	HIGDGCCLTR	1103	sp|Q6UX53|MET7B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	6-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=2085	14.963	2	1187.5176	1187.5176	K	E	197	207
PSM	HLIIENFIPLEEK	1104	sp|O15066-2|KIF3B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=11189	71.516	2	1593.8766	1593.8766	K	S	210	223
PSM	HLLLNEDPLNSCPPLMVVATTSR	1105	sp|Q13608-2|PEX6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:4,23-UNIMOD:267	ms_run[2]:scan=11023	70.412	3	2586.3173	2586.3173	R	A	553	576
PSM	HNQLPLVIEFTEQTAPK	1106	sp|P07237|PDIA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10026	63.656	2	1964.0367	1964.0367	K	I	231	248
PSM	HQGVMVGMGQK	1107	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:188	ms_run[2]:scan=2305	16.239	2	1176.5839	1176.5839	R	D	40	51
PSM	HSSVYPTQEELEAVQNMVSHTER	1108	sp|Q12906-5|ILF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9962	63.244	3	2670.2344	2670.2344	K	A	18	41
PSM	IAGHPLAQNER	1109	sp|Q9UMY4-3|SNX12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=1168	9.6399	2	1204.6313	1204.6313	K	C	126	137
PSM	IAGHPLAQNER	1110	sp|Q9UMY4-3|SNX12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:267	ms_run[2]:scan=1169	9.6454	2	1214.6395	1214.6395	K	C	126	137
PSM	IGILHENFQTLK	1111	sp|Q9Y6G9|DC1L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:188	ms_run[2]:scan=7139	45.306	2	1417.8025	1417.8025	K	A	333	345
PSM	IINEVKPTEIYNLGAQSHVK	1112	sp|O60547-2|GMDS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6826	43.386	3	2252.2165	2252.2165	K	I	66	86
PSM	IKTLFPLIEAK	1113	sp|P13010|XRCC5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9071	57.449	2	1271.7853	1271.7853	K	K	533	544
PSM	IPLNPYLNLHSLLPASNLAGK	1114	sp|Q8IY67-2|RAVR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	21-UNIMOD:188	ms_run[2]:scan=11891	76.313	2	2250.2832	2250.2832	R	E	504	525
PSM	ITDSAGHILYSKEDATK	1115	sp|P49755|TMEDA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3755	24.964	3	1847.9265	1847.9265	K	G	76	93
PSM	IYAEDPSNNFMPVAGPLVHLSTPR	1116	sp|Q96RQ3|MCCA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	24-UNIMOD:267	ms_run[2]:scan=10606	67.569	3	2634.314	2634.3140	R	A	386	410
PSM	KAILCLLLGGVER	1117	sp|P25205-2|MCM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	5-UNIMOD:4	ms_run[2]:scan=11266	72.032	2	1440.8487	1440.8487	K	D	360	373
PSM	KDDEENYLDLFSHK	1118	sp|Q07666|KHDR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=8105	51.352	3	1763.8405	1763.8405	K	N	139	153
PSM	LALLHEGTGPR	1119	sp|Q9UQE7|SMC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:267	ms_run[2]:scan=4439	29.037	2	1172.6541	1172.6541	R	V	62	73
PSM	LEGLTDEINFLR	1120	sp|P05787|K2C8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10873	69.401	2	1418.7405	1418.7405	R	Q	214	226
PSM	LEQEKELLHSQNTWLNTELK	1121	sp|P12270|TPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8090	51.263	3	2452.2598	2452.2598	R	T	183	203
PSM	LGNPTRSEDLLDYGPFR	1122	sp|P04843|RPN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9179	58.117	2	1948.9643	1948.9643	K	D	188	205
PSM	LKDLEALLNSK	1123	sp|P02545-5|LMNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=7797	49.351	2	1254.7586	1254.7586	R	E	35	46
PSM	LKEPWPNSDPPFSFK	1124	sp|P16144-5|ITB4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8934	56.59	3	1787.8883	1787.8883	K	N	190	205
PSM	LKVNFLPEIITLSK	1125	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=11704	75.018	2	1626.0159	1626.0159	K	E	735	749
PSM	LNQSQREELGLIEQAYDNPHEALSR	1126	sp|Q6P2Q9|PRP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8930	56.569	4	2909.4268	2909.4268	R	I	856	881
PSM	LQMEAPHIIVGTPGR	1127	sp|P60842-2|IF4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	15-UNIMOD:267	ms_run[2]:scan=7047	44.727	3	1627.8744	1627.8744	K	V	147	162
PSM	LQVVLEHMPVGPDAILR	1128	sp|P46379-4|BAG6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	17-UNIMOD:267	ms_run[2]:scan=10271	65.339	2	1896.0531	1896.0531	R	Y	790	807
PSM	LSSVVTQHDSKK	1129	sp|P54577|SYYC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=969	8.5739	2	1339.7498	1339.7498	R	A	136	148
PSM	MGIVGPEFKDK	1130	sp|Q15149|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:35,9-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=4080	26.901	2	1247.6623	1247.6623	R	L	4130	4141
PSM	MGLVDQLVEPLGPGLKPPEER	1131	sp|P40939|ECHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:35	ms_run[2]:scan=9934	63.061	2	2289.2039	2289.2039	K	T	215	236
PSM	MQKEITALAPSTMK	1132	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:35	ms_run[2]:scan=4679	30.441	2	1563.8	1563.8001	R	I	313	327
PSM	MTIGHLIECLQGK	1133	sp|P30876|RPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	9-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=10454	66.572	2	1504.7837	1504.7837	R	V	976	989
PSM	NCPHIVVGTPGR	1134	sp|Q13838|DX39B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:4	ms_run[2]:scan=3464	23.206	2	1305.6612	1305.6612	K	I	164	176
PSM	NRPPLPAGTNSK	1135	sp|P42167|LAP2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=1333	10.523	2	1250.6731	1250.6731	R	G	49	61
PSM	QAGEVTYADAHKER	1136	sp|Q13247-3|SRSF6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=1101	9.2864	2	1573.7485	1573.7485	R	T	132	146
PSM	QLPFRGDDGIFDDNFIEER	1137	sp|O60493-2|SNX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	5-UNIMOD:267,19-UNIMOD:267	ms_run[2]:scan=10597	67.509	3	2302.0769	2302.0769	R	K	68	87
PSM	QMEKDETVSDCSPHIANIGR	1138	sp|P47756-2|CAPZB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:4	ms_run[2]:scan=4603	29.999	3	2286.0369	2286.0369	R	L	196	216
PSM	RGGPNYQEGLR	1139	sp|P53396|ACLY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:267,11-UNIMOD:267	ms_run[2]:scan=2084	14.959	2	1265.638	1265.6380	R	V	379	390
PSM	RGPAEESSSWR	1140	sp|Q14152-2|EIF3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:267,11-UNIMOD:267	ms_run[2]:scan=1859	13.684	2	1280.6012	1280.6013	R	D	1216	1227
PSM	RGPAEESSSWR	1141	sp|Q14152-2|EIF3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=1866	13.723	2	1260.5847	1260.5847	R	D	1216	1227
PSM	RISGLIYEETR	1142	sp|P62805|H4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:267,11-UNIMOD:267	ms_run[2]:scan=5202	33.593	2	1355.7312	1355.7312	K	G	46	57
PSM	RLTLEDLEDSWDR	1143	sp|Q6P2Q9|PRP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:267,13-UNIMOD:267	ms_run[2]:scan=9943	63.122	2	1666.8066	1666.8066	R	G	1402	1415
PSM	RLVPGGGATEIELAK	1144	sp|P50990|TCPQ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5779	37.059	2	1509.8515	1509.8515	K	Q	407	422
PSM	RNFILDQTNVSAAAQR	1145	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6225	39.768	3	1802.9387	1802.9387	K	R	556	572
PSM	RPSANCDPFSVTEALIR	1146	sp|P15104|GLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:267,6-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=9749	61.868	3	1951.9689	1951.9689	R	T	341	358
PSM	SKVEETTEHLVTK	1147	sp|P52732|KIF11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=2899	19.77	3	1511.8234	1511.8234	R	S	1033	1046
PSM	SLEEDQEPIVSHQKPGK	1148	sp|Q14241|ELOA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=2860	19.524	2	1919.9589	1919.9589	R	G	222	239
PSM	SLGKGSAPPGPVPEGSIR	1149	sp|P78417-2|GSTO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4328	28.376	2	1704.9159	1704.9159	R	I	8	26
PSM	SPHQNVCEQAVWALGNIIGDGPQCR	1150	sp|O00505|IMA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	7-UNIMOD:4,24-UNIMOD:4,25-UNIMOD:267	ms_run[2]:scan=11795	75.651	3	2815.3158	2815.3158	R	D	168	193
PSM	TEELNREVAGHTEQLQMSR	1151	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	17-UNIMOD:35	ms_run[2]:scan=4289	28.143	2	2243.0601	2243.0601	R	S	275	294
PSM	TIFLNKQPNPR	1152	sp|Q9UBT2-2|SAE2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3846	25.499	2	1326.7408	1326.7408	R	K	319	330
PSM	TKPSDEEMLFIYGHYK	1153	sp|P07108|ACBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7737	48.971	3	1956.9291	1956.9292	K	Q	18	34
PSM	TLGVERFEEILQEAGSR	1154	sp|P04920-2|B3A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=11297	72.239	2	1932.9905	1932.9905	R	G	27	44
PSM	TLSSPSNRPSGETSVPPPPAVGR	1155	sp|Q8WWM7-6|ATX2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4518	29.5	2	2289.1713	2289.1713	K	M	421	444
PSM	TVNKHGDEIITSTTSNYETQTFSSK	1156	sp|Q6P2Q9|PRP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5699	36.587	3	2787.3199	2787.3199	R	T	2046	2071
PSM	TYEEGLKHEANNPQLK	1157	sp|P31948|STIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3583	23.933	3	1869.9221	1869.9221	R	E	94	110
PSM	VAEAHENIIHGSGATGK	1158	sp|Q08257-3|QOR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=1690	12.724	3	1689.8434	1689.8434	K	M	274	291
PSM	VAEIEHAEKEK	1159	sp|P78371-2|TCPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	9-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=941	8.4217	2	1293.6967	1293.6967	K	M	217	228
PSM	VAEIEHAEKEK	1160	sp|P78371-2|TCPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=942	8.4263	2	1281.6565	1281.6565	K	M	217	228
PSM	VEDMAELTCLNEASVLHNLKER	1161	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	4-UNIMOD:35,9-UNIMOD:4	ms_run[2]:scan=8359	52.973	3	2586.2418	2586.2418	K	Y	83	105
PSM	VLEALLPLKGLEER	1162	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10318	65.644	2	1578.9345	1578.9345	R	V	2383	2397
PSM	VLEALLPLKGLEER	1163	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10319	65.65	3	1578.9345	1578.9345	R	V	2383	2397
PSM	VSALNSVHCEHVEDEGESR	1164	sp|Q13085-3|ACACA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	9-UNIMOD:4	ms_run[2]:scan=3381	22.696	3	2152.9444	2152.9444	R	Y	1683	1702
PSM	VSFELFADKVPK	1165	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	9-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=8788	55.664	2	1390.7899	1390.7899	R	T	20	32
PSM	VSREDSQYLELATLEHR	1166	sp|Q96ER9-2|MITOK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	3-UNIMOD:267,17-UNIMOD:267	ms_run[2]:scan=6941	44.096	3	2065.0343	2065.0343	R	M	31	48
PSM	YIDSADLEPITSQEEPVRYHEAWQK	1167	sp|P17812-2|PYRG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7967	50.45	3	3003.425	3003.4250	K	L	105	130
PSM	YLLEGTAETHELAEGSTADVLHSR	1168	sp|Q709C8-4|VP13C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7941	50.284	3	2598.2562	2598.2562	R	I	2639	2663
PSM	YLTEHPDPNNENIVGYNNKK	1169	sp|Q6P2Q9|PRP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	19-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=4545	29.656	3	2370.1643	2370.1643	R	C	1113	1133
PSM	AGVENGKPTHFTVYTK	1170	sp|O75369|FLNB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	7-UNIMOD:188,16-UNIMOD:188	ms_run[1]:scan=3997	26.401786666666663	2	1760.914456	1759.929592	K	G	858	874
PSM	KEAESCDCLQGFQLTHSLGGGTGSGMGTLLISK	1171	sp|P04350|TBB4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:188,6-UNIMOD:4,8-UNIMOD:4,33-UNIMOD:188	ms_run[1]:scan=10053	63.82598333333334	2	3450.659733	3450.662034	R	I	122	155
PSM	QGGLGPMNIPLVSDPKR	1172	sp|Q06830|PRDX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:28	ms_run[1]:scan=9888	62.76564166666666	2	1760.9241	1760.9238	K	T	94	111
PSM	HIGVCISVANNR	1173	sp|O60506|HNRPQ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	5-UNIMOD:4,12-UNIMOD:267	ms_run[1]:scan=4595	29.951925	2	1348.691731	1348.690922	K	L	233	245
PSM	CCNHPYLFPVAAMEAPK	1174	sp|Q14839|CHD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:4,17-UNIMOD:188	ms_run[1]:scan=10664	67.94189166666666	2	1992.8979	1992.8987	K	M	1018	1035
PSM	CGQEEHDVLLSNEEDRK	1175	sp|Q9UGI8-2|TES_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:385,1-UNIMOD:4,16-UNIMOD:267,17-UNIMOD:188	ms_run[1]:scan=5199	33.571220000000004	3	2055.9146	2055.9133	K	V	37	54
PSM	CVFELPAENDKPHDVEINK	1176	sp|O95292|VAPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:385,1-UNIMOD:4,11-UNIMOD:188,19-UNIMOD:188	ms_run[1]:scan=8725	55.25604666666667	3	2248.0900	2248.0868	R	I	121	140
PSM	CWKFEHCNFNDVTTR	1177	sp|P13987|CD59_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:385,1-UNIMOD:4,3-UNIMOD:188,7-UNIMOD:4,15-UNIMOD:267	ms_run[1]:scan=8073	51.154175	2	2011.8631	2011.8635	K	L	64	79
PSM	CRVDLPLAVLSK	1178	sp|Q9H773|DCTP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=10710	68.28126666666667	2	1352.7497	1352.7481	R	M	110	122
PSM	VKTSEDADELHK	1179	sp|Q9UKX7|NUP50_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=980	8.628976666666667	2	1370.675022	1370.667774	R	I	449	461
PSM	MVSGFIPLKPTVK	1180	sp|P01023|A2MG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=7270	46.1205	2	1415.822436	1415.821044	K	M	1385	1398
PSM	LFNLSKEDDVR	1181	sp|P62753|RS6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	6-UNIMOD:188,11-UNIMOD:267	ms_run[1]:scan=5686	36.505315	2	1352.715334	1350.711428	K	Q	144	155
PSM	AFAHITGGGLLENIPR	1182	sp|P22102|PUR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	16-UNIMOD:267	ms_run[2]:scan=8807	55.787	2	1674.9081	1674.9081	K	V	677	693
PSM	AGNNMLLVGVHGPR	1183	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	14-UNIMOD:267	ms_run[2]:scan=6070	38.815	2	1443.7644	1443.7644	K	T	2577	2591
PSM	AGQVMCVAQGSGHTHSVGTVCCSR	1184	sp|Q12788|TBL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	6-UNIMOD:4,21-UNIMOD:4,22-UNIMOD:4	ms_run[2]:scan=3612	24.113	3	2545.1043	2545.1043	K	L	408	432
PSM	ALESPERPFLAILGGAK	1185	sp|P00558-2|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10659	67.913	3	1767.9883	1767.9883	K	V	172	189
PSM	AQHEDQVEQYKK	1186	sp|P02545-5|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=858	7.9667	3	1513.7564	1513.7564	R	E	151	163
PSM	AQHEDQVEQYKK	1187	sp|P02545-5|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=863	7.9928	3	1513.7564	1513.7564	R	E	151	163
PSM	AQHEDQVEQYKK	1188	sp|P02545-5|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=861	7.985	2	1513.7564	1513.7564	R	E	151	163
PSM	ARPAEVGGMQLR	1189	sp|P33316-2|DUT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:267,12-UNIMOD:267	ms_run[2]:scan=3840	25.465	2	1303.6934	1303.6934	R	F	16	28
PSM	ASITPGTILIILTGR	1190	sp|Q02878|RL6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=13545	91.614	2	1524.9239	1524.9239	R	H	142	157
PSM	DDVGKSVHELEK	1191	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	5-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=2939	20.017	2	1366.7131	1366.7131	K	S	1514	1526
PSM	DSGPLPTPPGVSLLGEPPKDYR	1192	sp|Q8IY67-2|RAVR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9487	60.039	2	2291.1798	2291.1798	K	I	482	504
PSM	EDSWTLFKPPPVFPVDNSSAK	1193	sp|Q7Z417|NUFP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11392	72.865	3	2360.1689	2360.1689	K	I	331	352
PSM	EETPGQRPAVTETHQLAELNEK	1194	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4861	31.516	3	2476.2194	2476.2194	K	K	109	131
PSM	EGMLQHWELGQALR	1195	sp|P11117-2|PPAL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	14-UNIMOD:267	ms_run[2]:scan=9118	57.743	2	1676.8332	1676.8332	K	Q	71	85
PSM	EGVKTENNDHINLK	1196	sp|P61956-2|SUMO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=2050	14.752	2	1609.806	1609.8060	K	V	8	22
PSM	EIVVIHQDPEALKDIK	1197	sp|P41252|SYIC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6428	40.967	2	1846.02	1846.0200	K	S	849	865
PSM	ELPRPVLEGQQSER	1198	sp|Q9BVJ6-2|UT14A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	4-UNIMOD:267,14-UNIMOD:267	ms_run[2]:scan=4565	29.776	2	1656.8698	1656.8698	K	T	359	373
PSM	ESDAMFAAERAPDWVDAEECHR	1199	sp|O14964-2|HGS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	20-UNIMOD:4	ms_run[2]:scan=8059	51.065	3	2591.0805	2591.0805	K	C	147	169
PSM	FACNGTVIEHPEYGEVIQLQGDQRK	1200	sp|P41567|EIF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	3-UNIMOD:4	ms_run[2]:scan=7227	45.852	3	2887.3923	2887.3923	K	N	67	92
PSM	FLHQDIDSGQGIR	1201	sp|P11717|MPRI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:267	ms_run[2]:scan=4462	29.175	2	1494.7455	1494.7455	K	N	1053	1066
PSM	FWEVISDEHGIDPTGTYHGDSDLQLDR	1202	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9504	60.158	3	3101.4003	3101.4003	K	I	20	47
PSM	GAVEALAAALAHISGATSVDQR	1203	sp|Q9NR30-2|DDX21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	22-UNIMOD:267	ms_run[2]:scan=12944	84.698	3	2117.1104	2117.1104	K	S	538	560
PSM	GHAGSVDSIAVDGSGTKFCSGSWDK	1204	sp|Q9GZL7|WDR12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	19-UNIMOD:4	ms_run[2]:scan=6365	40.594	3	2524.1289	2524.1289	R	M	187	212
PSM	GIRPAINVGLSVSR	1205	sp|P25705-2|ATPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6480	41.283	2	1437.8416	1437.8416	K	V	353	367
PSM	GITLHPELFSIDNGLLTPTMK	1206	sp|P33121-2|ACSL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11930	76.593	3	2296.2137	2296.2137	K	A	645	666
PSM	GLQEVGLPLHR	1207	sp|P11172-2|UMPS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:267	ms_run[2]:scan=6243	39.875	2	1227.6963	1227.6963	K	G	175	186
PSM	GPIKFNVWDTAGQEK	1208	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7636	48.36	3	1688.8522	1688.8522	R	F	57	72
PSM	GRLTECLETILNK	1209	sp|O94973|AP2A2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	6-UNIMOD:4	ms_run[2]:scan=9041	57.255	2	1545.8185	1545.8185	R	A	277	290
PSM	GTEAPAVVTEEEDDDEETAPPVIAPRPDHTK	1210	sp|Q13177|PAK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6289	40.146	3	3314.5426	3314.5426	K	S	161	192
PSM	GTEITHAVVIKK	1211	sp|Q99613-2|EIF3C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=2461	17.125	2	1306.8011	1306.8011	K	L	311	323
PSM	GTEITHAVVIKK	1212	sp|Q99613-2|EIF3C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=2465	17.145	2	1294.7609	1294.7609	K	L	311	323
PSM	GVAFILFLDKDSAQNCTR	1213	sp|Q8TBF4|ZCRB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	16-UNIMOD:4	ms_run[2]:scan=10695	68.17	3	2054.0255	2054.0255	K	A	52	70
PSM	GVDEVTIVNILTNR	1214	sp|P07355-2|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	14-UNIMOD:267	ms_run[2]:scan=11689	74.914	3	1551.8496	1551.8496	K	S	68	82
PSM	GVGGKLPNFGFVVFDDSEPVQR	1215	sp|Q9UN86-2|G3BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11311	72.33	2	2363.191	2363.1910	K	I	333	355
PSM	HDADGQATLLNLLLR	1216	sp|O43242|PSMD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	15-UNIMOD:267	ms_run[2]:scan=12209	78.553	3	1658.8979	1658.8979	R	N	242	257
PSM	HESGASIKIDEPLEGSEDR	1217	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	8-UNIMOD:188,19-UNIMOD:267	ms_run[2]:scan=4938	31.953	2	2083.9993	2080.0111	R	I	391	410
PSM	HLAGLGLTEAIDK	1218	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6695	42.592	2	1336.7351	1336.7351	K	N	320	333
PSM	HLFGQPNSAYDFK	1219	sp|O95347-2|SMC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:188	ms_run[2]:scan=6288	40.141	2	1528.7406	1528.7406	R	T	946	959
PSM	HNIAYFPQIVSVAAR	1220	sp|Q96AB3-3|ISOC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	15-UNIMOD:267	ms_run[2]:scan=8987	56.921	2	1694.9132	1694.9132	R	M	29	44
PSM	HNNLDLVIIR	1221	sp|O43837-2|IDH3B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:267	ms_run[2]:scan=7123	45.208	2	1215.6963	1215.6963	R	E	155	165
PSM	HPNILAYIDGLETEK	1222	sp|Q96KG9-5|SCYL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	15-UNIMOD:188	ms_run[2]:scan=10914	69.689	2	1717.8982	1717.8982	R	C	73	88
PSM	HQGVMVGMGQK	1223	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	8-UNIMOD:35,11-UNIMOD:188	ms_run[2]:scan=1059	9.0653	2	1192.5788	1192.5788	R	D	40	51
PSM	HQQLLGEVLTQLSSR	1224	sp|Q13616|CUL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	15-UNIMOD:267	ms_run[2]:scan=10566	67.311	3	1717.9351	1717.9351	K	F	727	742
PSM	IAILTCPFEPPKPK	1225	sp|P48643|TCPE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	6-UNIMOD:4,12-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=8014	50.778	2	1621.9304	1621.9304	K	T	248	262
PSM	ICHQIEYYFGDFNLPR	1226	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=10805	68.947	3	2080.9704	2080.9705	K	D	17	33
PSM	ICHQIEYYFGDFNLPR	1227	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:4	ms_run[2]:scan=10807	68.959	3	2070.9622	2070.9622	K	D	17	33
PSM	IECGPKYPEAPPFVR	1228	sp|Q13404-6|UB2V1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	3-UNIMOD:4	ms_run[2]:scan=6602	42.032	3	1758.8763	1758.8763	K	F	25	40
PSM	IGDEDVGRVIFGLFGK	1229	sp|P23284|PPIB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=12911	84.408	2	1720.9148	1720.9148	R	T	52	68
PSM	IGELVGVLVNHFK	1230	sp|O94832|MYO1D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:188	ms_run[2]:scan=10823	69.065	2	1429.8389	1429.8389	R	S	942	955
PSM	IHFPLATYAPVISAEK	1231	sp|Q71U36-2|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	16-UNIMOD:188	ms_run[2]:scan=9618	60.932	3	1761.9761	1761.9761	R	A	230	246
PSM	IHVSDQELQSANASVDDSRLEELK	1232	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	19-UNIMOD:267,24-UNIMOD:188	ms_run[2]:scan=7065	44.836	2	2698.3381	2694.3499	K	A	767	791
PSM	IIHEAGYSEEECKQYK	1233	sp|P63096-2|GNAI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:4,13-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=2518	17.443	3	1994.9446	1994.9447	K	A	3	19
PSM	IIHEDGYSEDECKQYK	1234	sp|P08754|GNAI3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:4	ms_run[2]:scan=2698	18.445	3	2012.8786	2012.8786	K	V	55	71
PSM	IIHEDGYSEDECKQYK	1235	sp|P08754|GNAI3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:4,13-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=2692	18.408	3	2024.9188	2024.9188	K	V	55	71
PSM	IIKDGEQHEDLNEVAK	1236	sp|O95831-5|AIFM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	3-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=2890	19.714	3	1848.962	1848.9620	K	L	239	255
PSM	ILGPQGNTIKR	1237	sp|Q07666|KHDR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=2444	17.03	2	1195.7037	1195.7037	K	L	176	187
PSM	INAGMLAQFIDKPVCFVGR	1238	sp|P35244|RFA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	15-UNIMOD:4	ms_run[2]:scan=12096	77.76	3	2135.102	2135.1020	R	L	12	31
PSM	ISLGMPVGPNAHK	1239	sp|Q13435|SF3B2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5888	37.725	2	1319.702	1319.7020	R	V	615	628
PSM	ITAAQALAHAYFAQYHDPDDEPVADPYDQSFESR	1240	sp|Q16539-2|MK14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10756	68.616	4	3837.7183	3837.7183	R	D	297	331
PSM	KFDLNSPWEAFPVYR	1241	sp|O75489|NDUS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11255	71.96	3	1867.9257	1867.9257	R	Q	232	247
PSM	KGAAPAPPGK	1242	sp|Q13428-5|TCOF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:188,10-UNIMOD:188	ms_run[2]:scan=644	6.7741	2	904.55331	904.5533	R	T	384	394
PSM	KGIVLLEELLPK	1243	sp|Q9Y3D6|FIS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=11729	75.187	2	1362.8889	1362.8889	R	G	53	65
PSM	KQFGAQANVIGPWIQTK	1244	sp|P12814-2|ACTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=8053	51.031	3	1897.0613	1897.0613	R	M	633	650
PSM	KTQNDVLHAENVK	1245	sp|P35241|RADI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=1849	13.628	3	1494.7791	1494.7791	K	A	544	557
PSM	KYEDICPSTHNMDVPNIK	1246	sp|P63241|IF5A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:188,6-UNIMOD:4,12-UNIMOD:35,18-UNIMOD:188	ms_run[2]:scan=4613	30.057	3	2188.0331	2188.0331	K	R	68	86
PSM	KYPYWPHQPIENL	1247	sp|O75947-2|ATP5H_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8202	51.97	2	1683.8409	1683.8409	K	-	125	138
PSM	LCPPGIPTPGSGLPPPR	1248	sp|P27708|PYR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:4	ms_run[2]:scan=7577	48	2	1711.908	1711.9080	R	K	378	395
PSM	LFDHPESPTPNPTEPLFLAQAEVYK	1249	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10985	70.161	2	2839.4069	2839.4069	R	E	968	993
PSM	LHGSVGGAQNLSALGALVSLSNAR	1250	sp|Q8IZL8|PELP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11129	71.116	3	2291.2346	2291.2346	R	L	75	99
PSM	LILGLMMPPAHYDAK	1251	sp|P08133-2|ANXA6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	15-UNIMOD:188	ms_run[2]:scan=9805	62.223	2	1674.8933	1674.8933	R	Q	396	411
PSM	LLIHQSLAGGIIGVK	1252	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8138	51.567	3	1517.9293	1517.9293	R	G	125	140
PSM	LLLEHLECLVSR	1253	sp|O75334-6|LIPA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	8-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=10345	65.828	2	1490.8155	1490.8155	R	H	62	74
PSM	LLLEHLECLVSR	1254	sp|O75334-6|LIPA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	8-UNIMOD:4	ms_run[2]:scan=10341	65.8	2	1480.8072	1480.8072	R	H	62	74
PSM	LMDLLGEGLKR	1255	sp|P54136-2|SYRC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7873	49.852	2	1243.6958	1243.6958	R	S	390	401
PSM	LPDGYEFKFPNR	1256	sp|P09382|LEG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7510	47.556	2	1481.7303	1481.7303	K	L	101	113
PSM	LPPKVESLESLYFTPIPAR	1257	sp|Q14980-2|NUMA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10716	68.322	3	2156.1881	2156.1881	R	S	1749	1768
PSM	LQAEIEGLKGQR	1258	sp|P05787|K2C8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4266	28.001	2	1340.7412	1340.7412	R	A	317	329
PSM	LQLEETDHQKNLLDEELQR	1259	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7214	45.776	4	2350.1765	2350.1765	R	L	2330	2349
PSM	LQMEAPHIIVGTPGR	1260	sp|P60842-2|IF4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7048	44.731	3	1617.8661	1617.8661	K	V	147	162
PSM	LSSVVTQHDSKK	1261	sp|P54577|SYYC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=968	8.5693	2	1327.7096	1327.7096	R	A	136	148
PSM	LVEALCAEHQINLIKVDDNK	1262	sp|P25398|RS12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	6-UNIMOD:4	ms_run[2]:scan=7628	48.315	3	2321.2049	2321.2049	K	K	64	84
PSM	LYGPTNFSPIINHVAR	1263	sp|O75131|CPNE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8587	54.403	3	1797.9526	1797.9526	K	F	391	407
PSM	LYKEELEQTYHAK	1264	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=3791	25.182	3	1650.8253	1650.8253	R	L	259	272
PSM	MGAGLGHGMDR	1265	sp|P52272-2|HNRPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:35	ms_run[2]:scan=1400	10.95	2	1116.4804	1116.4804	R	V	380	391
PSM	MLSLQYPDVYRDETAVQDYHGHK	1266	sp|P48147|PPCE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:1	ms_run[2]:scan=9355	59.22	3	2806.3021	2806.3021	-	I	1	24
PSM	MMITSQDVLHSWAVPTLGLK	1267	sp|P00403|COX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:35	ms_run[2]:scan=11554	73.994	2	2242.149	2242.1490	R	T	152	172
PSM	NAFMMLIHADQDR	1268	sp|P53618|COPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9114	57.72	2	1560.7177	1560.7177	R	A	192	205
PSM	NEEATKHLETSK	1269	sp|P51116|FXR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	6-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=773	7.4953	2	1397.7189	1397.7189	R	Q	212	224
PSM	NFAALEVLREEEFSPLK	1270	sp|Q3KQV9|UAP1L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11366	72.693	2	1991.0364	1991.0364	K	N	394	411
PSM	NIQDTSDLDAIAKDVFQHSQSR	1271	sp|Q9NZB2-4|F120A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10496	66.853	3	2487.199	2487.1990	R	T	292	314
PSM	NKEDQYDHLDAADMTK	1272	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=4295	28.176	3	1904.8613	1904.8613	K	V	718	734
PSM	NLNGHSIGQYR	1273	sp|P50579-3|MAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:267	ms_run[2]:scan=2872	19.601	2	1267.6297	1267.6297	R	I	304	315
PSM	NVTLQNIIDRFQK	1274	sp|O15344-2|TRI18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10583	67.414	2	1587.8733	1587.8733	R	A	76	89
PSM	PGHLQEGFGCVVTNR	1275	sp|Q8NC51-4|PAIRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:4	ms_run[2]:scan=5312	34.253	3	1669.7995	1669.7995	M	F	2	17
PSM	PHLENVVLCR	1276	sp|O43913-2|ORC5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	9-UNIMOD:4,10-UNIMOD:267	ms_run[2]:scan=5087	32.893	2	1245.6527	1245.6527	M	E	2	12
PSM	QKGDVVLQSDHVIETLTK	1277	sp|O00159-2|MYO1C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=7402	46.922	3	2021.1196	2021.1196	K	T	953	971
PSM	QKGDVVLQSDHVIETLTK	1278	sp|O00159-2|MYO1C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=7403	46.927	2	2021.1196	2021.1196	K	T	953	971
PSM	RFDEILEASDGIMVAR	1279	sp|P14618-2|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9462	59.884	3	1820.9091	1820.9091	R	G	279	295
PSM	RFGFPEGSVELYAEK	1280	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8234	52.167	3	1727.8519	1727.8519	K	V	76	91
PSM	RISGLIYEETR	1281	sp|P62805|H4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5195	33.548	2	1335.7147	1335.7147	K	G	46	57
PSM	RLAAEATEWQR	1282	sp|Q96SB4-4|SRPK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:267,11-UNIMOD:267	ms_run[2]:scan=4082	26.911	2	1349.6955	1349.6955	R	S	214	225
PSM	RLTAEDLFEAR	1283	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:267,11-UNIMOD:267	ms_run[2]:scan=7312	46.379	2	1339.6999	1339.6999	R	I	3783	3794
PSM	RPELEDSTLR	1284	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:267,10-UNIMOD:267	ms_run[2]:scan=3115	21.055	2	1234.6421	1234.6421	R	Y	651	661
PSM	RPELEDSTLR	1285	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=3124	21.111	2	1214.6255	1214.6255	R	Y	651	661
PSM	RPTELLSNPQFIVDGATR	1286	sp|P07384|CAN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8439	53.475	3	2013.0643	2013.0643	K	T	87	105
PSM	RPTELLSNPQFIVDGATR	1287	sp|P07384|CAN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:267,18-UNIMOD:267	ms_run[2]:scan=8455	53.577	3	2033.0809	2033.0809	K	T	87	105
PSM	SASASHQADIKEAR	1288	sp|Q14739|LBR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=770	7.4795	2	1469.7223	1469.7223	R	R	97	111
PSM	SGRGGNFGFGDSR	1289	sp|P22626-2|ROA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=3506	23.471	2	1312.5909	1312.5909	R	G	189	202
PSM	SKTEDHEEAGPLPTK	1290	sp|Q9BXS4|TMM59_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=1319	10.44	2	1637.7897	1637.7897	R	V	301	316
PSM	SLCIPFKPLCELQPGAK	1291	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	3-UNIMOD:4,7-UNIMOD:188,10-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=9951	63.175	2	1969.0568	1969.0568	K	C	1478	1495
PSM	SNYNFEKPFLWLAR	1292	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11369	72.715	2	1783.9046	1783.9046	K	K	153	167
PSM	SRLEQEIATYR	1293	sp|P08727|K1C19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5538	35.615	2	1364.7048	1364.7048	K	S	371	382
PSM	SSNLLDLKNPFFR	1294	sp|Q86X55-1|CARM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10693	68.158	2	1549.8253	1549.8253	K	Y	463	476
PSM	SSSSKQEQDLLHK	1295	sp|Q9BQG0|MBB1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=1592	12.179	2	1485.7423	1485.7423	R	T	862	875
PSM	TERFGQGGAGPVGGQGPR	1296	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=3060	20.738	3	1726.8499	1726.8499	R	G	664	682
PSM	THFFLNAGNLCNLNYGEGPK	1297	sp|Q9Y512|SAM50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:4	ms_run[2]:scan=9202	58.26	3	2265.0637	2265.0637	R	A	393	413
PSM	TKPSDEEMLFIYGHYK	1298	sp|P07108|ACBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:188,8-UNIMOD:35,16-UNIMOD:188	ms_run[2]:scan=6666	42.424	3	1984.9643	1984.9643	K	Q	18	34
PSM	TLGVERFEEILQEAGSR	1299	sp|P04920-2|B3A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	6-UNIMOD:267,17-UNIMOD:267	ms_run[2]:scan=11312	72.336	2	1953.007	1953.0070	R	G	27	44
PSM	TPLQGILQLGQELKPK	1300	sp|O75146|HIP1R_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11887	76.284	2	1762.0353	1762.0353	R	S	755	771
PSM	TRPVVAAGAVGLAQR	1301	sp|P11310|ACADM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4632	30.169	2	1464.8525	1464.8525	K	A	280	295
PSM	TSPPGPAPGPGLALEPPPGLASWR	1302	sp|A8MXV4|NUD19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10974	70.089	3	2321.2168	2321.2168	R	D	145	169
PSM	TTGIVMDSGDGVTHTVPIYEGYALPHAILR	1303	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10456	66.589	3	3182.607	3182.6070	R	L	148	178
PSM	TVLGTPEVLLGALPGAGGTQRLPK	1304	sp|P40939|ECHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11072	70.741	3	2344.3478	2344.3478	K	M	167	191
PSM	VAIVKPGVPMEIVLNK	1305	sp|Q9Y4L1|HYOU1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	5-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=8763	55.504	3	1718.0567	1718.0567	K	E	47	63
PSM	VAMHILNNGR	1306	sp|P49748-2|ACADV_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:267	ms_run[2]:scan=3784	25.139	2	1133.6003	1133.6003	K	F	310	320
PSM	VGNPWDPNVLYGPLHTK	1307	sp|P49419-2|AL7A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	17-UNIMOD:188	ms_run[2]:scan=9392	59.453	2	1911.9939	1911.9939	R	Q	331	348
PSM	VHIDIGADGR	1308	sp|P31942-3|HNRH3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=3867	25.621	2	1051.5411	1051.5411	R	A	174	184
PSM	VKVDPSHDASK	1309	sp|O75369-2|FLNB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=690	7.034	2	1193.6443	1193.6443	R	V	837	848
PSM	VLGPAACRNPDIFTEVANCCIR	1310	sp|Q7Z6Z7-2|HUWE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	7-UNIMOD:4,8-UNIMOD:267,19-UNIMOD:4,20-UNIMOD:4,22-UNIMOD:267	ms_run[2]:scan=9072	57.453	3	2552.2201	2552.2201	R	I	1873	1895
PSM	VPAPVTMDSFFFGCELSGHTR	1311	sp|O75607|NPM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	14-UNIMOD:4	ms_run[2]:scan=11783	75.565	3	2354.0824	2354.0824	R	S	28	49
PSM	VRELLEQISAFDNVPR	1312	sp|Q9NX58|LYAR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=9880	62.714	3	1905.0223	1905.0223	K	K	94	110
PSM	WFNGQPIHAELSPVTDFR	1313	sp|Q01081-4|U2AF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	18-UNIMOD:267	ms_run[2]:scan=9544	60.417	2	2123.0464	2123.0464	R	E	61	79
PSM	WFQQKYDGIILPGK	1314	sp|P62913-2|RL11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	5-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=8495	53.827	2	1703.9438	1703.9438	R	-	164	178
PSM	WFQQKYDGIILPGK	1315	sp|P62913-2|RL11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8485	53.764	2	1691.9035	1691.9035	R	-	164	178
PSM	YNIPHGPVVGSTR	1316	sp|P50402|EMD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:267	ms_run[2]:scan=4869	31.564	2	1405.7342	1405.7342	R	R	19	32
PSM	YNPTWHCIVGR	1317	sp|Q96FJ2|DYL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	7-UNIMOD:4,11-UNIMOD:267	ms_run[2]:scan=5942	38.051	2	1411.6695	1411.6695	K	N	50	61
PSM	QLYVLGHEAMKR	1318	sp|P22314|UBA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28	ms_run[1]:scan=7136	45.28825333333333	2	1426.7383	1426.7386	R	L	58	70
PSM	QLFHPEQLITGK	1319	sp|P68363|TBA1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28	ms_run[1]:scan=9993	63.44606166666667	2	1392.7401	1392.7396	R	E	85	97
PSM	VVCDENGSKGYGFVHFETQEAAER	1320	sp|P11940|PABP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:4,9-UNIMOD:188,24-UNIMOD:267	ms_run[1]:scan=6730	42.81080333333333	3	2745.231230	2744.247142	K	A	130	154
PSM	ISGASEKDIVHSGLAYTMER	1321	sp|P00367|DHE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	7-UNIMOD:188,20-UNIMOD:267	ms_run[1]:scan=6970	44.25940166666667	3	2179.092120	2179.091416	R	S	497	517
PSM	QSVENDIHGLRK	1322	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28	ms_run[1]:scan=4582	29.874296666666666	2	1377.6995	1377.6996	R	V	176	188
PSM	IPNIYAIGDVVAGPMLAHK	1323	sp|P09622|DLDH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	19-UNIMOD:188	ms_run[1]:scan=12014	77.1939	3	1984.080332	1984.091133	K	A	347	366
PSM	DSKCEYPAACNALETLLIHR	1324	sp|P54886|P5CS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=10723	68.373675	3	2360.127203	2360.125301	R	D	603	623
PSM	QKPGHPECDILTNVFAILSAK	1325	sp|O75691|UTP20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28,8-UNIMOD:4	ms_run[1]:scan=13509	91.30783833333334	3	2320.1815	2320.1880	K	N	1222	1243
PSM	CCNHPYLFPVAAMEAPK	1326	sp|Q14839|CHD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:4	ms_run[1]:scan=10662	67.92957833333334	2	1986.8761	1986.8785	K	M	1018	1035
PSM	LYKEELEQTYHAK	1327	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:188,13-UNIMOD:188	ms_run[1]:scan=3789	25.171533333333333	3	1663.882122	1662.865595	R	L	259	272
PSM	CTKEEAIEHNYGGHDDDLSVR	1328	sp|Q93009|UBP7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=5196	33.55302666666667	4	2427.0400	2427.0392	R	H	488	509
PSM	CTKEEAIEHNYGGHDDDLSVR	1329	sp|Q93009|UBP7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:385,1-UNIMOD:4,3-UNIMOD:188,21-UNIMOD:267	ms_run[1]:scan=5208	33.62198	3	2443.0660	2443.0676	R	H	488	509
PSM	QADVFPDRDHFGR	1330	sp|Q9HCC0|MCCB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28,8-UNIMOD:267,13-UNIMOD:267	ms_run[1]:scan=6221	39.740363333333335	2	1561.7154	1561.7172	R	T	181	194
PSM	RGPGLYYVDSEGNR	1331	sp|P28074|PSB5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:267,14-UNIMOD:267	ms_run[1]:scan=4725	30.701801666666665	2	1601.758914	1601.770107	K	I	166	180
PSM	LAGMADGLFLLR	1332	sp|P43403|ZAP70_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	12-UNIMOD:267	ms_run[1]:scan=5438	35.004466666666666	2	1286.708431	1285.709198	K	Q	26	38
PSM	VKYWIQGDSESEAHLLDSK	1333	sp|P16144|ITB4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	2-UNIMOD:188,19-UNIMOD:188	ms_run[1]:scan=7208	45.73796333333333	3	2217.117899	2216.115221	R	V	1159	1178
PSM	HQTLQGLAFPLQPEAQR	1334	sp|Q6IBS0|TWF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=8388	53.149078333333335	2	1934.013821	1933.016995	K	A	172	189
PSM	LLQSNPVLEAFGNAKTLR	1335	sp|O00159|MYO1C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=7407	46.94853	2	1970.106382	1970.094911	R	N	174	192
PSM	SLRVGPEGPMGTELGDFLR	1336	sp|Q13470|TNK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:267,10-UNIMOD:35,19-UNIMOD:267	ms_run[1]:scan=4246	27.877803333333333	2	2068.066946	2066.036963	K	E	149	168
PSM	VIECDVVKDYAFVHMEK	1337	sp|Q96PK6|RBM14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:4	ms_run[1]:scan=8044	50.97357	3	2080.980779	2080.996184	R	E	105	122
PSM	KIWCFGPDGTGPNILTDITK	1338	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:188,4-UNIMOD:4	ms_run[1]:scan=11317	72.37218	2	2238.116314	2238.145019	R	G	648	668
PSM	LEQEKELLHSQNTWLNTELK	1339	sp|P12270|TPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=8087	51.24149833333333	2	2452.262213	2452.259804	R	T	183	203
PSM	MKYILVTGGVISGIGK	1340	sp|P17812|PYRG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:35	ms_run[1]:scan=8076	51.17261333333334	2	1651.937657	1650.937865	-	G	1	17
PSM	HDADGQATLLNLLLR	1341	sp|O43242|PSMD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=12294	79.17863166666666	2	1648.883693	1648.889669	R	N	242	257