MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000208 -- new
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220618\20220618002634800212^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\111222_HL14.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220618\20220618002634800212^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\111222_HL14.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Acetyl (Protein N-term),Label:13C(6) (K),Label:13C(6)15N(4) (R),Oxidation (M)
MTD	software[1]-setting	maxMissedCleavages=1
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=40
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Label:13C(6) (K),Label:13C(6)15N(4) (R),Acetyl (Protein N-term)
MTD	software[2]-setting	TOL(-)=20
MTD	software[2]-setting	TOL(+)=20
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=1000
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=1
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Acetyl (Protein N-term),Label:13C(6) (K),Label:13C(6)15N(4) (R),Oxidation (M)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=1
MTD	software[3]-setting	peptide_mass_tolerance=20
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:1, Acetyl,]
MTD	variable_mod[1]-site	N-term
MTD	variable_mod[1]-position	Protein N-term
MTD	variable_mod[2]	[UNIMOD, UNIMOD:188, Label:13C(6),]
MTD	variable_mod[2]-site	K
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:267, Label:13C(6)15N(4),]
MTD	variable_mod[3]-site	R
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[4]-site	M
MTD	variable_mod[4]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|Q92667-2|AKAP1_HUMAN	Isoform 2 of A-kinase anchor protein 1, mitochondrial OS=Homo sapiens OX=9606 GN=AKAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	null	49-UNIMOD:267	0.03	49.0	4	1	0
PRT	sp|Q13509|TBB3_HUMAN	Tubulin beta-3 chain OS=Homo sapiens OX=9606 GN=TUBB3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	null	124-UNIMOD:4,127-UNIMOD:4,129-UNIMOD:4,122-UNIMOD:188,154-UNIMOD:188,121-UNIMOD:267	0.18	49.0	12	5	2
PRT	sp|P05387|RLA2_HUMAN	60S acidic ribosomal protein P2 OS=Homo sapiens OX=9606 GN=RPLP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	null	1-UNIMOD:35,2-UNIMOD:267,21-UNIMOD:188	0.19	49.0	2	1	0
PRT	sp|P52272-2|HNRPM_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein M OS=Homo sapiens OX=9606 GN=HNRNPM	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null	611-UNIMOD:267,637-UNIMOD:4,633-UNIMOD:188,646-UNIMOD:188	0.08	48.0	7	3	0
PRT	sp|Q92922|SMRC1_HUMAN	SWI/SNF complex subunit SMARCC1 OS=Homo sapiens OX=9606 GN=SMARCC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null		0.02	48.0	1	1	1
PRT	sp|P63244|RACK1_HUMAN	Receptor of activated protein C kinase 1 OS=Homo sapiens OX=9606 GN=RACK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null	207-UNIMOD:4,212-UNIMOD:188	0.09	48.0	3	1	0
PRT	sp|P00558-2|PGK1_HUMAN	Isoform 2 of Phosphoglycerate kinase 1 OS=Homo sapiens OX=9606 GN=PGK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null		0.11	48.0	3	2	1
PRT	sp|P14550|AK1A1_HUMAN	Aldo-keto reductase family 1 member A1 OS=Homo sapiens OX=9606 GN=AKR1A1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	46-UNIMOD:4,61-UNIMOD:188,68-UNIMOD:188	0.08	47.0	3	1	0
PRT	sp|Q92597-3|NDRG1_HUMAN	Isoform 3 of Protein NDRG1 OS=Homo sapiens OX=9606 GN=NDRG1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	307-UNIMOD:188	0.08	47.0	2	1	0
PRT	sp|Q15717|ELAV1_HUMAN	ELAV-like protein 1 OS=Homo sapiens OX=9606 GN=ELAVL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	55-UNIMOD:188,72-UNIMOD:188	0.06	46.0	3	1	0
PRT	sp|P51532-5|SMCA4_HUMAN	Isoform 5 of Transcription activator BRG1 OS=Homo sapiens OX=9606 GN=SMARCA4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.01	46.0	2	1	0
PRT	sp|P21333-2|FLNA_HUMAN	Isoform 2 of Filamin-A OS=Homo sapiens OX=9606 GN=FLNA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	760-UNIMOD:267,2532-UNIMOD:188,891-UNIMOD:188,900-UNIMOD:188,2505-UNIMOD:188	0.03	46.0	9	5	2
PRT	sp|P31040-3|SDHA_HUMAN	Isoform 3 of Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Homo sapiens OX=9606 GN=SDHA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	293-UNIMOD:4,298-UNIMOD:4,306-UNIMOD:267	0.06	46.0	2	1	0
PRT	sp|P21281|VATB2_HUMAN	V-type proton ATPase subunit B, brain isoform OS=Homo sapiens OX=9606 GN=ATP6V1B2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	425-UNIMOD:4,413-UNIMOD:188,430-UNIMOD:188,207-UNIMOD:4	0.08	46.0	4	2	1
PRT	sp|P32119|PRDX2_HUMAN	Peroxiredoxin-2 OS=Homo sapiens OX=9606 GN=PRDX2 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	46.0	null	92-UNIMOD:188,109-UNIMOD:267	0.10	46.0	5	1	0
PRT	sp|Q9BTE3-3|MCMBP_HUMAN	Isoform 3 of Mini-chromosome maintenance complex-binding protein OS=Homo sapiens OX=9606 GN=MCMBP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.04	46.0	3	1	0
PRT	sp|P51665|PSMD7_HUMAN	26S proteasome non-ATPase regulatory subunit 7 OS=Homo sapiens OX=9606 GN=PSMD7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	46.0	null	177-UNIMOD:267	0.08	46.0	3	1	0
PRT	sp|Q12929-2|EPS8_HUMAN	Isoform 2 of Epidermal growth factor receptor kinase substrate 8 OS=Homo sapiens OX=9606 GN=EPS8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.04	45.0	2	1	0
PRT	sp|Q00839-2|HNRPU_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	505-UNIMOD:188,517-UNIMOD:188,515-UNIMOD:35	0.04	45.0	7	2	1
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	499-UNIMOD:188,510-UNIMOD:267,338-UNIMOD:267	0.05	45.0	7	2	0
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	50-UNIMOD:188,61-UNIMOD:188,153-UNIMOD:35,177-UNIMOD:267,47-UNIMOD:35	0.14	45.0	19	3	1
PRT	sp|Q09666|AHNK_HUMAN	Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	5567-UNIMOD:188,5591-UNIMOD:188,1711-UNIMOD:188	0.01	45.0	3	2	1
PRT	sp|P23142-2|FBLN1_HUMAN	Isoform A of Fibulin-1 OS=Homo sapiens OX=9606 GN=FBLN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	479-UNIMOD:4,485-UNIMOD:4,494-UNIMOD:4	0.06	45.0	1	1	1
PRT	sp|P13667|PDIA4_HUMAN	Protein disulfide-isomerase A4 OS=Homo sapiens OX=9606 GN=PDIA4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	386-UNIMOD:188,391-UNIMOD:188,373-UNIMOD:35,374-UNIMOD:35	0.03	45.0	6	1	0
PRT	sp|O75083-3|WDR1_HUMAN	Isoform 2 of WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=WDR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	116-UNIMOD:188,298-UNIMOD:4,297-UNIMOD:188,330-UNIMOD:267	0.13	44.0	3	2	1
PRT	sp|P09382|LEG1_HUMAN	Galectin-1 OS=Homo sapiens OX=9606 GN=LGALS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	61-UNIMOD:4,112-UNIMOD:267,128-UNIMOD:188	0.35	44.0	5	2	0
PRT	sp|Q13098-5|CSN1_HUMAN	Isoform 4 of COP9 signalosome complex subunit 1 OS=Homo sapiens OX=9606 GN=GPS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	171-UNIMOD:4,179-UNIMOD:188	0.04	44.0	3	1	0
PRT	sp|Q9GZP4-2|PITH1_HUMAN	Isoform 2 of PITH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PITHD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	186-UNIMOD:4,198-UNIMOD:267	0.09	44.0	4	1	0
PRT	sp|P49321|NASP_HUMAN	Nuclear autoantigenic sperm protein OS=Homo sapiens OX=9606 GN=NASP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	44.0	null	708-UNIMOD:4,698-UNIMOD:188,717-UNIMOD:267	0.03	44.0	5	1	0
PRT	sp|Q9BR76|COR1B_HUMAN	Coronin-1B OS=Homo sapiens OX=9606 GN=CORO1B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.08	44.0	2	1	0
PRT	sp|P10301|RRAS_HUMAN	Ras-related protein R-Ras OS=Homo sapiens OX=9606 GN=RRAS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	174-UNIMOD:188	0.10	44.0	2	1	0
PRT	sp|P10768|ESTD_HUMAN	S-formylglutathione hydrolase OS=Homo sapiens OX=9606 GN=ESD PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	86-UNIMOD:267	0.08	44.0	4	1	0
PRT	sp|P07305-2|H10_HUMAN	Isoform 2 of Histone H1.0 OS=Homo sapiens OX=9606 GN=H1-0	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	10-UNIMOD:188,23-UNIMOD:188	0.11	44.0	3	1	0
PRT	sp|P62318-2|SMD3_HUMAN	Isoform 2 of Small nuclear ribonucleoprotein Sm D3 OS=Homo sapiens OX=9606 GN=SNRPD3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	20-UNIMOD:4,29-UNIMOD:267	0.18	44.0	3	1	0
PRT	sp|Q9HCU5|PREB_HUMAN	Prolactin regulatory element-binding protein OS=Homo sapiens OX=9606 GN=PREB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.06	43.0	1	1	1
PRT	sp|Q9BRG1|VPS25_HUMAN	Vacuolar protein-sorting-associated protein 25 OS=Homo sapiens OX=9606 GN=VPS25 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.12	43.0	2	1	0
PRT	sp|O43175|SERA_HUMAN	D-3-phosphoglycerate dehydrogenase OS=Homo sapiens OX=9606 GN=PHGDH PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	43.0	null	281-UNIMOD:4,289-UNIMOD:188	0.04	43.0	4	1	0
PRT	sp|P29218-2|IMPA1_HUMAN	Isoform 2 of Inositol monophosphatase 1 OS=Homo sapiens OX=9606 GN=IMPA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	61-UNIMOD:188,78-UNIMOD:188	0.10	43.0	1	1	0
PRT	sp|Q8N183|NDUF2_HUMAN	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 2 OS=Homo sapiens OX=9606 GN=NDUFAF2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	140-UNIMOD:188,152-UNIMOD:188	0.14	43.0	3	1	0
PRT	sp|P35580|MYH10_HUMAN	Myosin-10 OS=Homo sapiens OX=9606 GN=MYH10 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.02	43.0	4	3	2
PRT	sp|P51808|DYLT3_HUMAN	Dynein light chain Tctex-type 3 OS=Homo sapiens OX=9606 GN=DYNLT3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	8-UNIMOD:4,23-UNIMOD:188	0.16	43.0	4	1	0
PRT	sp|Q9Y5L0-5|TNPO3_HUMAN	Isoform 4 of Transportin-3 OS=Homo sapiens OX=9606 GN=TNPO3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	380-UNIMOD:4,400-UNIMOD:267,570-UNIMOD:4	0.05	43.0	5	2	1
PRT	sp|Q01082-3|SPTB2_HUMAN	Isoform 2 of Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	1640-UNIMOD:188	0.03	43.0	6	3	1
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	683-UNIMOD:188,713-UNIMOD:267	0.04	43.0	3	2	1
PRT	sp|P04075-2|ALDOA_HUMAN	Isoform 2 of Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	227-UNIMOD:267,232-UNIMOD:4	0.12	43.0	4	2	0
PRT	sp|P40925-2|MDHC_HUMAN	Isoform 2 of Malate dehydrogenase, cytoplasmic OS=Homo sapiens OX=9606 GN=MDH1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	110-UNIMOD:188	0.09	43.0	4	1	0
PRT	sp|P32322-3|P5CR1_HUMAN	Isoform 3 of Pyrroline-5-carboxylate reductase 1, mitochondrial OS=Homo sapiens OX=9606 GN=PYCR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	122-UNIMOD:4	0.11	43.0	3	2	1
PRT	sp|P62888|RL30_HUMAN	60S ribosomal protein L30 OS=Homo sapiens OX=9606 GN=RPL30 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	43.0	null	85-UNIMOD:4,87-UNIMOD:188	0.17	43.0	6	1	0
PRT	sp|P35221-2|CTNA1_HUMAN	Isoform 2 of Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	75-UNIMOD:188,78-UNIMOD:188,767-UNIMOD:4,772-UNIMOD:4	0.05	42.0	4	2	1
PRT	sp|Q8IY67-2|RAVR1_HUMAN	Isoform 2 of Ribonucleoprotein PTB-binding 1 OS=Homo sapiens OX=9606 GN=RAVER1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.03	42.0	1	1	1
PRT	sp|Q9BQA1|MEP50_HUMAN	Methylosome protein 50 OS=Homo sapiens OX=9606 GN=WDR77 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	120-UNIMOD:4,121-UNIMOD:188,145-UNIMOD:188	0.08	42.0	2	1	0
PRT	sp|P15121|ALDR_HUMAN	Aldo-keto reductase family 1 member B1 OS=Homo sapiens OX=9606 GN=AKR1B1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	45-UNIMOD:4,187-UNIMOD:4	0.13	42.0	3	2	1
PRT	sp|P35579|MYH9_HUMAN	Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	917-UNIMOD:4,569-UNIMOD:4,1209-UNIMOD:188,1210-UNIMOD:267,1370-UNIMOD:188,1371-UNIMOD:188,910-UNIMOD:188,923-UNIMOD:267	0.04	42.0	11	6	3
PRT	sp|P30405|PPIF_HUMAN	Peptidyl-prolyl cis-trans isomerase F, mitochondrial OS=Homo sapiens OX=9606 GN=PPIF PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	42.0	null	157-UNIMOD:4,160-UNIMOD:188,142-UNIMOD:35	0.14	42.0	6	1	0
PRT	sp|P06865-2|HEXA_HUMAN	Isoform 2 of Beta-hexosaminidase subunit alpha OS=Homo sapiens OX=9606 GN=HEXA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.11	42.0	1	1	1
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	1405-UNIMOD:267,1423-UNIMOD:267,992-UNIMOD:188,1118-UNIMOD:4,1127-UNIMOD:4,1131-UNIMOD:267	0.04	42.0	7	5	4
PRT	sp|P11216|PYGB_HUMAN	Glycogen phosphorylase, brain form OS=Homo sapiens OX=9606 GN=PYGB PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	496-UNIMOD:4	0.02	42.0	2	1	0
PRT	sp|Q9P2E9-3|RRBP1_HUMAN	Isoform 2 of Ribosome-binding protein 1 OS=Homo sapiens OX=9606 GN=RRBP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	500-UNIMOD:4,499-UNIMOD:188,514-UNIMOD:267	0.02	42.0	3	1	0
PRT	sp|P08133-2|ANXA6_HUMAN	Isoform 2 of Annexin A6 OS=Homo sapiens OX=9606 GN=ANXA6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	615-UNIMOD:188,631-UNIMOD:188	0.03	42.0	1	1	1
PRT	sp|P29218|IMPA1_HUMAN	Inositol monophosphatase 1 OS=Homo sapiens OX=9606 GN=IMPA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	null		0.07	42.0	1	1	0
PRT	sp|P29401|TKT_HUMAN	Transketolase OS=Homo sapiens OX=9606 GN=TKT PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	41.0	null	206-UNIMOD:4,225-UNIMOD:4,206-UNIMOD:385,226-UNIMOD:188,381-UNIMOD:267,386-UNIMOD:4,395-UNIMOD:267	0.06	41.0	7	2	1
PRT	sp|P49591|SYSC_HUMAN	Serine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=SARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.05	41.0	2	1	0
PRT	sp|P68402-3|PA1B2_HUMAN	Isoform 3 of Platelet-activating factor acetylhydrolase IB subunit beta OS=Homo sapiens OX=9606 GN=PAFAH1B2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	79-UNIMOD:267,2-UNIMOD:1	0.38	41.0	5	2	1
PRT	sp|Q6PD74-2|AAGAB_HUMAN	Isoform 2 of Alpha- and gamma-adaptin-binding protein p34 OS=Homo sapiens OX=9606 GN=AAGAB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	51-UNIMOD:188,52-UNIMOD:267	0.14	41.0	2	1	0
PRT	sp|P13995-2|MTDC_HUMAN	Isoform 2 of Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=MTHFD2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	43-UNIMOD:4	0.09	41.0	3	1	0
PRT	sp|O43396|TXNL1_HUMAN	Thioredoxin-like protein 1 OS=Homo sapiens OX=9606 GN=TXNL1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	104-UNIMOD:188,121-UNIMOD:188	0.07	41.0	2	1	0
PRT	sp|P53621|COPA_HUMAN	Coatomer subunit alpha OS=Homo sapiens OX=9606 GN=COPA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	227-UNIMOD:267	0.03	41.0	5	2	0
PRT	sp|P00568|KAD1_HUMAN	Adenylate kinase isoenzyme 1 OS=Homo sapiens OX=9606 GN=AK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	187-UNIMOD:4,172-UNIMOD:188,194-UNIMOD:188	0.12	41.0	2	1	0
PRT	sp|O00303|EIF3F_HUMAN	Eukaryotic translation initiation factor 3 subunit F OS=Homo sapiens OX=9606 GN=EIF3F PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	108-UNIMOD:267	0.04	41.0	3	1	0
PRT	sp|Q9BRP1|PDD2L_HUMAN	Programmed cell death protein 2-like OS=Homo sapiens OX=9606 GN=PDCD2L PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	80-UNIMOD:4,82-UNIMOD:4,85-UNIMOD:4,91-UNIMOD:267	0.05	41.0	2	1	0
PRT	sp|Q6P2Q9|PRP8_HUMAN	Pre-mRNA-processing-splicing factor 8 OS=Homo sapiens OX=9606 GN=PRPF8 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	861-UNIMOD:267,880-UNIMOD:267,1402-UNIMOD:267,1414-UNIMOD:267	0.02	41.0	9	3	1
PRT	sp|P40926-2|MDHM_HUMAN	Isoform 2 of Malate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=MDH2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	74-UNIMOD:188	0.08	41.0	6	1	0
PRT	sp|O43684-2|BUB3_HUMAN	Isoform 2 of Mitotic checkpoint protein BUB3 OS=Homo sapiens OX=9606 GN=BUB3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	81-UNIMOD:35,100-UNIMOD:267	0.06	41.0	3	1	0
PRT	sp|Q9UGI8-2|TES_HUMAN	Isoform 2 of Testin OS=Homo sapiens OX=9606 GN=TES	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	352-UNIMOD:4,355-UNIMOD:4,365-UNIMOD:267	0.05	41.0	3	1	0
PRT	sp|P05783|K1C18_HUMAN	Keratin, type I cytoskeletal 18 OS=Homo sapiens OX=9606 GN=KRT18 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	41.0	null		0.09	41.0	4	2	1
PRT	sp|P14618-3|KPYM_HUMAN	Isoform 3 of Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	264-UNIMOD:267,279-UNIMOD:267	0.03	41.0	1	1	1
PRT	sp|Q6UN15-4|FIP1_HUMAN	Isoform 4 of Pre-mRNA 3'-end-processing factor FIP1 OS=Homo sapiens OX=9606 GN=FIP1L1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	294-UNIMOD:267,310-UNIMOD:267	0.05	41.0	4	1	0
PRT	sp|O94832|MYO1D_HUMAN	Unconventional myosin-Id OS=Homo sapiens OX=9606 GN=MYO1D PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	41.0	null	217-UNIMOD:267,215-UNIMOD:35	0.02	41.0	3	1	0
PRT	sp|P28482|MK01_HUMAN	Mitogen-activated protein kinase 1 OS=Homo sapiens OX=9606 GN=MAPK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	191-UNIMOD:267	0.06	41.0	4	1	0
PRT	sp|Q01105-3|SET_HUMAN	Isoform 3 of Protein SET OS=Homo sapiens OX=9606 GN=SET	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.07	41.0	2	1	0
PRT	sp|Q9Y3E5|PTH2_HUMAN	Peptidyl-tRNA hydrolase 2, mitochondrial OS=Homo sapiens OX=9606 GN=PTRH2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	119-UNIMOD:188,134-UNIMOD:188	0.11	41.0	4	1	0
PRT	sp|P31939|PUR9_HUMAN	Bifunctional purine biosynthesis protein PURH OS=Homo sapiens OX=9606 GN=ATIC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null		0.03	41.0	1	1	0
PRT	sp|Q96C86|DCPS_HUMAN	m7GpppX diphosphatase OS=Homo sapiens OX=9606 GN=DCPS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	307-UNIMOD:4,310-UNIMOD:267	0.05	40.0	4	1	0
PRT	sp|Q96GK7|FAH2A_HUMAN	Fumarylacetoacetate hydrolase domain-containing protein 2A OS=Homo sapiens OX=9606 GN=FAHD2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null	194-UNIMOD:267	0.07	40.0	4	1	0
PRT	sp|Q9Y2Z0-2|SGT1_HUMAN	Isoform 2 of Protein SGT1 homolog OS=Homo sapiens OX=9606 GN=SUGT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	54-UNIMOD:4,62-UNIMOD:4,69-UNIMOD:188,70-UNIMOD:188	0.06	40.0	2	1	0
PRT	sp|Q9NX63|MIC19_HUMAN	MICOS complex subunit MIC19 OS=Homo sapiens OX=9606 GN=CHCHD3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	204-UNIMOD:4,214-UNIMOD:4,219-UNIMOD:188	0.07	40.0	2	1	0
PRT	sp|P40227|TCPZ_HUMAN	T-complex protein 1 subunit zeta OS=Homo sapiens OX=9606 GN=CCT6A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	79-UNIMOD:188,67-UNIMOD:35	0.04	40.0	5	1	0
PRT	sp|Q9Y230-2|RUVB2_HUMAN	Isoform 2 of RuvB-like 2 OS=Homo sapiens OX=9606 GN=RUVBL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	208-UNIMOD:267	0.04	40.0	4	1	0
PRT	sp|P05198|IF2A_HUMAN	Eukaryotic translation initiation factor 2 subunit 1 OS=Homo sapiens OX=9606 GN=EIF2S1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	123-UNIMOD:188,133-UNIMOD:267	0.07	40.0	3	1	0
PRT	sp|Q86U86-6|PB1_HUMAN	Isoform 6 of Protein polybromo-1 OS=Homo sapiens OX=9606 GN=PBRM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.02	40.0	1	1	1
PRT	sp|Q3ZCM7|TBB8_HUMAN	Tubulin beta-8 chain OS=Homo sapiens OX=9606 GN=TUBB8 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	127-UNIMOD:4,129-UNIMOD:4	0.08	40.0	1	1	1
PRT	sp|P17812-2|PYRG1_HUMAN	Isoform 2 of CTP synthase 1 OS=Homo sapiens OX=9606 GN=CTPS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	131-UNIMOD:4,145-UNIMOD:267	0.05	40.0	3	1	0
PRT	sp|P07919|QCR6_HUMAN	Cytochrome b-c1 complex subunit 6, mitochondrial OS=Homo sapiens OX=9606 GN=UQCRH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	67-UNIMOD:4,78-UNIMOD:267	0.21	40.0	5	1	0
PRT	sp|Q9UHJ6|SHPK_HUMAN	Sedoheptulokinase OS=Homo sapiens OX=9606 GN=SHPK PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	239-UNIMOD:267	0.05	40.0	3	1	0
PRT	sp|Q9NYL9|TMOD3_HUMAN	Tropomodulin-3 OS=Homo sapiens OX=9606 GN=TMOD3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	194-UNIMOD:188,209-UNIMOD:188	0.05	40.0	1	1	1
PRT	sp|P61221|ABCE1_HUMAN	ATP-binding cassette sub-family E member 1 OS=Homo sapiens OX=9606 GN=ABCE1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	201-UNIMOD:4	0.03	40.0	2	1	0
PRT	sp|Q9Y6C9|MTCH2_HUMAN	Mitochondrial carrier homolog 2 OS=Homo sapiens OX=9606 GN=MTCH2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	100-UNIMOD:188,111-UNIMOD:188	0.07	40.0	3	1	0
PRT	sp|P62937|PPIA_HUMAN	Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	40.0	null	100-UNIMOD:35,115-UNIMOD:4,118-UNIMOD:188,82-UNIMOD:188,91-UNIMOD:188,28-UNIMOD:188,31-UNIMOD:188	0.34	40.0	13	3	0
PRT	sp|O43660-2|PLRG1_HUMAN	Isoform 2 of Pleiotropic regulator 1 OS=Homo sapiens OX=9606 GN=PLRG1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	328-UNIMOD:267	0.04	39.0	3	1	0
PRT	sp|Q14498-3|RBM39_HUMAN	Isoform 3 of RNA-binding protein 39 OS=Homo sapiens OX=9606 GN=RBM39	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	456-UNIMOD:4,472-UNIMOD:267	0.04	39.0	4	1	0
PRT	sp|Q16762|THTR_HUMAN	Thiosulfate sulfurtransferase OS=Homo sapiens OX=9606 GN=TST PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.06	39.0	1	1	1
PRT	sp|O94925-2|GLSK_HUMAN	Isoform 2 of Glutaminase kidney isoform, mitochondrial OS=Homo sapiens OX=9606 GN=GLS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	106-UNIMOD:188	0.13	39.0	3	1	0
PRT	sp|P48643-2|TCPE_HUMAN	Isoform 2 of T-complex protein 1 subunit epsilon OS=Homo sapiens OX=9606 GN=CCT5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	160-UNIMOD:4,166-UNIMOD:188,168-UNIMOD:188	0.07	39.0	3	2	0
PRT	sp|Q13310-2|PABP4_HUMAN	Isoform 2 of Polyadenylate-binding protein 4 OS=Homo sapiens OX=9606 GN=PABPC4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	153-UNIMOD:188,157-UNIMOD:188	0.03	39.0	4	1	0
PRT	sp|P09960|LKHA4_HUMAN	Leukotriene A-4 hydrolase OS=Homo sapiens OX=9606 GN=LTA4H PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	355-UNIMOD:188	0.05	39.0	5	2	0
PRT	sp|P52948-6|NUP98_HUMAN	Isoform 6 of Nuclear pore complex protein Nup98-Nup96 OS=Homo sapiens OX=9606 GN=NUP98	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	1608-UNIMOD:4,1619-UNIMOD:188	0.01	39.0	2	1	0
PRT	sp|P68363-2|TBA1B_HUMAN	Isoform 2 of Tubulin alpha-1B chain OS=Homo sapiens OX=9606 GN=TUBA1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	164-UNIMOD:188	0.05	39.0	10	1	0
PRT	sp|Q8WUM0|NU133_HUMAN	Nuclear pore complex protein Nup133 OS=Homo sapiens OX=9606 GN=NUP133 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	35-UNIMOD:188,54-UNIMOD:267	0.02	39.0	2	1	0
PRT	sp|Q00610-2|CLH1_HUMAN	Isoform 2 of Clathrin heavy chain 1 OS=Homo sapiens OX=9606 GN=CLTC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	189-UNIMOD:188,205-UNIMOD:188,870-UNIMOD:4,881-UNIMOD:188,245-UNIMOD:188	0.05	39.0	10	5	2
PRT	sp|Q9H307|PININ_HUMAN	Pinin OS=Homo sapiens OX=9606 GN=PNN PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	212-UNIMOD:188,228-UNIMOD:188	0.03	39.0	2	1	0
PRT	sp|Q92598-2|HS105_HUMAN	Isoform Beta of Heat shock protein 105 kDa OS=Homo sapiens OX=9606 GN=HSPH1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.02	39.0	2	1	0
PRT	sp|Q5QJE6|TDIF2_HUMAN	Deoxynucleotidyltransferase terminal-interacting protein 2 OS=Homo sapiens OX=9606 GN=DNTTIP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.03	39.0	1	1	1
PRT	sp|Q7Z6Z7-2|HUWE1_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens OX=9606 GN=HUWE1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	4325-UNIMOD:4,4318-UNIMOD:267,4339-UNIMOD:188	0.01	39.0	3	1	0
PRT	sp|Q92900-2|RENT1_HUMAN	Isoform 2 of Regulator of nonsense transcripts 1 OS=Homo sapiens OX=9606 GN=UPF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.02	39.0	2	1	0
PRT	sp|O60506-4|HNRPQ_HUMAN	Isoform 4 of Heterogeneous nuclear ribonucleoprotein Q OS=Homo sapiens OX=9606 GN=SYNCRIP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.04	39.0	1	1	1
PRT	sp|P80303|NUCB2_HUMAN	Nucleobindin-2 OS=Homo sapiens OX=9606 GN=NUCB2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	null	378-UNIMOD:28,386-UNIMOD:188,399-UNIMOD:188	0.05	39.0	2	1	0
PRT	sp|O75489|NDUS3_HUMAN	NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFS3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null		0.06	39.0	1	1	1
PRT	sp|P31939-2|PUR9_HUMAN	Isoform 2 of Bifunctional purine biosynthesis protein PURH OS=Homo sapiens OX=9606 GN=ATIC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	193-UNIMOD:267,194-UNIMOD:188	0.03	38.0	2	1	0
PRT	sp|Q53H96-2|P5CR3_HUMAN	Isoform 2 of Pyrroline-5-carboxylate reductase 3 OS=Homo sapiens OX=9606 GN=PYCR3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.07	38.0	1	1	1
PRT	sp|P09211|GSTP1_HUMAN	Glutathione S-transferase P OS=Homo sapiens OX=9606 GN=GSTP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	128-UNIMOD:188,141-UNIMOD:188	0.10	38.0	2	1	0
PRT	sp|P06733|ENOA_HUMAN	Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	71-UNIMOD:188,80-UNIMOD:188,64-UNIMOD:188	0.05	38.0	4	2	0
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	492-UNIMOD:267	0.03	38.0	4	1	0
PRT	sp|Q14204|DYHC1_HUMAN	Cytoplasmic dynein 1 heavy chain 1 OS=Homo sapiens OX=9606 GN=DYNC1H1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null	3147-UNIMOD:4,671-UNIMOD:188,681-UNIMOD:188,3160-UNIMOD:267,736-UNIMOD:188,748-UNIMOD:188	0.02	38.0	8	5	2
PRT	sp|P09651-3|ROA1_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	161-UNIMOD:188,166-UNIMOD:188	0.15	38.0	6	2	0
PRT	sp|P51991-2|ROA3_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens OX=9606 GN=HNRNPA3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	160-UNIMOD:188,165-UNIMOD:188	0.06	38.0	4	1	0
PRT	sp|P18621-2|RL17_HUMAN	Isoform 2 of 60S ribosomal protein L17 OS=Homo sapiens OX=9606 GN=RPL17	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	83-UNIMOD:188,86-UNIMOD:188	0.14	38.0	4	1	0
PRT	sp|O60313-13|OPA1_HUMAN	Isoform 7 of Dynamin-like 120 kDa protein, mitochondrial OS=Homo sapiens OX=9606 GN=OPA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.02	38.0	1	1	1
PRT	sp|P42167|LAP2B_HUMAN	Lamina-associated polypeptide 2, isoforms beta/gamma OS=Homo sapiens OX=9606 GN=TMPO PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	319-UNIMOD:267	0.04	38.0	3	1	0
PRT	sp|Q8IY81|SPB1_HUMAN	pre-rRNA 2'-O-ribose RNA methyltransferase FTSJ3 OS=Homo sapiens OX=9606 GN=FTSJ3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	197-UNIMOD:4,205-UNIMOD:188,209-UNIMOD:188	0.03	38.0	4	1	0
PRT	sp|P31930|QCR1_HUMAN	Cytochrome b-c1 complex subunit 1, mitochondrial OS=Homo sapiens OX=9606 GN=UQCRC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	268-UNIMOD:4,423-UNIMOD:267,432-UNIMOD:267	0.10	38.0	4	3	2
PRT	sp|O14497-3|ARI1A_HUMAN	Isoform 3 of AT-rich interactive domain-containing protein 1A OS=Homo sapiens OX=9606 GN=ARID1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	1479-UNIMOD:188	0.01	38.0	2	1	0
PRT	sp|Q6I9Y2|THOC7_HUMAN	THO complex subunit 7 homolog OS=Homo sapiens OX=9606 GN=THOC7 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	90-UNIMOD:4,86-UNIMOD:188,98-UNIMOD:188	0.08	38.0	3	1	0
PRT	sp|Q96EY1-2|DNJA3_HUMAN	Isoform 2 of DnaJ homolog subfamily A member 3, mitochondrial OS=Homo sapiens OX=9606 GN=DNAJA3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.06	38.0	1	1	1
PRT	sp|P50395-2|GDIB_HUMAN	Isoform 2 of Rab GDP dissociation inhibitor beta OS=Homo sapiens OX=9606 GN=GDI2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	284-UNIMOD:188,290-UNIMOD:4,303-UNIMOD:188	0.05	38.0	3	1	0
PRT	sp|P11142-2|HSP7C_HUMAN	Isoform 2 of Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	237-UNIMOD:35,301-UNIMOD:267,311-UNIMOD:267	0.09	38.0	4	3	2
PRT	sp|Q9P2I0|CPSF2_HUMAN	Cleavage and polyadenylation specificity factor subunit 2 OS=Homo sapiens OX=9606 GN=CPSF2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	609-UNIMOD:267	0.02	38.0	1	1	1
PRT	sp|P42330|AK1C3_HUMAN	Aldo-keto reductase family 1 member C3 OS=Homo sapiens OX=9606 GN=AKR1C3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.07	38.0	1	1	1
PRT	sp|P09874|PARP1_HUMAN	Poly [ADP-ribose] polymerase 1 OS=Homo sapiens OX=9606 GN=PARP1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null	838-UNIMOD:188,621-UNIMOD:188,629-UNIMOD:188	0.03	38.0	5	2	1
PRT	sp|O43242-2|PSMD3_HUMAN	Isoform 2 of 26S proteasome non-ATPase regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PSMD3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	131-UNIMOD:188,135-UNIMOD:188,118-UNIMOD:267	0.09	38.0	3	2	1
PRT	sp|P09234|RU1C_HUMAN	U1 small nuclear ribonucleoprotein C OS=Homo sapiens OX=9606 GN=SNRPC PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	6-UNIMOD:4,9-UNIMOD:4	0.13	38.0	2	1	0
PRT	sp|O94903|PLPHP_HUMAN	Pyridoxal phosphate homeostasis protein OS=Homo sapiens OX=9606 GN=PLPBP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.06	38.0	2	1	0
PRT	sp|P62191-2|PRS4_HUMAN	Isoform 2 of 26S proteasome regulatory subunit 4 OS=Homo sapiens OX=9606 GN=PSMC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.06	38.0	2	1	0
PRT	sp|Q15365|PCBP1_HUMAN	Poly(rC)-binding protein 1 OS=Homo sapiens OX=9606 GN=PCBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	null	201-UNIMOD:385,201-UNIMOD:4,237-UNIMOD:188	0.11	38.0	2	1	0
PRT	sp|Q96FQ6|S10AG_HUMAN	Protein S100-A16 OS=Homo sapiens OX=9606 GN=S100A16 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.17	37.0	2	1	0
PRT	sp|Q9Y6H1|CHCH2_HUMAN	Coiled-coil-helix-coiled-coil-helix domain-containing protein 2 OS=Homo sapiens OX=9606 GN=CHCHD2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	27-UNIMOD:267,51-UNIMOD:267	0.19	37.0	3	1	0
PRT	sp|P22102|PUR2_HUMAN	Trifunctional purine biosynthetic protein adenosine-3 OS=Homo sapiens OX=9606 GN=GART PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	692-UNIMOD:267	0.02	37.0	2	1	0
PRT	sp|O43707|ACTN4_HUMAN	Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	37.0	null	432-UNIMOD:188,435-UNIMOD:35,437-UNIMOD:188,522-UNIMOD:28,535-UNIMOD:188,536-UNIMOD:267,652-UNIMOD:267,668-UNIMOD:188,258-UNIMOD:35,273-UNIMOD:188,280-UNIMOD:267	0.08	37.0	16	4	0
PRT	sp|P62633-7|CNBP_HUMAN	Isoform 7 of Cellular nucleic acid-binding protein OS=Homo sapiens OX=9606 GN=CNBP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	102-UNIMOD:4,105-UNIMOD:4,113-UNIMOD:188,115-UNIMOD:4,117-UNIMOD:188	0.11	37.0	2	1	0
PRT	sp|Q14839|CHD4_HUMAN	Chromodomain-helicase-DNA-binding protein 4 OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	1827-UNIMOD:4,1837-UNIMOD:188	0.01	37.0	2	1	0
PRT	sp|P52907|CAZA1_HUMAN	F-actin-capping protein subunit alpha-1 OS=Homo sapiens OX=9606 GN=CAPZA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	37-UNIMOD:267	0.07	37.0	3	1	0
PRT	sp|O43681|ASNA_HUMAN	ATPase ASNA1 OS=Homo sapiens OX=9606 GN=ASNA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.07	37.0	1	1	1
PRT	sp|Q9UJV9|DDX41_HUMAN	Probable ATP-dependent RNA helicase DDX41 OS=Homo sapiens OX=9606 GN=DDX41 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.03	37.0	1	1	1
PRT	sp|P23528|COF1_HUMAN	Cofilin-1 OS=Homo sapiens OX=9606 GN=CFL1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	139-UNIMOD:4	0.09	37.0	2	1	0
PRT	sp|P25788-2|PSA3_HUMAN	Isoform 2 of Proteasome subunit alpha type-3 OS=Homo sapiens OX=9606 GN=PSMA3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	86-UNIMOD:267	0.11	37.0	3	2	1
PRT	sp|Q16576|RBBP7_HUMAN	Histone-binding protein RBBP7 OS=Homo sapiens OX=9606 GN=RBBP7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	116-UNIMOD:4,119-UNIMOD:188,128-UNIMOD:267	0.04	37.0	2	1	0
PRT	sp|P47755|CAZA2_HUMAN	F-actin-capping protein subunit alpha-2 OS=Homo sapiens OX=9606 GN=CAPZA2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.06	37.0	2	1	0
PRT	sp|Q9P013|CWC15_HUMAN	Spliceosome-associated protein CWC15 homolog OS=Homo sapiens OX=9606 GN=CWC15 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.12	37.0	1	1	1
PRT	sp|Q8TCG1-2|CIP2A_HUMAN	Isoform 2 of Protein CIP2A OS=Homo sapiens OX=9606 GN=CIP2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.02	37.0	1	1	1
PRT	sp|O95831-5|AIFM1_HUMAN	Isoform 5 of Apoptosis-inducing factor 1, mitochondrial OS=Homo sapiens OX=9606 GN=AIFM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.08	37.0	1	1	1
PRT	sp|Q9GZV4|IF5A2_HUMAN	Eukaryotic translation initiation factor 5A-2 OS=Homo sapiens OX=9606 GN=EIF5A2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	73-UNIMOD:4,68-UNIMOD:188,85-UNIMOD:188,67-UNIMOD:188	0.21	37.0	7	3	1
PRT	sp|Q15428|SF3A2_HUMAN	Splicing factor 3A subunit 2 OS=Homo sapiens OX=9606 GN=SF3A2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	59-UNIMOD:4	0.04	37.0	2	1	0
PRT	sp|P61978-3|HNRPK_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	139-UNIMOD:188	0.08	37.0	4	2	0
PRT	sp|Q9UBX3|DIC_HUMAN	Mitochondrial dicarboxylate carrier OS=Homo sapiens OX=9606 GN=SLC25A10 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	240-UNIMOD:4,231-UNIMOD:188,246-UNIMOD:188	0.07	37.0	3	1	0
PRT	sp|P21796|VDAC1_HUMAN	Voltage-dependent anion-selective channel protein 1 OS=Homo sapiens OX=9606 GN=VDAC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	266-UNIMOD:188,274-UNIMOD:188	0.07	37.0	1	1	1
PRT	sp|P50897|PPT1_HUMAN	Palmitoyl-protein thioesterase 1 OS=Homo sapiens OX=9606 GN=PPT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.06	37.0	2	1	0
PRT	sp|P46782|RS5_HUMAN	40S ribosomal protein S5 OS=Homo sapiens OX=9606 GN=RPS5 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	155-UNIMOD:4,146-UNIMOD:267,159-UNIMOD:267	0.07	37.0	2	1	0
PRT	sp|O14618|CCS_HUMAN	Copper chaperone for superoxide dismutase OS=Homo sapiens OX=9606 GN=CCS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.08	37.0	1	1	1
PRT	sp|O15143|ARC1B_HUMAN	Actin-related protein 2/3 complex subunit 1B OS=Homo sapiens OX=9606 GN=ARPC1B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	26-UNIMOD:4,37-UNIMOD:188	0.05	37.0	2	1	0
PRT	sp|P18124|RL7_HUMAN	60S ribosomal protein L7 OS=Homo sapiens OX=9606 GN=RPL7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	202-UNIMOD:188,212-UNIMOD:188,236-UNIMOD:267,242-UNIMOD:267	0.13	37.0	4	2	0
PRT	sp|P43007-2|SATT_HUMAN	Isoform 2 of Neutral amino acid transporter A OS=Homo sapiens OX=9606 GN=SLC1A4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	182-UNIMOD:188	0.10	37.0	1	1	1
PRT	sp|Q99880|H2B1L_HUMAN	Histone H2B type 1-L OS=Homo sapiens OX=9606 GN=H2BC13 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	47-UNIMOD:188,58-UNIMOD:188	0.12	37.0	2	1	0
PRT	sp|Q15257|PTPA_HUMAN	Serine/threonine-protein phosphatase 2A activator OS=Homo sapiens OX=9606 GN=PTPA PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	81-UNIMOD:188,86-UNIMOD:188	0.05	37.0	1	1	1
PRT	sp|Q13526|PIN1_HUMAN	Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 OS=Homo sapiens OX=9606 GN=PIN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.16	37.0	2	1	0
PRT	sp|P05787|K2C8_HUMAN	Keratin, type II cytoskeletal 8 OS=Homo sapiens OX=9606 GN=KRT8 PE=1 SV=7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	37.0	null	409-UNIMOD:35,406-UNIMOD:35,264-UNIMOD:188	0.16	37.0	9	5	3
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	37.0	null	387-UNIMOD:188,389-UNIMOD:188	0.03	37.0	3	1	0
PRT	sp|Q71U36|TBA1A_HUMAN	Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	null	85-UNIMOD:28	0.05	37.0	2	1	0
PRT	sp|P07237|PDIA1_HUMAN	Protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	37.0	null	425-UNIMOD:35,436-UNIMOD:188,444-UNIMOD:188,415-UNIMOD:188,424-UNIMOD:188	0.07	37.0	9	2	0
PRT	sp|Q15424|SAFB1_HUMAN	Scaffold attachment factor B1 OS=Homo sapiens OX=9606 GN=SAFB PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	253-UNIMOD:188,285-UNIMOD:188	0.04	37.0	1	1	0
PRT	sp|Q96FW1|OTUB1_HUMAN	Ubiquitin thioesterase OTUB1 OS=Homo sapiens OX=9606 GN=OTUB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	109-UNIMOD:188,198-UNIMOD:267	0.10	36.0	5	2	0
PRT	sp|Q9P258|RCC2_HUMAN	Protein RCC2 OS=Homo sapiens OX=9606 GN=RCC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	337-UNIMOD:4	0.12	36.0	4	4	4
PRT	sp|P43243|MATR3_HUMAN	Matrin-3 OS=Homo sapiens OX=9606 GN=MATR3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	192-UNIMOD:267,207-UNIMOD:267	0.03	36.0	3	1	0
PRT	sp|P53396|ACLY_HUMAN	ATP-citrate synthase OS=Homo sapiens OX=9606 GN=ACLY PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	148-UNIMOD:188	0.02	36.0	2	1	0
PRT	sp|O95347-2|SMC2_HUMAN	Isoform 2 of Structural maintenance of chromosomes protein 2 OS=Homo sapiens OX=9606 GN=SMC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	837-UNIMOD:188,848-UNIMOD:188	0.02	36.0	2	1	0
PRT	sp|Q16891-3|MIC60_HUMAN	Isoform 3 of MICOS complex subunit MIC60 OS=Homo sapiens OX=9606 GN=IMMT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	289-UNIMOD:188,298-UNIMOD:188,395-UNIMOD:188,404-UNIMOD:188	0.04	36.0	3	2	1
PRT	sp|P09327|VILI_HUMAN	Villin-1 OS=Homo sapiens OX=9606 GN=VIL1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	285-UNIMOD:4	0.07	36.0	4	3	2
PRT	sp|Q8NC51-2|PAIRB_HUMAN	Isoform 2 of Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.05	36.0	2	1	0
PRT	sp|P00390-5|GSHR_HUMAN	Isoform 4 of Glutathione reductase, mitochondrial OS=Homo sapiens OX=9606 GN=GSR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	181-UNIMOD:188,189-UNIMOD:188	0.04	36.0	3	1	0
PRT	sp|P62826|RAN_HUMAN	GTP-binding nuclear protein Ran OS=Homo sapiens OX=9606 GN=RAN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.14	36.0	3	2	1
PRT	sp|Q15149|PLEC_HUMAN	Plectin OS=Homo sapiens OX=9606 GN=PLEC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	3968-UNIMOD:188,3981-UNIMOD:267,3446-UNIMOD:267,3462-UNIMOD:267	0.01	36.0	4	2	1
PRT	sp|Q86UE4|LYRIC_HUMAN	Protein LYRIC OS=Homo sapiens OX=9606 GN=MTDH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.03	36.0	1	1	1
PRT	sp|Q96C36|P5CR2_HUMAN	Pyrroline-5-carboxylate reductase 2 OS=Homo sapiens OX=9606 GN=PYCR2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	95-UNIMOD:4,106-UNIMOD:188,107-UNIMOD:188	0.06	36.0	3	1	0
PRT	sp|O75153|CLU_HUMAN	Clustered mitochondria protein homolog OS=Homo sapiens OX=9606 GN=CLUH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	546-UNIMOD:4,551-UNIMOD:4,539-UNIMOD:267,552-UNIMOD:188	0.03	36.0	4	2	1
PRT	sp|P42345|MTOR_HUMAN	Serine/threonine-protein kinase mTOR OS=Homo sapiens OX=9606 GN=MTOR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.01	36.0	1	1	1
PRT	sp|P23284|PPIB_HUMAN	Peptidyl-prolyl cis-trans isomerase B OS=Homo sapiens OX=9606 GN=PPIB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	145-UNIMOD:188,140-UNIMOD:35	0.07	36.0	3	1	0
PRT	sp|Q8NBS9-2|TXND5_HUMAN	Isoform 2 of Thioredoxin domain-containing protein 5 OS=Homo sapiens OX=9606 GN=TXNDC5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	139-UNIMOD:4,146-UNIMOD:4	0.06	36.0	2	1	0
PRT	sp|Q04637-6|IF4G1_HUMAN	Isoform E of Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	397-UNIMOD:188,401-UNIMOD:188	0.01	36.0	3	1	0
PRT	sp|Q96ME7-2|ZN512_HUMAN	Isoform 2 of Zinc finger protein 512 OS=Homo sapiens OX=9606 GN=ZNF512	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.04	36.0	1	1	1
PRT	sp|P16435|NCPR_HUMAN	NADPH--cytochrome P450 reductase OS=Homo sapiens OX=9606 GN=POR PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.04	36.0	2	1	0
PRT	sp|Q92879-5|CELF1_HUMAN	Isoform 5 of CUGBP Elav-like family member 1 OS=Homo sapiens OX=9606 GN=CELF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	53-UNIMOD:188,66-UNIMOD:188	0.03	36.0	3	1	0
PRT	sp|P41567|EIF1_HUMAN	Eukaryotic translation initiation factor 1 OS=Homo sapiens OX=9606 GN=EIF1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	69-UNIMOD:4	0.23	36.0	1	1	1
PRT	sp|Q8N335|GPD1L_HUMAN	Glycerol-3-phosphate dehydrogenase 1-like protein OS=Homo sapiens OX=9606 GN=GPD1L PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	51-UNIMOD:188,64-UNIMOD:188	0.04	36.0	2	1	0
PRT	sp|Q969G9|NKD1_HUMAN	Protein naked cuticle homolog 1 OS=Homo sapiens OX=9606 GN=NKD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	244-UNIMOD:4,248-UNIMOD:4	0.04	36.0	2	1	0
PRT	sp|P36578|RL4_HUMAN	60S ribosomal protein L4 OS=Homo sapiens OX=9606 GN=RPL4 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.06	36.0	3	1	0
PRT	sp|Q01813-2|PFKAP_HUMAN	Isoform 2 of ATP-dependent 6-phosphofructokinase, platelet type OS=Homo sapiens OX=9606 GN=PFKP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	675-UNIMOD:267	0.02	36.0	2	1	0
PRT	sp|P35658-2|NU214_HUMAN	Isoform 2 of Nuclear pore complex protein Nup214 OS=Homo sapiens OX=9606 GN=NUP214	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	1026-UNIMOD:188	0.01	36.0	2	1	0
PRT	sp|P31948-2|STIP1_HUMAN	Isoform 2 of Stress-induced-phosphoprotein 1 OS=Homo sapiens OX=9606 GN=STIP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	147-UNIMOD:188,156-UNIMOD:188,170-UNIMOD:188,183-UNIMOD:188	0.05	36.0	3	2	1
PRT	sp|P04080|CYTB_HUMAN	Cystatin-B OS=Homo sapiens OX=9606 GN=CSTB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	78-UNIMOD:188,89-UNIMOD:188	0.22	36.0	3	1	0
PRT	sp|P39687|AN32A_HUMAN	Acidic leucine-rich nuclear phosphoprotein 32 family member A OS=Homo sapiens OX=9606 GN=ANP32A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	87-UNIMOD:4,86-UNIMOD:188,99-UNIMOD:188	0.10	36.0	3	1	0
PRT	sp|Q9H6Y2-2|WDR55_HUMAN	Isoform 2 of WD repeat-containing protein 55 OS=Homo sapiens OX=9606 GN=WDR55	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	88-UNIMOD:4,90-UNIMOD:267	0.15	36.0	1	1	1
PRT	sp|Q99623|PHB2_HUMAN	Prohibitin-2 OS=Homo sapiens OX=9606 GN=PHB2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	71-UNIMOD:267	0.06	36.0	1	1	1
PRT	sp|Q9H6F5|CCD86_HUMAN	Coiled-coil domain-containing protein 86 OS=Homo sapiens OX=9606 GN=CCDC86 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	36.0	null	197-UNIMOD:188,212-UNIMOD:188	0.06	36.0	4	1	0
PRT	sp|Q92499-3|DDX1_HUMAN	Isoform 3 of ATP-dependent RNA helicase DDX1 OS=Homo sapiens OX=9606 GN=DDX1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.04	35.0	1	1	1
PRT	sp|Q15059-2|BRD3_HUMAN	Isoform 2 of Bromodomain-containing protein 3 OS=Homo sapiens OX=9606 GN=BRD3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.06	35.0	2	2	2
PRT	sp|P60842-2|IF4A1_HUMAN	Isoform 2 of Eukaryotic initiation factor 4A-I OS=Homo sapiens OX=9606 GN=EIF4A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	161-UNIMOD:267	0.10	35.0	4	2	0
PRT	sp|P31483-2|TIA1_HUMAN	Isoform Short of Nucleolysin TIA-1 isoform p40 OS=Homo sapiens OX=9606 GN=TIA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	112-UNIMOD:188	0.06	35.0	3	1	0
PRT	sp|Q9H3Z4-2|DNJC5_HUMAN	Isoform 2 of DnaJ homolog subfamily C member 5 OS=Homo sapiens OX=9606 GN=DNAJC5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.10	35.0	1	1	1
PRT	sp|Q71RC2-7|LARP4_HUMAN	Isoform 7 of La-related protein 4 OS=Homo sapiens OX=9606 GN=LARP4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	428-UNIMOD:188	0.04	35.0	2	1	0
PRT	sp|Q13057|COASY_HUMAN	Bifunctional coenzyme A synthase OS=Homo sapiens OX=9606 GN=COASY PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.03	35.0	2	1	0
PRT	sp|Q5H9R7-3|PP6R3_HUMAN	Isoform 3 of Serine/threonine-protein phosphatase 6 regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PPP6R3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	416-UNIMOD:4	0.03	35.0	2	1	0
PRT	sp|P33993-2|MCM7_HUMAN	Isoform 2 of DNA replication licensing factor MCM7 OS=Homo sapiens OX=9606 GN=MCM7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	282-UNIMOD:267	0.05	35.0	2	1	0
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	648-UNIMOD:188,651-UNIMOD:4,667-UNIMOD:188	0.04	35.0	5	2	1
PRT	sp|P23526-2|SAHH_HUMAN	Isoform 2 of Adenosylhomocysteinase OS=Homo sapiens OX=9606 GN=AHCY	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	361-UNIMOD:188,373-UNIMOD:188,307-UNIMOD:267,315-UNIMOD:267	0.06	35.0	4	2	0
PRT	sp|P30419-2|NMT1_HUMAN	Isoform Short of Glycylpeptide N-tetradecanoyltransferase 1 OS=Homo sapiens OX=9606 GN=NMT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.05	35.0	2	1	0
PRT	sp|Q8TC12-2|RDH11_HUMAN	Isoform 2 of Retinol dehydrogenase 11 OS=Homo sapiens OX=9606 GN=RDH11	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.08	35.0	1	1	1
PRT	sp|Q9BT09|CNPY3_HUMAN	Protein canopy homolog 3 OS=Homo sapiens OX=9606 GN=CNPY3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	194-UNIMOD:4	0.07	35.0	1	1	1
PRT	sp|Q9H8W4|PKHF2_HUMAN	Pleckstrin homology domain-containing family F member 2 OS=Homo sapiens OX=9606 GN=PLEKHF2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	14-UNIMOD:267,21-UNIMOD:4,34-UNIMOD:267	0.09	35.0	1	1	1
PRT	sp|Q9UHQ4|BAP29_HUMAN	B-cell receptor-associated protein 29 OS=Homo sapiens OX=9606 GN=BCAP29 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	171-UNIMOD:4,167-UNIMOD:188,178-UNIMOD:188	0.07	35.0	4	1	0
PRT	sp|Q13769|THOC5_HUMAN	THO complex subunit 5 homolog OS=Homo sapiens OX=9606 GN=THOC5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	153-UNIMOD:188,167-UNIMOD:188	0.02	35.0	2	1	0
PRT	sp|Q86YS7|C2CD5_HUMAN	C2 domain-containing protein 5 OS=Homo sapiens OX=9606 GN=C2CD5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	1	1	1
PRT	sp|P48681|NEST_HUMAN	Nestin OS=Homo sapiens OX=9606 GN=NES PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	157-UNIMOD:4	0.01	35.0	2	1	0
PRT	sp|P04406|G3P_HUMAN	Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	139-UNIMOD:188,145-UNIMOD:188,175-UNIMOD:35	0.16	35.0	3	2	1
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	178-UNIMOD:4,200-UNIMOD:188,201-UNIMOD:267	0.13	35.0	6	2	0
PRT	sp|P48643|TCPE_HUMAN	T-complex protein 1 subunit epsilon OS=Homo sapiens OX=9606 GN=CCT5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	502-UNIMOD:188,513-UNIMOD:188	0.03	35.0	1	1	0
PRT	sp|Q99615|DNJC7_HUMAN	DnaJ homolog subfamily C member 7 OS=Homo sapiens OX=9606 GN=DNAJC7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null		0.03	35.0	1	1	0
PRT	sp|P50454|SERPH_HUMAN	Serpin H1 OS=Homo sapiens OX=9606 GN=SERPINH1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	103-UNIMOD:267,116-UNIMOD:267	0.06	34.0	4	1	0
PRT	sp|P55072|TERA_HUMAN	Transitional endoplasmic reticulum ATPase OS=Homo sapiens OX=9606 GN=VCP PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	512-UNIMOD:188,522-UNIMOD:4,524-UNIMOD:188,502-UNIMOD:188,505-UNIMOD:188	0.05	34.0	4	2	0
PRT	sp|Q9H3S7|PTN23_HUMAN	Tyrosine-protein phosphatase non-receptor type 23 OS=Homo sapiens OX=9606 GN=PTPN23 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	2	1	0
PRT	sp|Q96J01-2|THOC3_HUMAN	Isoform 2 of THO complex subunit 3 OS=Homo sapiens OX=9606 GN=THOC3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	106-UNIMOD:4,122-UNIMOD:188	0.08	34.0	3	1	0
PRT	sp|Q99848|EBP2_HUMAN	Probable rRNA-processing protein EBP2 OS=Homo sapiens OX=9606 GN=EBNA1BP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	33-UNIMOD:188,44-UNIMOD:188	0.05	34.0	2	1	0
PRT	sp|Q02878|RL6_HUMAN	60S ribosomal protein L6 OS=Homo sapiens OX=9606 GN=RPL6 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	237-UNIMOD:188,239-UNIMOD:188,156-UNIMOD:267	0.10	34.0	4	2	0
PRT	sp|P61769|B2MG_HUMAN	Beta-2-microglobulin OS=Homo sapiens OX=9606 GN=B2M PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	68-UNIMOD:188,78-UNIMOD:188	0.12	34.0	2	1	0
PRT	sp|Q15075|EEA1_HUMAN	Early endosome antigen 1 OS=Homo sapiens OX=9606 GN=EEA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	370-UNIMOD:188,376-UNIMOD:188	0.01	34.0	2	1	0
PRT	sp|Q92616|GCN1_HUMAN	eIF-2-alpha kinase activator GCN1 OS=Homo sapiens OX=9606 GN=GCN1 PE=1 SV=6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	907-UNIMOD:4	0.01	34.0	1	1	1
PRT	sp|Q9Y2X3|NOP58_HUMAN	Nucleolar protein 58 OS=Homo sapiens OX=9606 GN=NOP58 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	81-UNIMOD:188,93-UNIMOD:188	0.03	34.0	2	1	0
PRT	sp|Q04446|GLGB_HUMAN	1,4-alpha-glucan-branching enzyme OS=Homo sapiens OX=9606 GN=GBE1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	212-UNIMOD:188	0.02	34.0	1	1	1
PRT	sp|P30044-2|PRDX5_HUMAN	Isoform Cytoplasmic+peroxisomal of Peroxiredoxin-5, mitochondrial OS=Homo sapiens OX=9606 GN=PRDX5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	48-UNIMOD:4	0.11	34.0	1	1	1
PRT	sp|Q14151|SAFB2_HUMAN	Scaffold attachment factor B2 OS=Homo sapiens OX=9606 GN=SAFB2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.07	34.0	3	2	1
PRT	sp|Q9H6R0-2|DHX33_HUMAN	Isoform 2 of ATP-dependent RNA helicase DHX33 OS=Homo sapiens OX=9606 GN=DHX33	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	17-UNIMOD:4	0.03	34.0	2	1	0
PRT	sp|P19525-2|E2AK2_HUMAN	Isoform 2 of Interferon-induced, double-stranded RNA-activated protein kinase OS=Homo sapiens OX=9606 GN=EIF2AK2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	121-UNIMOD:4,134-UNIMOD:188	0.04	34.0	2	1	0
PRT	sp|Q99829|CPNE1_HUMAN	Copine-1 OS=Homo sapiens OX=9606 GN=CPNE1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	400-UNIMOD:267,2-UNIMOD:1,4-UNIMOD:4,14-UNIMOD:4,20-UNIMOD:188,25-UNIMOD:188	0.08	34.0	4	2	0
PRT	sp|Q14683|SMC1A_HUMAN	Structural maintenance of chromosomes protein 1A OS=Homo sapiens OX=9606 GN=SMC1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.01	34.0	1	1	1
PRT	sp|Q6PI48|SYDM_HUMAN	Aspartate--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=DARS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	408-UNIMOD:267,362-UNIMOD:188,368-UNIMOD:188	0.06	34.0	4	2	0
PRT	sp|P09429|HMGB1_HUMAN	High mobility group protein B1 OS=Homo sapiens OX=9606 GN=HMGB1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	106-UNIMOD:4	0.07	34.0	2	1	0
PRT	sp|Q9UDY2-5|ZO2_HUMAN	Isoform A3 of Tight junction protein ZO-2 OS=Homo sapiens OX=9606 GN=TJP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	787-UNIMOD:188,796-UNIMOD:188	0.02	34.0	2	1	0
PRT	sp|P50995-2|ANX11_HUMAN	Isoform 2 of Annexin A11 OS=Homo sapiens OX=9606 GN=ANXA11	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.04	34.0	2	1	0
PRT	sp|Q14684-2|RRP1B_HUMAN	Isoform 2 of Ribosomal RNA processing protein 1 homolog B OS=Homo sapiens OX=9606 GN=RRP1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.05	34.0	3	2	1
PRT	sp|P31943|HNRH1_HUMAN	Heterogeneous nuclear ribonucleoprotein H OS=Homo sapiens OX=9606 GN=HNRNPH1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	167-UNIMOD:188,22-UNIMOD:4,16-UNIMOD:267,29-UNIMOD:267	0.08	34.0	4	2	1
PRT	sp|P07108|ACBP_HUMAN	Acyl-CoA-binding protein OS=Homo sapiens OX=9606 GN=DBI PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	19-UNIMOD:188,33-UNIMOD:188	0.20	34.0	2	1	0
PRT	sp|P62987|RL40_HUMAN	Ubiquitin-60S ribosomal protein L40 OS=Homo sapiens OX=9606 GN=UBA52 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.15	34.0	1	1	1
PRT	sp|P20839-2|IMDH1_HUMAN	Isoform 2 of Inosine-5'-monophosphate dehydrogenase 1 OS=Homo sapiens OX=9606 GN=IMPDH1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	486-UNIMOD:188	0.08	34.0	3	2	1
PRT	sp|Q93009-3|UBP7_HUMAN	Isoform 3 of Ubiquitin carboxyl-terminal hydrolase 7 OS=Homo sapiens OX=9606 GN=USP7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	256-UNIMOD:188,261-UNIMOD:188	0.01	34.0	2	1	0
PRT	sp|Q8NBQ5|DHB11_HUMAN	Estradiol 17-beta-dehydrogenase 11 OS=Homo sapiens OX=9606 GN=HSD17B11 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	94-UNIMOD:4	0.07	34.0	1	1	1
PRT	sp|P31040|SDHA_HUMAN	Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Homo sapiens OX=9606 GN=SDHA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	438-UNIMOD:4,443-UNIMOD:4,451-UNIMOD:267	0.04	34.0	2	1	0
PRT	sp|Q9H488|OFUT1_HUMAN	GDP-fucose protein O-fucosyltransferase 1 OS=Homo sapiens OX=9606 GN=POFUT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	59-UNIMOD:188	0.04	34.0	2	1	0
PRT	sp|P61962|DCAF7_HUMAN	DDB1- and CUL4-associated factor 7 OS=Homo sapiens OX=9606 GN=DCAF7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null		0.05	34.0	1	1	1
PRT	sp|O75369-5|FLNB_HUMAN	Isoform 5 of Filamin-B OS=Homo sapiens OX=9606 GN=FLNB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	864-UNIMOD:188,873-UNIMOD:188,1135-UNIMOD:188,1147-UNIMOD:188,838-UNIMOD:188,847-UNIMOD:188,1219-UNIMOD:267	0.04	33.0	8	5	3
PRT	sp|Q99615-2|DNJC7_HUMAN	Isoform 2 of DnaJ homolog subfamily C member 7 OS=Homo sapiens OX=9606 GN=DNAJC7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	72-UNIMOD:188,81-UNIMOD:188	0.04	33.0	1	1	0
PRT	sp|Q9H4L5-8|OSBL3_HUMAN	Isoform 2d of Oxysterol-binding protein-related protein 3 OS=Homo sapiens OX=9606 GN=OSBPL3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	114-UNIMOD:4,127-UNIMOD:188	0.03	33.0	1	1	1
PRT	sp|Q96I25|SPF45_HUMAN	Splicing factor 45 OS=Homo sapiens OX=9606 GN=RBM17 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.05	33.0	1	1	1
PRT	sp|Q08AM6|VAC14_HUMAN	Protein VAC14 homolog OS=Homo sapiens OX=9606 GN=VAC14 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	1	1	1
PRT	sp|Q9H6H4-2|REEP4_HUMAN	Isoform 2 of Receptor expression-enhancing protein 4 OS=Homo sapiens OX=9606 GN=REEP4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	101-UNIMOD:188,111-UNIMOD:188	0.08	33.0	2	1	0
PRT	sp|Q8TBX8-2|PI42C_HUMAN	Isoform 2 of Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma OS=Homo sapiens OX=9606 GN=PIP4K2C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	362-UNIMOD:188	0.05	33.0	3	1	0
PRT	sp|P48426-2|PI42A_HUMAN	Isoform 2 of Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha OS=Homo sapiens OX=9606 GN=PIP4K2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.05	33.0	2	1	0
PRT	sp|P13010|XRCC5_HUMAN	X-ray repair cross-complementing protein 5 OS=Homo sapiens OX=9606 GN=XRCC5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	84-UNIMOD:35,97-UNIMOD:188	0.02	33.0	4	1	0
PRT	sp|O43852-9|CALU_HUMAN	Isoform 9 of Calumenin OS=Homo sapiens OX=9606 GN=CALU	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	120-UNIMOD:188,123-UNIMOD:188	0.09	33.0	2	1	0
PRT	sp|P61970|NTF2_HUMAN	Nuclear transport factor 2 OS=Homo sapiens OX=9606 GN=NUTF2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	80-UNIMOD:4	0.22	33.0	1	1	1
PRT	sp|P56181-2|NDUV3_HUMAN	Isoform 2 of NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFV3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	2	1	0
PRT	sp|P27824-3|CALX_HUMAN	Isoform 3 of Calnexin OS=Homo sapiens OX=9606 GN=CANX	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.06	33.0	4	2	1
PRT	sp|P62424|RL7A_HUMAN	60S ribosomal protein L7a OS=Homo sapiens OX=9606 GN=RPL7A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null	75-UNIMOD:188,89-UNIMOD:267	0.06	33.0	3	1	0
PRT	sp|Q14C86-3|GAPD1_HUMAN	Isoform 3 of GTPase-activating protein and VPS9 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=GAPVD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	888-UNIMOD:188	0.01	33.0	1	1	1
PRT	sp|Q8NFI4|F10A5_HUMAN	Putative protein FAM10A5 OS=Homo sapiens OX=9606 GN=ST13P5 PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	16-UNIMOD:4	0.04	33.0	2	1	0
PRT	sp|P22314-2|UBA1_HUMAN	Isoform 2 of Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	609-UNIMOD:267	0.04	33.0	4	2	0
PRT	sp|P21283|VATC1_HUMAN	V-type proton ATPase subunit C 1 OS=Homo sapiens OX=9606 GN=ATP6V1C1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	15-UNIMOD:4	0.04	33.0	1	1	1
PRT	sp|Q9Y3I0|RTCB_HUMAN	RNA-splicing ligase RtcB homolog OS=Homo sapiens OX=9606 GN=RTCB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	33.0	null	357-UNIMOD:188,68-UNIMOD:28,81-UNIMOD:267	0.10	33.0	5	3	1
PRT	sp|Q01518-2|CAP1_HUMAN	Isoform 2 of Adenylyl cyclase-associated protein 1 OS=Homo sapiens OX=9606 GN=CAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	415-UNIMOD:4,411-UNIMOD:188,421-UNIMOD:188,29-UNIMOD:267	0.07	33.0	3	2	1
PRT	sp|P60891-2|PRPS1_HUMAN	Isoform 2 of Ribose-phosphate pyrophosphokinase 1 OS=Homo sapiens OX=9606 GN=PRPS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.07	33.0	1	1	1
PRT	sp|Q96HC4-3|PDLI5_HUMAN	Isoform 3 of PDZ and LIM domain protein 5 OS=Homo sapiens OX=9606 GN=PDLIM5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.07	33.0	1	1	1
PRT	sp|Q14498|RBM39_HUMAN	RNA-binding protein 39 OS=Homo sapiens OX=9606 GN=RBM39 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	null	478-UNIMOD:385,478-UNIMOD:4,494-UNIMOD:267	0.03	33.0	2	1	0
PRT	sp|Q14676|MDC1_HUMAN	Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens OX=9606 GN=MDC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null		0.01	33.0	1	1	1
PRT	sp|Q9NQ29-2|LUC7L_HUMAN	Isoform 2 of Putative RNA-binding protein Luc7-like 1 OS=Homo sapiens OX=9606 GN=LUC7L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	125-UNIMOD:188,135-UNIMOD:188	0.04	32.0	3	1	0
PRT	sp|P62081|RS7_HUMAN	40S ribosomal protein S7 OS=Homo sapiens OX=9606 GN=RPS7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	169-UNIMOD:188,178-UNIMOD:188	0.17	32.0	2	2	2
PRT	sp|Q8NAV1|PR38A_HUMAN	Pre-mRNA-splicing factor 38A OS=Homo sapiens OX=9606 GN=PRPF38A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.05	32.0	1	1	1
PRT	sp|P63220|RS21_HUMAN	40S ribosomal protein S21 OS=Homo sapiens OX=9606 GN=RPS21 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.23	32.0	1	1	1
PRT	sp|O95758-7|PTBP3_HUMAN	Isoform 7 of Polypyrimidine tract-binding protein 3 OS=Homo sapiens OX=9606 GN=PTBP3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	2	1	0
PRT	sp|P26599|PTBP1_HUMAN	Polypyrimidine tract-binding protein 1 OS=Homo sapiens OX=9606 GN=PTBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	1	1	1
PRT	sp|Q8NE62|CHDH_HUMAN	Choline dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=CHDH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|O15042-2|SR140_HUMAN	Isoform 2 of U2 snRNP-associated SURP motif-containing protein OS=Homo sapiens OX=9606 GN=U2SURP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	65-UNIMOD:4	0.02	32.0	1	1	1
PRT	sp|Q9NZM1-2|MYOF_HUMAN	Isoform 2 of Myoferlin OS=Homo sapiens OX=9606 GN=MYOF	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	2	2	2
PRT	sp|P27708|PYR1_HUMAN	CAD protein OS=Homo sapiens OX=9606 GN=CAD PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.01	32.0	2	2	2
PRT	sp|P30837|AL1B1_HUMAN	Aldehyde dehydrogenase X, mitochondrial OS=Homo sapiens OX=9606 GN=ALDH1B1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|P29144|TPP2_HUMAN	Tripeptidyl-peptidase 2 OS=Homo sapiens OX=9606 GN=TPP2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|P07355-2|ANXA2_HUMAN	Isoform 2 of Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	151-UNIMOD:4,153-UNIMOD:267,67-UNIMOD:188,81-UNIMOD:267	0.10	32.0	8	3	0
PRT	sp|P11766|ADHX_HUMAN	Alcohol dehydrogenase class-3 OS=Homo sapiens OX=9606 GN=ADH5 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	341-UNIMOD:188,357-UNIMOD:188	0.05	32.0	2	1	0
PRT	sp|P26038|MOES_HUMAN	Moesin OS=Homo sapiens OX=9606 GN=MSN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|Q96I51-2|RCC1L_HUMAN	Isoform 2 of RCC1-like G exchanging factor-like protein OS=Homo sapiens OX=9606 GN=RCC1L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	2	1	0
PRT	sp|P53992|SC24C_HUMAN	Protein transport protein Sec24C OS=Homo sapiens OX=9606 GN=SEC24C PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	654-UNIMOD:188	0.02	32.0	3	1	0
PRT	sp|Q8IWA0|WDR75_HUMAN	WD repeat-containing protein 75 OS=Homo sapiens OX=9606 GN=WDR75 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	306-UNIMOD:4,313-UNIMOD:188	0.03	32.0	1	1	1
PRT	sp|P62258-2|1433E_HUMAN	Isoform SV of 14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	75-UNIMOD:4,76-UNIMOD:4,84-UNIMOD:188,96-UNIMOD:188	0.11	32.0	1	1	1
PRT	sp|P46940|IQGA1_HUMAN	Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens OX=9606 GN=IQGAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.01	32.0	1	1	1
PRT	sp|Q5HYK3|COQ5_HUMAN	2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial OS=Homo sapiens OX=9606 GN=COQ5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.05	32.0	1	1	1
PRT	sp|Q13643|FHL3_HUMAN	Four and a half LIM domains protein 3 OS=Homo sapiens OX=9606 GN=FHL3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	150-UNIMOD:4,153-UNIMOD:4	0.07	32.0	1	1	1
PRT	sp|Q96H79|ZCCHL_HUMAN	Zinc finger CCCH-type antiviral protein 1-like OS=Homo sapiens OX=9606 GN=ZC3HAV1L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.05	32.0	1	1	1
PRT	sp|O75351|VPS4B_HUMAN	Vacuolar protein sorting-associated protein 4B OS=Homo sapiens OX=9606 GN=VPS4B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	422-UNIMOD:188,432-UNIMOD:188	0.04	32.0	2	1	0
PRT	sp|P16144-2|ITB4_HUMAN	Isoform Beta-4A of Integrin beta-4 OS=Homo sapiens OX=9606 GN=ITGB4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	1362-UNIMOD:267,1376-UNIMOD:267	0.01	32.0	4	1	0
PRT	sp|Q9BWJ5|SF3B5_HUMAN	Splicing factor 3B subunit 5 OS=Homo sapiens OX=9606 GN=SF3B5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	2-UNIMOD:1	0.20	32.0	3	1	0
PRT	sp|P46459|NSF_HUMAN	Vesicle-fusing ATPase OS=Homo sapiens OX=9606 GN=NSF PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	67-UNIMOD:267	0.02	32.0	2	1	0
PRT	sp|O75688-5|PPM1B_HUMAN	Isoform 5 of Protein phosphatase 1B OS=Homo sapiens OX=9606 GN=PPM1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	71-UNIMOD:4	0.06	32.0	1	1	1
PRT	sp|P62333|PRS10_HUMAN	26S proteasome regulatory subunit 10B OS=Homo sapiens OX=9606 GN=PSMC6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	168-UNIMOD:188,170-UNIMOD:4,180-UNIMOD:188	0.05	32.0	2	1	0
PRT	sp|Q7KZF4|SND1_HUMAN	Staphylococcal nuclease domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SND1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|P21333|FLNA_HUMAN	Filamin-A OS=Homo sapiens OX=9606 GN=FLNA PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	2540-UNIMOD:188	0.01	32.0	1	1	0
PRT	sp|P08727|K1C19_HUMAN	Keratin, type I cytoskeletal 19 OS=Homo sapiens OX=9606 GN=KRT19 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	32.0	null	280-UNIMOD:267,293-UNIMOD:267,372-UNIMOD:267,381-UNIMOD:267	0.08	32.0	5	2	0
PRT	sp|Q12906|ILF3_HUMAN	Interleukin enhancer-binding factor 3 OS=Homo sapiens OX=9606 GN=ILF3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	null	309-UNIMOD:28	0.02	32.0	2	1	0
PRT	sp|P62829|RL23_HUMAN	60S ribosomal protein L23 OS=Homo sapiens OX=9606 GN=RPL23 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	32.0	null	15-UNIMOD:267,28-UNIMOD:4,35-UNIMOD:188	0.16	32.0	2	1	0
PRT	sp|P40121|CAPG_HUMAN	Macrophage-capping protein OS=Homo sapiens OX=9606 GN=CAPG PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null		0.05	32.0	1	1	0
PRT	sp|P18206-2|VINC_HUMAN	Isoform 1 of Vinculin OS=Homo sapiens OX=9606 GN=VCL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.01	31.0	1	1	1
PRT	sp|Q9UHI6|DDX20_HUMAN	Probable ATP-dependent RNA helicase DDX20 OS=Homo sapiens OX=9606 GN=DDX20 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|P26639|SYTC_HUMAN	Threonine--tRNA ligase 1, cytoplasmic OS=Homo sapiens OX=9606 GN=TARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|Q9ULE6|PALD_HUMAN	Paladin OS=Homo sapiens OX=9606 GN=PALD1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	382-UNIMOD:4	0.02	31.0	2	1	0
PRT	sp|P16989-2|YBOX3_HUMAN	Isoform 2 of Y-box-binding protein 3 OS=Homo sapiens OX=9606 GN=YBX3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	124-UNIMOD:188,125-UNIMOD:188	0.04	31.0	2	1	0
PRT	sp|P22626-2|ROA2_HUMAN	Isoform A2 of Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	191-UNIMOD:267,201-UNIMOD:267,92-UNIMOD:188,100-UNIMOD:188	0.08	31.0	4	2	0
PRT	sp|P48059|LIMS1_HUMAN	LIM and senescent cell antigen-like-containing domain protein 1 OS=Homo sapiens OX=9606 GN=LIMS1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	181-UNIMOD:4,184-UNIMOD:4,176-UNIMOD:188,187-UNIMOD:188,161-UNIMOD:4,164-UNIMOD:4,166-UNIMOD:188	0.10	31.0	4	2	1
PRT	sp|P30101|PDIA3_HUMAN	Protein disulfide-isomerase A3 OS=Homo sapiens OX=9606 GN=PDIA3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	244-UNIMOD:4,247-UNIMOD:35,252-UNIMOD:188,258-UNIMOD:188	0.08	31.0	9	2	1
PRT	sp|P50579-3|MAP2_HUMAN	Isoform 3 of Methionine aminopeptidase 2 OS=Homo sapiens OX=9606 GN=METAP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	357-UNIMOD:4,362-UNIMOD:188	0.03	31.0	2	1	0
PRT	sp|Q96A26|F162A_HUMAN	Protein FAM162A OS=Homo sapiens OX=9606 GN=FAM162A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	139-UNIMOD:188,140-UNIMOD:188	0.08	31.0	2	1	0
PRT	sp|P00367-2|DHE3_HUMAN	Isoform 2 of Glutamate dehydrogenase 1, mitochondrial OS=Homo sapiens OX=9606 GN=GLUD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.09	31.0	2	2	2
PRT	sp|Q9UJ70|NAGK_HUMAN	N-acetyl-D-glucosamine kinase OS=Homo sapiens OX=9606 GN=NAGK PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	261-UNIMOD:188	0.05	31.0	2	1	0
PRT	sp|P35244|RFA3_HUMAN	Replication protein A 14 kDa subunit OS=Homo sapiens OX=9606 GN=RPA3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.15	31.0	1	1	1
PRT	sp|P00505-2|AATM_HUMAN	Isoform 2 of Aspartate aminotransferase, mitochondrial OS=Homo sapiens OX=9606 GN=GOT2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.06	31.0	1	1	1
PRT	sp|Q8IZP0-10|ABI1_HUMAN	Isoform 10 of Abl interactor 1 OS=Homo sapiens OX=9606 GN=ABI1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.04	31.0	1	1	1
PRT	sp|Q9Y2K7-4|KDM2A_HUMAN	Isoform 4 of Lysine-specific demethylase 2A OS=Homo sapiens OX=9606 GN=KDM2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	532-UNIMOD:4,551-UNIMOD:267	0.04	31.0	1	1	1
PRT	sp|P18858-3|DNLI1_HUMAN	Isoform 3 of DNA ligase 1 OS=Homo sapiens OX=9606 GN=LIG1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	782-UNIMOD:188	0.02	31.0	1	1	1
PRT	sp|Q13561|DCTN2_HUMAN	Dynactin subunit 2 OS=Homo sapiens OX=9606 GN=DCTN2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	119-UNIMOD:188,121-UNIMOD:188	0.04	31.0	2	1	0
PRT	sp|Q6P2E9-2|EDC4_HUMAN	Isoform 2 of Enhancer of mRNA-decapping protein 4 OS=Homo sapiens OX=9606 GN=EDC4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|O75874|IDHC_HUMAN	Isocitrate dehydrogenase [NADP] cytoplasmic OS=Homo sapiens OX=9606 GN=IDH1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	1	1	1
PRT	sp|P20700|LMNB1_HUMAN	Lamin-B1 OS=Homo sapiens OX=9606 GN=LMNB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	261-UNIMOD:188,271-UNIMOD:188	0.02	31.0	4	1	0
PRT	sp|Q9NRW3|ABC3C_HUMAN	DNA dC->dU-editing enzyme APOBEC-3C OS=Homo sapiens OX=9606 GN=APOBEC3C PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	65-UNIMOD:4,69-UNIMOD:267	0.07	31.0	2	1	0
PRT	sp|Q15046|SYK_HUMAN	Lysine--tRNA ligase OS=Homo sapiens OX=9606 GN=KARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	164-UNIMOD:188,175-UNIMOD:188	0.03	31.0	2	1	0
PRT	sp|Q9UMS4|PRP19_HUMAN	Pre-mRNA-processing factor 19 OS=Homo sapiens OX=9606 GN=PRPF19 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	114-UNIMOD:4,115-UNIMOD:267	0.03	31.0	2	1	0
PRT	sp|P13647|K2C5_HUMAN	Keratin, type II cytoskeletal 5 OS=Homo sapiens OX=9606 GN=KRT5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	73-UNIMOD:267,84-UNIMOD:267,343-UNIMOD:188	0.04	31.0	2	2	2
PRT	sp|Q99805|TM9S2_HUMAN	Transmembrane 9 superfamily member 2 OS=Homo sapiens OX=9606 GN=TM9SF2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|P26583|HMGB2_HUMAN	High mobility group protein B2 OS=Homo sapiens OX=9606 GN=HMGB2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	127-UNIMOD:188,128-UNIMOD:188	0.07	31.0	3	1	0
PRT	sp|Q9Y2W1|TR150_HUMAN	Thyroid hormone receptor-associated protein 3 OS=Homo sapiens OX=9606 GN=THRAP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	621-UNIMOD:267	0.01	31.0	3	1	0
PRT	sp|Q13724-2|MOGS_HUMAN	Isoform 2 of Mannosyl-oligosaccharide glucosidase OS=Homo sapiens OX=9606 GN=MOGS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	7-UNIMOD:188,26-UNIMOD:188,355-UNIMOD:267	0.05	31.0	2	2	2
PRT	sp|P60174|TPIS_HUMAN	Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	56-UNIMOD:188,70-UNIMOD:188	0.11	31.0	2	2	2
PRT	sp|P07737|PROF1_HUMAN	Profilin-1 OS=Homo sapiens OX=9606 GN=PFN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.14	31.0	1	1	1
PRT	sp|P00441|SODC_HUMAN	Superoxide dismutase [Cu-Zn] OS=Homo sapiens OX=9606 GN=SOD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	123-UNIMOD:188,129-UNIMOD:188	0.09	31.0	1	1	1
PRT	sp|O43150-2|ASAP2_HUMAN	Isoform 2 of Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ASAP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	616-UNIMOD:188,620-UNIMOD:188	0.02	31.0	1	1	1
PRT	sp|P49915-2|GUAA_HUMAN	Isoform 2 of GMP synthase [glutamine-hydrolyzing] OS=Homo sapiens OX=9606 GN=GMPS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	218-UNIMOD:267,221-UNIMOD:267	0.04	31.0	1	1	1
PRT	sp|O95159|ZFPL1_HUMAN	Zinc finger protein-like 1 OS=Homo sapiens OX=9606 GN=ZFPL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	24-UNIMOD:4,27-UNIMOD:4,34-UNIMOD:188	0.05	31.0	2	1	0
PRT	sp|P54886-2|P5CS_HUMAN	Isoform Short of Delta-1-pyrroline-5-carboxylate synthase OS=Homo sapiens OX=9606 GN=ALDH18A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	345-UNIMOD:188,346-UNIMOD:188	0.02	31.0	4	1	0
PRT	sp|Q15067|ACOX1_HUMAN	Peroxisomal acyl-coenzyme A oxidase 1 OS=Homo sapiens OX=9606 GN=ACOX1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|O00231|PSD11_HUMAN	26S proteasome non-ATPase regulatory subunit 11 OS=Homo sapiens OX=9606 GN=PSMD11 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.09	30.0	2	2	2
PRT	sp|P30048-2|PRDX3_HUMAN	Isoform 2 of Thioredoxin-dependent peroxide reductase, mitochondrial OS=Homo sapiens OX=9606 GN=PRDX3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	211-UNIMOD:4,189-UNIMOD:267	0.18	30.0	3	2	1
PRT	sp|Q9Y5X1|SNX9_HUMAN	Sorting nexin-9 OS=Homo sapiens OX=9606 GN=SNX9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	414-UNIMOD:188,425-UNIMOD:188,502-UNIMOD:4,511-UNIMOD:188	0.06	30.0	3	2	1
PRT	sp|Q96QK1|VPS35_HUMAN	Vacuolar protein sorting-associated protein 35 OS=Homo sapiens OX=9606 GN=VPS35 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	640-UNIMOD:4,653-UNIMOD:4	0.03	30.0	1	1	1
PRT	sp|Q13523|PRP4B_HUMAN	Serine/threonine-protein kinase PRP4 homolog OS=Homo sapiens OX=9606 GN=PRPF4B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	809-UNIMOD:4	0.02	30.0	1	1	1
PRT	sp|P54646|AAPK2_HUMAN	5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Homo sapiens OX=9606 GN=PRKAA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	1	1	1
PRT	sp|P25705-2|ATPA_HUMAN	Isoform 2 of ATP synthase subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	255-UNIMOD:188,266-UNIMOD:188	0.03	30.0	3	1	0
PRT	sp|O00625|PIR_HUMAN	Pirin OS=Homo sapiens OX=9606 GN=PIR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	79-UNIMOD:4	0.09	30.0	1	1	1
PRT	sp|P30086|PEBP1_HUMAN	Phosphatidylethanolamine-binding protein 1 OS=Homo sapiens OX=9606 GN=PEBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.14	30.0	1	1	1
PRT	sp|P54920|SNAA_HUMAN	Alpha-soluble NSF attachment protein OS=Homo sapiens OX=9606 GN=NAPA PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	84-UNIMOD:4,93-UNIMOD:188,94-UNIMOD:188	0.06	30.0	2	1	0
PRT	sp|Q15120|PDK3_HUMAN	[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 3, mitochondrial OS=Homo sapiens OX=9606 GN=PDK3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	191-UNIMOD:4	0.06	30.0	1	1	1
PRT	sp|O43390-4|HNRPR_HUMAN	Isoform 4 of Heterogeneous nuclear ribonucleoprotein R OS=Homo sapiens OX=9606 GN=HNRNPR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	139-UNIMOD:4	0.02	30.0	1	1	1
PRT	sp|P30740-2|ILEU_HUMAN	Isoform 2 of Leukocyte elastase inhibitor OS=Homo sapiens OX=9606 GN=SERPINB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.06	30.0	1	1	1
PRT	sp|P30050-2|RL12_HUMAN	Isoform 2 of 60S ribosomal protein L12 OS=Homo sapiens OX=9606 GN=RPL12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	129-UNIMOD:4	0.27	30.0	2	2	1
PRT	sp|Q96L92|SNX27_HUMAN	Sorting nexin-27 OS=Homo sapiens OX=9606 GN=SNX27 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	1	1	1
PRT	sp|P49411|EFTU_HUMAN	Elongation factor Tu, mitochondrial OS=Homo sapiens OX=9606 GN=TUFM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	290-UNIMOD:4,286-UNIMOD:188,297-UNIMOD:188	0.03	30.0	2	1	0
PRT	sp|Q9H8S9-2|MOB1A_HUMAN	Isoform 2 of MOB kinase activator 1A OS=Homo sapiens OX=9606 GN=MOB1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	17-UNIMOD:188,30-UNIMOD:188	0.10	30.0	3	1	0
PRT	sp|Q9NYB9-3|ABI2_HUMAN	Isoform 3 of Abl interactor 2 OS=Homo sapiens OX=9606 GN=ABI2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	94-UNIMOD:188,109-UNIMOD:188	0.09	30.0	4	2	0
PRT	sp|Q69YN4-3|VIR_HUMAN	Isoform 3 of Protein virilizer homolog OS=Homo sapiens OX=9606 GN=VIRMA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	1465-UNIMOD:188,1481-UNIMOD:188	0.01	30.0	1	1	1
PRT	sp|P40939|ECHA_HUMAN	Trifunctional enzyme subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=HADHA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	215-UNIMOD:35	0.03	30.0	1	1	1
PRT	sp|Q06124-3|PTN11_HUMAN	Isoform 3 of Tyrosine-protein phosphatase non-receptor type 11 OS=Homo sapiens OX=9606 GN=PTPN11	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.08	30.0	2	2	1
PRT	sp|P07195|LDHB_HUMAN	L-lactate dehydrogenase B chain OS=Homo sapiens OX=9606 GN=LDHB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.04	30.0	1	1	1
PRT	sp|P62249|RS16_HUMAN	40S ribosomal protein S16 OS=Homo sapiens OX=9606 GN=RPS16 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.10	30.0	1	1	1
PRT	sp|Q9NRW7|VPS45_HUMAN	Vacuolar protein sorting-associated protein 45 OS=Homo sapiens OX=9606 GN=VPS45 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	1	1	1
PRT	sp|Q9Y6G9|DC1L1_HUMAN	Cytoplasmic dynein 1 light intermediate chain 1 OS=Homo sapiens OX=9606 GN=DYNC1LI1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	111-UNIMOD:267,116-UNIMOD:267,490-UNIMOD:188,501-UNIMOD:267	0.07	30.0	3	2	1
PRT	sp|Q15185-2|TEBP_HUMAN	Isoform 2 of Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	35-UNIMOD:188,40-UNIMOD:4,48-UNIMOD:188	0.13	30.0	1	1	0
PRT	sp|Q92747|ARC1A_HUMAN	Actin-related protein 2/3 complex subunit 1A OS=Homo sapiens OX=9606 GN=ARPC1A PE=2 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	2-UNIMOD:1,13-UNIMOD:4,18-UNIMOD:267	0.05	30.0	2	1	0
PRT	sp|P47813|IF1AX_HUMAN	Eukaryotic translation initiation factor 1A, X-chromosomal OS=Homo sapiens OX=9606 GN=EIF1AX PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	104-UNIMOD:188,114-UNIMOD:188	0.10	30.0	2	1	0
PRT	sp|O60763|USO1_HUMAN	General vesicular transport factor p115 OS=Homo sapiens OX=9606 GN=USO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|P48507-2|GSH0_HUMAN	Isoform 2 of Glutamate--cysteine ligase regulatory subunit OS=Homo sapiens OX=9606 GN=GCLM	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	30-UNIMOD:267	0.06	30.0	1	1	1
PRT	sp|Q99613-2|EIF3C_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit C OS=Homo sapiens OX=9606 GN=EIF3C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	713-UNIMOD:267,724-UNIMOD:267	0.02	30.0	2	1	0
PRT	sp|Q9BUF5|TBB6_HUMAN	Tubulin beta-6 chain OS=Homo sapiens OX=9606 GN=TUBB6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	124-UNIMOD:4,127-UNIMOD:4,129-UNIMOD:4,154-UNIMOD:188	0.07	30.0	1	1	1
PRT	sp|Q13435|SF3B2_HUMAN	Splicing factor 3B subunit 2 OS=Homo sapiens OX=9606 GN=SF3B2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	30.0	null	467-UNIMOD:28,519-UNIMOD:188,529-UNIMOD:188	0.04	30.0	3	2	1
PRT	sp|O60282|KIF5C_HUMAN	Kinesin heavy chain isoform 5C OS=Homo sapiens OX=9606 GN=KIF5C PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null		0.03	30.0	1	1	1
PRT	sp|Q9Y276|BCS1_HUMAN	Mitochondrial chaperone BCS1 OS=Homo sapiens OX=9606 GN=BCS1L PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null		0.04	30.0	1	1	1
PRT	sp|P30050|RL12_HUMAN	60S ribosomal protein L12 OS=Homo sapiens OX=9606 GN=RPL12 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	162-UNIMOD:4	0.12	30.0	1	1	0
PRT	sp|Q9H7E9|CH033_HUMAN	UPF0488 protein C8orf33 OS=Homo sapiens OX=9606 GN=C8orf33 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	69-UNIMOD:188,70-UNIMOD:188	0.07	29.0	1	1	1
PRT	sp|P12814-2|ACTN1_HUMAN	Isoform 2 of Alpha-actinin-1 OS=Homo sapiens OX=9606 GN=ACTN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|Q9UDT6-2|CLIP2_HUMAN	Isoform 2 of CAP-Gly domain-containing linker protein 2 OS=Homo sapiens OX=9606 GN=CLIP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	390-UNIMOD:4	0.02	29.0	1	1	1
PRT	sp|P04792|HSPB1_HUMAN	Heat shock protein beta-1 OS=Homo sapiens OX=9606 GN=HSPB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.07	29.0	1	1	1
PRT	sp|P33992|MCM5_HUMAN	DNA replication licensing factor MCM5 OS=Homo sapiens OX=9606 GN=MCM5 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	2	1	0
PRT	sp|Q86VP6-3|CAND1_HUMAN	Isoform 3 of Cullin-associated NEDD8-dissociated protein 1 OS=Homo sapiens OX=9606 GN=CAND1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.04	29.0	1	1	1
PRT	sp|Q00059-2|TFAM_HUMAN	Isoform 2 of Transcription factor A, mitochondrial OS=Homo sapiens OX=9606 GN=TFAM	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.07	29.0	1	1	1
PRT	sp|O60271-5|JIP4_HUMAN	Isoform 5 of C-Jun-amino-terminal kinase-interacting protein 4 OS=Homo sapiens OX=9606 GN=SPAG9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	1	1	1
PRT	sp|P00491|PNPH_HUMAN	Purine nucleoside phosphorylase OS=Homo sapiens OX=9606 GN=PNP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	158-UNIMOD:267,168-UNIMOD:267	0.05	29.0	4	1	0
PRT	sp|Q9GZY8-5|MFF_HUMAN	Isoform 5 of Mitochondrial fission factor OS=Homo sapiens OX=9606 GN=MFF	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.07	29.0	1	1	1
PRT	sp|P40121-2|CAPG_HUMAN	Isoform 2 of Macrophage-capping protein OS=Homo sapiens OX=9606 GN=CAPG	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	115-UNIMOD:188,127-UNIMOD:188	0.05	29.0	1	1	0
PRT	sp|Q8IU81|I2BP1_HUMAN	Interferon regulatory factor 2-binding protein 1 OS=Homo sapiens OX=9606 GN=IRF2BP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.04	29.0	1	1	1
PRT	sp|Q9C0J8|WDR33_HUMAN	pre-mRNA 3' end processing protein WDR33 OS=Homo sapiens OX=9606 GN=WDR33 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null	906-UNIMOD:188	0.01	29.0	2	1	0
PRT	sp|P48444|COPD_HUMAN	Coatomer subunit delta OS=Homo sapiens OX=9606 GN=ARCN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	335-UNIMOD:188,336-UNIMOD:188	0.03	29.0	2	1	0
PRT	sp|P34897-3|GLYM_HUMAN	Isoform 3 of Serine hydroxymethyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=SHMT2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	259-UNIMOD:188	0.02	29.0	2	1	0
PRT	sp|Q14651|PLSI_HUMAN	Plastin-1 OS=Homo sapiens OX=9606 GN=PLS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	157-UNIMOD:188	0.02	29.0	1	1	1
PRT	sp|P61201|CSN2_HUMAN	COP9 signalosome complex subunit 2 OS=Homo sapiens OX=9606 GN=COPS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.04	29.0	1	1	1
PRT	sp|P63151|2ABA_HUMAN	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform OS=Homo sapiens OX=9606 GN=PPP2R2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	210-UNIMOD:267	0.07	29.0	3	2	1
PRT	sp|P12236|ADT3_HUMAN	ADP/ATP translocase 3 OS=Homo sapiens OX=9606 GN=SLC25A6 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.04	29.0	1	1	1
PRT	sp|Q9Y265|RUVB1_HUMAN	RuvB-like 1 OS=Homo sapiens OX=9606 GN=RUVBL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.05	29.0	1	1	1
PRT	sp|Q96KR1|ZFR_HUMAN	Zinc finger RNA-binding protein OS=Homo sapiens OX=9606 GN=ZFR PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	340-UNIMOD:4	0.02	29.0	1	1	1
PRT	sp|P12956|XRCC6_HUMAN	X-ray repair cross-complementing protein 6 OS=Homo sapiens OX=9606 GN=XRCC6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|Q13813-2|SPTN1_HUMAN	Isoform 2 of Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	3	2	1
PRT	sp|P41250|GARS_HUMAN	Glycine--tRNA ligase OS=Homo sapiens OX=9606 GN=GARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	2	1	0
PRT	sp|P45973|CBX5_HUMAN	Chromobox protein homolog 5 OS=Homo sapiens OX=9606 GN=CBX5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.08	29.0	1	1	1
PRT	sp|O75131|CPNE3_HUMAN	Copine-3 OS=Homo sapiens OX=9606 GN=CPNE3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	406-UNIMOD:267	0.03	29.0	2	1	0
PRT	sp|Q16181-2|SEPT7_HUMAN	Isoform 2 of Septin-7 OS=Homo sapiens OX=9606 GN=SEPTIN7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	394-UNIMOD:188,399-UNIMOD:188	0.03	29.0	2	1	0
PRT	sp|Q12906-5|ILF3_HUMAN	Isoform 5 of Interleukin enhancer-binding factor 3 OS=Homo sapiens OX=9606 GN=ILF3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	311-UNIMOD:267,323-UNIMOD:267	0.02	29.0	4	1	0
PRT	sp|P24928-2|RPB1_HUMAN	Isoform 2 of DNA-directed RNA polymerase II subunit RPB1 OS=Homo sapiens OX=9606 GN=POLR2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	1	1	1
PRT	sp|Q13347|EIF3I_HUMAN	Eukaryotic translation initiation factor 3 subunit I OS=Homo sapiens OX=9606 GN=EIF3I PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.04	29.0	1	1	1
PRT	sp|Q12765-3|SCRN1_HUMAN	Isoform 3 of Secernin-1 OS=Homo sapiens OX=9606 GN=SCRN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	238-UNIMOD:188,247-UNIMOD:188	0.04	29.0	3	1	0
PRT	sp|P49005|DPOD2_HUMAN	DNA polymerase delta subunit 2 OS=Homo sapiens OX=9606 GN=POLD2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	125-UNIMOD:188,141-UNIMOD:267	0.04	29.0	2	1	0
PRT	sp|P07814|SYEP_HUMAN	Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens OX=9606 GN=EPRS1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	1480-UNIMOD:4,1487-UNIMOD:4,1484-UNIMOD:188,1494-UNIMOD:188	0.02	29.0	4	2	1
PRT	sp|P62917|RL8_HUMAN	60S ribosomal protein L8 OS=Homo sapiens OX=9606 GN=RPL8 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	90-UNIMOD:4	0.09	29.0	1	1	1
PRT	sp|Q4VC31|CCD58_HUMAN	Coiled-coil domain-containing protein 58 OS=Homo sapiens OX=9606 GN=CCDC58 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.16	29.0	1	1	1
PRT	sp|Q99798|ACON_HUMAN	Aconitate hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=ACO2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	50-UNIMOD:188	0.03	29.0	2	1	0
PRT	sp|P17931|LEG3_HUMAN	Galectin-3 OS=Homo sapiens OX=9606 GN=LGALS3 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	130-UNIMOD:35,224-UNIMOD:267	0.12	29.0	3	2	1
PRT	sp|Q99460-2|PSMD1_HUMAN	Isoform 2 of 26S proteasome non-ATPase regulatory subunit 1 OS=Homo sapiens OX=9606 GN=PSMD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	720-UNIMOD:188,727-UNIMOD:188	0.01	29.0	3	1	0
PRT	sp|Q9UK76|JUPI1_HUMAN	Jupiter microtubule associated homolog 1 OS=Homo sapiens OX=9606 GN=JPT1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	22-UNIMOD:267,43-UNIMOD:267	0.16	29.0	2	1	0
PRT	sp|Q6ZMZ3-2|SYNE3_HUMAN	Isoform 2 of Nesprin-3 OS=Homo sapiens OX=9606 GN=SYNE3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	859-UNIMOD:267	0.01	29.0	1	1	1
PRT	sp|P22234|PUR6_HUMAN	Multifunctional protein ADE2 OS=Homo sapiens OX=9606 GN=PAICS PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	1	1	1
PRT	sp|O14880|MGST3_HUMAN	Microsomal glutathione S-transferase 3 OS=Homo sapiens OX=9606 GN=MGST3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	56-UNIMOD:4	0.16	29.0	1	1	1
PRT	sp|Q13885|TBB2A_HUMAN	Tubulin beta-2A chain OS=Homo sapiens OX=9606 GN=TUBB2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null		0.06	29.0	1	1	1
PRT	sp|P60709|ACTB_HUMAN	Actin, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=ACTB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	153-UNIMOD:35,177-UNIMOD:267	0.08	29.0	1	1	0
PRT	sp|P52272|HNRPM_HUMAN	Heterogeneous nuclear ribonucleoprotein M OS=Homo sapiens OX=9606 GN=HNRNPM PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	419-UNIMOD:35,429-UNIMOD:267,145-UNIMOD:188,154-UNIMOD:267	0.03	29.0	3	2	0
PRT	sp|P12268|IMDH2_HUMAN	Inosine-5'-monophosphate dehydrogenase 2 OS=Homo sapiens OX=9606 GN=IMPDH2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	29.0	null	140-UNIMOD:4,149-UNIMOD:267,511-UNIMOD:188	0.06	29.0	3	2	1
PRT	sp|P62633|CNBP_HUMAN	Cellular nucleic acid-binding protein OS=Homo sapiens OX=9606 GN=CNBP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	null	119-UNIMOD:385,119-UNIMOD:4,122-UNIMOD:4,132-UNIMOD:4	0.10	29.0	1	1	0
PRT	sp|Q9UMY4|SNX12_HUMAN	Sorting nexin-12 OS=Homo sapiens OX=9606 GN=SNX12 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	null	141-UNIMOD:385,141-UNIMOD:4	0.09	29.0	1	1	1
PRT	sp|P82930|RT34_HUMAN	28S ribosomal protein S34, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS34 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	29.0	null	101-UNIMOD:267,113-UNIMOD:188	0.07	29.0	4	1	0
PRT	sp|P01023|A2MG_HUMAN	Alpha-2-macroglobulin OS=Homo sapiens OX=9606 GN=A2M PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	1385-UNIMOD:35	0.01	29.0	1	1	1
PRT	sp|Q99567|NUP88_HUMAN	Nuclear pore complex protein Nup88 OS=Homo sapiens OX=9606 GN=NUP88 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	null	447-UNIMOD:385,447-UNIMOD:4,454-UNIMOD:4,456-UNIMOD:188,460-UNIMOD:4,461-UNIMOD:267	0.02	29.0	1	1	1
PRT	sp|Q9HD20|AT131_HUMAN	Manganese-transporting ATPase 13A1 OS=Homo sapiens OX=9606 GN=ATP13A1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|Q9Y6M1-1|IF2B2_HUMAN	Isoform 2 of Insulin-like growth factor 2 mRNA-binding protein 2 OS=Homo sapiens OX=9606 GN=IGF2BP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	61-UNIMOD:188,67-UNIMOD:188	0.03	28.0	1	1	1
PRT	sp|P78347-2|GTF2I_HUMAN	Isoform 2 of General transcription factor II-I OS=Homo sapiens OX=9606 GN=GTF2I	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|O15144|ARPC2_HUMAN	Actin-related protein 2/3 complex subunit 2 OS=Homo sapiens OX=9606 GN=ARPC2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	152-UNIMOD:35	0.06	28.0	1	1	1
PRT	sp|P39023|RL3_HUMAN	60S ribosomal protein L3 OS=Homo sapiens OX=9606 GN=RPL3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	39-UNIMOD:188,50-UNIMOD:188,114-UNIMOD:4	0.08	28.0	3	2	1
PRT	sp|Q12888|TP53B_HUMAN	TP53-binding protein 1 OS=Homo sapiens OX=9606 GN=TP53BP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|P04181-2|OAT_HUMAN	Isoform 2 of Ornithine aminotransferase, mitochondrial OS=Homo sapiens OX=9606 GN=OAT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.05	28.0	1	1	1
PRT	sp|O00165-4|HAX1_HUMAN	Isoform 4 of HCLS1-associated protein X-1 OS=Homo sapiens OX=9606 GN=HAX1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.10	28.0	1	1	1
PRT	sp|Q14451-4|GRB7_HUMAN	Isoform 4 of Growth factor receptor-bound protein 7 OS=Homo sapiens OX=9606 GN=GRB7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|P22695|QCR2_HUMAN	Cytochrome b-c1 complex subunit 2, mitochondrial OS=Homo sapiens OX=9606 GN=UQCRC2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	315-UNIMOD:188	0.03	28.0	2	1	0
PRT	sp|Q9UPT5-2|EXOC7_HUMAN	Isoform 2 of Exocyst complex component 7 OS=Homo sapiens OX=9606 GN=EXOC7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|Q9UKF6|CPSF3_HUMAN	Cleavage and polyadenylation specificity factor subunit 3 OS=Homo sapiens OX=9606 GN=CPSF3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	381-UNIMOD:188,385-UNIMOD:188	0.03	28.0	1	1	1
PRT	sp|Q14571|ITPR2_HUMAN	Inositol 1,4,5-trisphosphate receptor type 2 OS=Homo sapiens OX=9606 GN=ITPR2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	393-UNIMOD:4	0.01	28.0	1	1	1
PRT	sp|Q9H4M9|EHD1_HUMAN	EH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=EHD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	87-UNIMOD:267	0.02	28.0	2	1	0
PRT	sp|P09622-2|DLDH_HUMAN	Isoform 2 of Dihydrolipoyl dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=DLD	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.05	28.0	1	1	1
PRT	sp|P22059|OSBP1_HUMAN	Oxysterol-binding protein 1 OS=Homo sapiens OX=9606 GN=OSBP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|Q9UG63|ABCF2_HUMAN	ATP-binding cassette sub-family F member 2 OS=Homo sapiens OX=9606 GN=ABCF2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	186-UNIMOD:4,188-UNIMOD:188,195-UNIMOD:267	0.03	28.0	1	1	1
PRT	sp|A0MZ66-2|SHOT1_HUMAN	Isoform 2 of Shootin-1 OS=Homo sapiens OX=9606 GN=SHTN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.04	28.0	1	1	1
PRT	sp|Q9NR30-2|DDX21_HUMAN	Isoform 2 of Nucleolar RNA helicase 2 OS=Homo sapiens OX=9606 GN=DDX21	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|O15382-2|BCAT2_HUMAN	Isoform B of Branched-chain-amino-acid aminotransferase, mitochondrial OS=Homo sapiens OX=9606 GN=BCAT2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	279-UNIMOD:267	0.06	28.0	1	1	1
PRT	sp|P00338-5|LDHA_HUMAN	Isoform 5 of L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	118-UNIMOD:188,126-UNIMOD:188	0.06	28.0	2	1	0
PRT	sp|O60264|SMCA5_HUMAN	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Homo sapiens OX=9606 GN=SMARCA5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	957-UNIMOD:4	0.02	28.0	1	1	0
PRT	sp|Q7Z4G4-3|TRM11_HUMAN	Isoform 3 of tRNA (guanine(10)-N2)-methyltransferase homolog OS=Homo sapiens OX=9606 GN=TRMT11	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.05	28.0	1	1	1
PRT	sp|O94979-5|SC31A_HUMAN	Isoform 5 of Protein transport protein Sec31A OS=Homo sapiens OX=9606 GN=SEC31A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|O60256-4|KPRB_HUMAN	Isoform 4 of Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Homo sapiens OX=9606 GN=PRPSAP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	163-UNIMOD:188	0.06	28.0	2	1	0
PRT	sp|Q9Y263|PLAP_HUMAN	Phospholipase A-2-activating protein OS=Homo sapiens OX=9606 GN=PLAA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	2	1	0
PRT	sp|Q9UKN8|TF3C4_HUMAN	General transcription factor 3C polypeptide 4 OS=Homo sapiens OX=9606 GN=GTF3C4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	598-UNIMOD:188,605-UNIMOD:188	0.02	28.0	1	1	1
PRT	sp|O95433-2|AHSA1_HUMAN	Isoform 2 of Activator of 90 kDa heat shock protein ATPase homolog 1 OS=Homo sapiens OX=9606 GN=AHSA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.09	28.0	1	1	1
PRT	sp|Q9Y295|DRG1_HUMAN	Developmentally-regulated GTP-binding protein 1 OS=Homo sapiens OX=9606 GN=DRG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	352-UNIMOD:188,366-UNIMOD:188	0.05	28.0	1	1	1
PRT	sp|Q9NYU2-2|UGGG1_HUMAN	Isoform 2 of UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	561-UNIMOD:188,571-UNIMOD:188	0.01	28.0	2	1	0
PRT	sp|P34932|HSP74_HUMAN	Heat shock 70 kDa protein 4 OS=Homo sapiens OX=9606 GN=HSPA4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	390-UNIMOD:267,405-UNIMOD:267	0.02	28.0	2	1	0
PRT	sp|P63167|DYL1_HUMAN	Dynein light chain 1, cytoplasmic OS=Homo sapiens OX=9606 GN=DYNLL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	36-UNIMOD:188,43-UNIMOD:188	0.15	28.0	1	1	1
PRT	sp|Q13813|SPTN1_HUMAN	Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	1066-UNIMOD:35,1067-UNIMOD:188,1082-UNIMOD:188	0.01	28.0	1	1	1
PRT	sp|P16989|YBOX3_HUMAN	Y-box-binding protein 3 OS=Homo sapiens OX=9606 GN=YBX3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null		0.07	28.0	1	1	1
PRT	sp|P48735|IDHP_HUMAN	Isocitrate dehydrogenase [NADP], mitochondrial OS=Homo sapiens OX=9606 GN=IDH2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	362-UNIMOD:267,377-UNIMOD:267	0.04	28.0	1	1	1
PRT	sp|O95757|HS74L_HUMAN	Heat shock 70 kDa protein 4L OS=Homo sapiens OX=9606 GN=HSPA4L PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|P12814|ACTN1_HUMAN	Alpha-actinin-1 OS=Homo sapiens OX=9606 GN=ACTN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null		0.03	28.0	1	1	0
PRT	sp|Q9Y5A7-2|NUB1_HUMAN	Isoform 2 of NEDD8 ultimate buster 1 OS=Homo sapiens OX=9606 GN=NUB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	400-UNIMOD:4	0.03	27.0	1	1	1
PRT	sp|P43897-3|EFTS_HUMAN	Isoform 3 of Elongation factor Ts, mitochondrial OS=Homo sapiens OX=9606 GN=TSFM	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	71-UNIMOD:4,76-UNIMOD:188,84-UNIMOD:188	0.11	27.0	1	1	1
PRT	sp|Q99873-5|ANM1_HUMAN	Isoform 4 of Protein arginine N-methyltransferase 1 OS=Homo sapiens OX=9606 GN=PRMT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	116-UNIMOD:188,125-UNIMOD:188	0.05	27.0	2	1	0
PRT	sp|Q8IYB5-3|SMAP1_HUMAN	Isoform 3 of Stromal membrane-associated protein 1 OS=Homo sapiens OX=9606 GN=SMAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|Q8IW45|NNRD_HUMAN	ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Homo sapiens OX=9606 GN=NAXD PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.07	27.0	1	1	1
PRT	sp|Q9NV96-3|CC50A_HUMAN	Isoform 3 of Cell cycle control protein 50A OS=Homo sapiens OX=9606 GN=TMEM30A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	96-UNIMOD:267,107-UNIMOD:267	0.06	27.0	4	1	0
PRT	sp|O00571-2|DDX3X_HUMAN	Isoform 2 of ATP-dependent RNA helicase DDX3X OS=Homo sapiens OX=9606 GN=DDX3X	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	301-UNIMOD:4	0.02	27.0	1	1	1
PRT	sp|Q9Y6Y8-2|S23IP_HUMAN	Isoform 2 of SEC23-interacting protein OS=Homo sapiens OX=9606 GN=SEC23IP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|P57740-3|NU107_HUMAN	Isoform 3 of Nuclear pore complex protein Nup107 OS=Homo sapiens OX=9606 GN=NUP107	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	575-UNIMOD:188,577-UNIMOD:188,366-UNIMOD:188	0.04	27.0	3	2	1
PRT	sp|P15927|RFA2_HUMAN	Replication protein A 32 kDa subunit OS=Homo sapiens OX=9606 GN=RPA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	85-UNIMOD:188,93-UNIMOD:188	0.05	27.0	2	1	0
PRT	sp|P36542-2|ATPG_HUMAN	Isoform Heart of ATP synthase subunit gamma, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	100-UNIMOD:267	0.04	27.0	2	1	0
PRT	sp|Q9NTJ3-2|SMC4_HUMAN	Isoform 2 of Structural maintenance of chromosomes protein 4 OS=Homo sapiens OX=9606 GN=SMC4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	349-UNIMOD:188,354-UNIMOD:188,190-UNIMOD:4	0.02	27.0	2	2	2
PRT	sp|P17655-2|CAN2_HUMAN	Isoform 2 of Calpain-2 catalytic subunit OS=Homo sapiens OX=9606 GN=CAPN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|P62277|RS13_HUMAN	40S ribosomal protein S13 OS=Homo sapiens OX=9606 GN=RPS13 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.09	27.0	1	1	1
PRT	sp|P13797-3|PLST_HUMAN	Isoform 3 of Plastin-3 OS=Homo sapiens OX=9606 GN=PLS3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	418-UNIMOD:4	0.03	27.0	1	1	1
PRT	sp|P54577|SYYC_HUMAN	Tyrosine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=YARS1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	146-UNIMOD:188,147-UNIMOD:188,222-UNIMOD:188	0.05	27.0	4	2	0
PRT	sp|Q9H0U4|RAB1B_HUMAN	Ras-related protein Rab-1B OS=Homo sapiens OX=9606 GN=RAB1B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	173-UNIMOD:35	0.08	27.0	1	1	1
PRT	sp|Q96BW9-2|TAM41_HUMAN	Isoform 2 of Phosphatidate cytidylyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=TAMM41	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	285-UNIMOD:4	0.07	27.0	1	1	1
PRT	sp|P46087-2|NOP2_HUMAN	Isoform 2 of Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase OS=Homo sapiens OX=9606 GN=NOP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|Q8WU79-3|SMAP2_HUMAN	Isoform 3 of Stromal membrane-associated protein 2 OS=Homo sapiens OX=9606 GN=SMAP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.04	27.0	1	1	1
PRT	sp|Q9H4A4|AMPB_HUMAN	Aminopeptidase B OS=Homo sapiens OX=9606 GN=RNPEP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|Q96BD0-2|SO4A1_HUMAN	Isoform 2 of Solute carrier organic anion transporter family member 4A1 OS=Homo sapiens OX=9606 GN=SLCO4A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	56-UNIMOD:188,60-UNIMOD:4,66-UNIMOD:188	0.04	27.0	1	1	1
PRT	sp|Q9Y3F4|STRAP_HUMAN	Serine-threonine kinase receptor-associated protein OS=Homo sapiens OX=9606 GN=STRAP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.08	27.0	1	1	1
PRT	sp|Q13618-3|CUL3_HUMAN	Isoform 3 of Cullin-3 OS=Homo sapiens OX=9606 GN=CUL3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	585-UNIMOD:188,602-UNIMOD:188	0.03	27.0	1	1	1
PRT	sp|Q8NFH5-2|NUP35_HUMAN	Isoform 2 of Nucleoporin NUP35 OS=Homo sapiens OX=9606 GN=NUP35	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	66-UNIMOD:188	0.06	27.0	2	1	0
PRT	sp|Q8TCC3|RM30_HUMAN	39S ribosomal protein L30, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL30 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.11	27.0	1	1	1
PRT	sp|Q5U5X0|LYRM7_HUMAN	Complex III assembly factor LYRM7 OS=Homo sapiens OX=9606 GN=LYRM7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	82-UNIMOD:188	0.15	27.0	2	1	0
PRT	sp|Q9Y678|COPG1_HUMAN	Coatomer subunit gamma-1 OS=Homo sapiens OX=9606 GN=COPG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	325-UNIMOD:4,465-UNIMOD:188	0.04	27.0	3	2	1
PRT	sp|Q9Y2G1-2|MYRF_HUMAN	Isoform 2 of Myelin regulatory factor OS=Homo sapiens OX=9606 GN=MYRF	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|Q8TEM1|PO210_HUMAN	Nuclear pore membrane glycoprotein 210 OS=Homo sapiens OX=9606 GN=NUP210 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	2	1	0
PRT	sp|Q6FI13|H2A2A_HUMAN	Histone H2A type 2-A OS=Homo sapiens OX=9606 GN=HIST2H2AA3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.15	27.0	1	1	1
PRT	sp|P07203|GPX1_HUMAN	Glutathione peroxidase 1 OS=Homo sapiens OX=9606 GN=GPX1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.09	27.0	2	1	0
PRT	sp|Q9UNM6|PSD13_HUMAN	26S proteasome non-ATPase regulatory subunit 13 OS=Homo sapiens OX=9606 GN=PSMD13 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	174-UNIMOD:188,178-UNIMOD:267	0.05	27.0	1	1	1
PRT	sp|P04004|VTNC_HUMAN	Vitronectin OS=Homo sapiens OX=9606 GN=VTN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.04	27.0	1	1	1
PRT	sp|Q9UDT6|CLIP2_HUMAN	CAP-Gly domain-containing linker protein 2 OS=Homo sapiens OX=9606 GN=CLIP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|Q9BRA2|TXD17_HUMAN	Thioredoxin domain-containing protein 17 OS=Homo sapiens OX=9606 GN=TXNDC17 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.15	27.0	1	1	1
PRT	sp|A4D1Z8|GRIFN_HUMAN	Grifin OS=Homo sapiens OX=9606 GN=GRIFIN PE=2 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	1-UNIMOD:1,6-UNIMOD:188,9-UNIMOD:4	0.13	27.0	1	1	1
PRT	sp|Q96HS1-2|PGAM5_HUMAN	Isoform 2 of Serine/threonine-protein phosphatase PGAM5, mitochondrial OS=Homo sapiens OX=9606 GN=PGAM5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	229-UNIMOD:4	0.09	26.0	1	1	1
PRT	sp|P16422|EPCAM_HUMAN	Epithelial cell adhesion molecule OS=Homo sapiens OX=9606 GN=EPCAM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.04	26.0	1	1	1
PRT	sp|Q15942|ZYX_HUMAN	Zyxin OS=Homo sapiens OX=9606 GN=ZYX PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	33-UNIMOD:188,35-UNIMOD:188	0.02	26.0	2	1	0
PRT	sp|P07437|TBB5_HUMAN	Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.06	26.0	1	1	1
PRT	sp|Q9GZL7|WDR12_HUMAN	Ribosome biogenesis protein WDR12 OS=Homo sapiens OX=9606 GN=WDR12 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	203-UNIMOD:188,205-UNIMOD:4,211-UNIMOD:188	0.06	26.0	1	1	1
PRT	sp|P60900|PSA6_HUMAN	Proteasome subunit alpha type-6 OS=Homo sapiens OX=9606 GN=PSMA6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.04	26.0	1	1	1
PRT	sp|Q96T37-4|RBM15_HUMAN	Isoform 4 of RNA-binding protein 15 OS=Homo sapiens OX=9606 GN=RBM15	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	2	1	0
PRT	sp|Q13263-2|TIF1B_HUMAN	Isoform 2 of Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	330-UNIMOD:267,345-UNIMOD:267	0.03	26.0	1	1	1
PRT	sp|P15311|EZRI_HUMAN	Ezrin OS=Homo sapiens OX=9606 GN=EZR PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q9HCC0|MCCB_HUMAN	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial OS=Homo sapiens OX=9606 GN=MCCC2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|Q14247|SRC8_HUMAN	Src substrate cortactin OS=Homo sapiens OX=9606 GN=CTTN PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|P78330|SERB_HUMAN	Phosphoserine phosphatase OS=Homo sapiens OX=9606 GN=PSPH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.07	26.0	1	1	1
PRT	sp|P53634|CATC_HUMAN	Dipeptidyl peptidase 1 OS=Homo sapiens OX=9606 GN=CTSC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|P59998|ARPC4_HUMAN	Actin-related protein 2/3 complex subunit 4 OS=Homo sapiens OX=9606 GN=ARPC4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	87-UNIMOD:4	0.08	26.0	1	1	1
PRT	sp|Q58FF7|H90B3_HUMAN	Putative heat shock protein HSP 90-beta-3 OS=Homo sapiens OX=9606 GN=HSP90AB3P PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q9H0D6-2|XRN2_HUMAN	Isoform 2 of 5'-3' exoribonuclease 2 OS=Homo sapiens OX=9606 GN=XRN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	20-UNIMOD:267,32-UNIMOD:267	0.02	26.0	1	1	1
PRT	sp|P06396-3|GELS_HUMAN	Isoform 3 of Gelsolin OS=Homo sapiens OX=9606 GN=GSN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	291-UNIMOD:4,298-UNIMOD:188,301-UNIMOD:188	0.02	26.0	2	1	0
PRT	sp|Q16204|CCDC6_HUMAN	Coiled-coil domain-containing protein 6 OS=Homo sapiens OX=9606 GN=CCDC6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	55-UNIMOD:267,62-UNIMOD:267	0.04	26.0	2	1	0
PRT	sp|O00629|IMA3_HUMAN	Importin subunit alpha-3 OS=Homo sapiens OX=9606 GN=KPNA4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	122-UNIMOD:4	0.03	26.0	1	1	1
PRT	sp|P49748-2|ACADV_HUMAN	Isoform 2 of Very long-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ACADVL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	578-UNIMOD:188	0.02	26.0	2	1	0
PRT	sp|P62269|RS18_HUMAN	40S ribosomal protein S18 OS=Homo sapiens OX=9606 GN=RPS18 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1	0.09	26.0	1	1	1
PRT	sp|O75955|FLOT1_HUMAN	Flotillin-1 OS=Homo sapiens OX=9606 GN=FLOT1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	109-UNIMOD:267	0.04	26.0	1	1	1
PRT	sp|P78371-2|TCPB_HUMAN	Isoform 2 of T-complex protein 1 subunit beta OS=Homo sapiens OX=9606 GN=CCT2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	365-UNIMOD:4	0.06	26.0	1	1	1
PRT	sp|Q8TCZ2-6|C99L2_HUMAN	Isoform 6 of CD99 antigen-like protein 2 OS=Homo sapiens OX=9606 GN=CD99L2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	188-UNIMOD:267	0.11	26.0	1	1	1
PRT	sp|P11142|HSP7C_HUMAN	Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.03	26.0	2	1	0
PRT	sp|P27824|CALX_HUMAN	Calnexin OS=Homo sapiens OX=9606 GN=CANX PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	401-UNIMOD:188,415-UNIMOD:267	0.03	26.0	1	1	0
PRT	sp|P60842|IF4A1_HUMAN	Eukaryotic initiation factor 4A-I OS=Homo sapiens OX=9606 GN=EIF4A1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	309-UNIMOD:188,311-UNIMOD:267	0.04	26.0	1	1	0
PRT	sp|Q05048|CSTF1_HUMAN	Cleavage stimulation factor subunit 1 OS=Homo sapiens OX=9606 GN=CSTF1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	178-UNIMOD:4	0.06	26.0	1	1	1
PRT	sp|P06753-2|TPM3_HUMAN	Isoform 2 of Tropomyosin alpha-3 chain OS=Homo sapiens OX=9606 GN=TPM3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	26.0	null	226-UNIMOD:4,233-UNIMOD:4,226-UNIMOD:385,228-UNIMOD:188,236-UNIMOD:267	0.05	26.0	3	1	0
PRT	sp|Q15185|TEBP_HUMAN	Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	40-UNIMOD:4	0.10	26.0	1	1	0
PRT	sp|Q9GZT3|SLIRP_HUMAN	SRA stem-loop-interacting RNA-binding protein, mitochondrial OS=Homo sapiens OX=9606 GN=SLIRP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	null	48-UNIMOD:385,48-UNIMOD:4,54-UNIMOD:188,60-UNIMOD:267	0.13	26.0	3	1	0
PRT	sp|P69905|HBA_HUMAN	Hemoglobin subunit alpha OS=Homo sapiens OX=9606 GN=HBA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.11	26.0	1	1	1
PRT	sp|P28370|SMCA1_HUMAN	Probable global transcription activator SNF2L1 OS=Homo sapiens OX=9606 GN=SMARCA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	968-UNIMOD:267,972-UNIMOD:4,976-UNIMOD:188	0.02	26.0	1	1	0
PRT	sp|Q9UFC0|LRWD1_HUMAN	Leucine-rich repeat and WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=LRWD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	72-UNIMOD:267	0.04	26.0	1	1	1
PRT	sp|Q9Y277|VDAC3_HUMAN	Voltage-dependent anion-selective channel protein 3 OS=Homo sapiens OX=9606 GN=VDAC3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	197-UNIMOD:188	0.08	25.0	1	1	1
PRT	sp|Q9Y530|OARD1_HUMAN	ADP-ribose glycohydrolase OARD1 OS=Homo sapiens OX=9606 GN=OARD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	90-UNIMOD:188,98-UNIMOD:188	0.09	25.0	1	1	1
PRT	sp|P45880-2|VDAC2_HUMAN	Isoform 2 of Voltage-dependent anion-selective channel protein 2 OS=Homo sapiens OX=9606 GN=VDAC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	20-UNIMOD:188,28-UNIMOD:188	0.05	25.0	2	1	0
PRT	sp|P41743|KPCI_HUMAN	Protein kinase C iota type OS=Homo sapiens OX=9606 GN=PRKCI PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	380-UNIMOD:188,393-UNIMOD:188	0.03	25.0	2	1	0
PRT	sp|P51812|KS6A3_HUMAN	Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens OX=9606 GN=RPS6KA3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q5VTE0|EF1A3_HUMAN	Putative elongation factor 1-alpha-like 3 OS=Homo sapiens OX=9606 GN=EEF1A1P5 PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	146-UNIMOD:188	0.03	25.0	1	1	1
PRT	sp|P38646|GRP75_HUMAN	Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	2	1	0
PRT	sp|O43615|TIM44_HUMAN	Mitochondrial import inner membrane translocase subunit TIM44 OS=Homo sapiens OX=9606 GN=TIMM44 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q15393|SF3B3_HUMAN	Splicing factor 3B subunit 3 OS=Homo sapiens OX=9606 GN=SF3B3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q14690|RRP5_HUMAN	Protein RRP5 homolog OS=Homo sapiens OX=9606 GN=PDCD11 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|P78504-2|JAG1_HUMAN	Isoform 2 of Protein jagged-1 OS=Homo sapiens OX=9606 GN=JAG1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|Q86UV5-5|UBP48_HUMAN	Isoform 5 of Ubiquitin carboxyl-terminal hydrolase 48 OS=Homo sapiens OX=9606 GN=USP48	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q92541|RTF1_HUMAN	RNA polymerase-associated protein RTF1 homolog OS=Homo sapiens OX=9606 GN=RTF1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|P41223|BUD31_HUMAN	Protein BUD31 homolog OS=Homo sapiens OX=9606 GN=BUD31 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.08	25.0	1	1	1
PRT	sp|Q92522|H1X_HUMAN	Histone H1x OS=Homo sapiens OX=9606 GN=H1FX PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.06	25.0	1	1	1
PRT	sp|Q9BTE7|DCNL5_HUMAN	DCN1-like protein 5 OS=Homo sapiens OX=9606 GN=DCUN1D5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null	49-UNIMOD:188,50-UNIMOD:188	0.05	25.0	2	1	0
PRT	sp|Q9BPW8|NIPS1_HUMAN	Protein NipSnap homolog 1 OS=Homo sapiens OX=9606 GN=NIPSNAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.06	25.0	1	1	1
PRT	sp|Q14980-2|NUMA1_HUMAN	Isoform 2 of Nuclear mitotic apparatus protein 1 OS=Homo sapiens OX=9606 GN=NUMA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|O60930|RNH1_HUMAN	Ribonuclease H1 OS=Homo sapiens OX=9606 GN=RNASEH1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.07	25.0	1	1	1
PRT	sp|P11586|C1TC_HUMAN	C-1-tetrahydrofolate synthase, cytoplasmic OS=Homo sapiens OX=9606 GN=MTHFD1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	706-UNIMOD:35,721-UNIMOD:188	0.02	25.0	1	1	1
PRT	sp|Q15459-2|SF3A1_HUMAN	Isoform 2 of Splicing factor 3A subunit 1 OS=Homo sapiens OX=9606 GN=SF3A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	20-UNIMOD:188	0.03	25.0	1	1	1
PRT	sp|Q14978|NOLC1_HUMAN	Nucleolar and coiled-body phosphoprotein 1 OS=Homo sapiens OX=9606 GN=NOLC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	648-UNIMOD:267,657-UNIMOD:267	0.02	25.0	2	1	0
PRT	sp|Q9UN37|VPS4A_HUMAN	Vacuolar protein sorting-associated protein 4A OS=Homo sapiens OX=9606 GN=VPS4A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q96A33-2|CCD47_HUMAN	Isoform 2 of Coiled-coil domain-containing protein 47 OS=Homo sapiens OX=9606 GN=CCDC47	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	227-UNIMOD:267,236-UNIMOD:267	0.02	25.0	2	1	0
PRT	sp|Q9H0J9|PAR12_HUMAN	Protein mono-ADP-ribosyltransferase PARP12 OS=Homo sapiens OX=9606 GN=PARP12 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q15642-5|CIP4_HUMAN	Isoform 5 of Cdc42-interacting protein 4 OS=Homo sapiens OX=9606 GN=TRIP10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	187-UNIMOD:188,196-UNIMOD:267	0.05	25.0	1	1	1
PRT	sp|Q8TEQ6|GEMI5_HUMAN	Gem-associated protein 5 OS=Homo sapiens OX=9606 GN=GEMIN5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	860-UNIMOD:188,867-UNIMOD:4,874-UNIMOD:188	0.01	25.0	1	1	1
PRT	sp|Q8NBX0|SCPDL_HUMAN	Saccharopine dehydrogenase-like oxidoreductase OS=Homo sapiens OX=9606 GN=SCCPDH PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|P62760|VISL1_HUMAN	Visinin-like protein 1 OS=Homo sapiens OX=9606 GN=VSNL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.08	25.0	1	1	1
PRT	sp|Q9NVA2|SEP11_HUMAN	Septin-11 OS=Homo sapiens OX=9606 GN=SEPTIN11 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null		0.06	25.0	2	1	0
PRT	sp|Q06210-2|GFPT1_HUMAN	Isoform 2 of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 OS=Homo sapiens OX=9606 GN=GFPT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	202-UNIMOD:267	0.02	25.0	1	1	1
PRT	sp|Q7L014|DDX46_HUMAN	Probable ATP-dependent RNA helicase DDX46 OS=Homo sapiens OX=9606 GN=DDX46 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q08380|LG3BP_HUMAN	Galectin-3-binding protein OS=Homo sapiens OX=9606 GN=LGALS3BP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q96J02-3|ITCH_HUMAN	Isoform 3 of E3 ubiquitin-protein ligase Itchy homolog OS=Homo sapiens OX=9606 GN=ITCH	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|Q8N6R0-3|EFNMT_HUMAN	Isoform 3 of eEF1A lysine and N-terminal methyltransferase OS=Homo sapiens OX=9606 GN=EEF1AKNMT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q9NR30|DDX21_HUMAN	Nucleolar RNA helicase 2 OS=Homo sapiens OX=9606 GN=DDX21 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	161-UNIMOD:4	0.05	25.0	1	1	1
PRT	sp|Q7L3B6|CD37L_HUMAN	Hsp90 co-chaperone Cdc37-like 1 OS=Homo sapiens OX=9606 GN=CDC37L1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.06	25.0	1	1	1
PRT	sp|Q9UNX3|RL26L_HUMAN	60S ribosomal protein L26-like 1 OS=Homo sapiens OX=9606 GN=RPL26L1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	103-UNIMOD:188	0.10	25.0	2	1	0
PRT	sp|G9CGD6-3|CNIPF_HUMAN	Isoform CNK3-IPCEF1-3 of CNK3/IPCEF1 fusion protein OS=Homo sapiens OX=9606 GN=CNK3/IPCEF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	null	463-UNIMOD:35,467-UNIMOD:35	0.02	25.0	1	1	1
PRT	sp|P61247|RS3A_HUMAN	40S ribosomal protein S3a OS=Homo sapiens OX=9606 GN=RPS3A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	201-UNIMOD:4,213-UNIMOD:267	0.06	24.0	1	1	1
PRT	sp|Q9Y520-2|PRC2C_HUMAN	Isoform 2 of Protein PRRC2C OS=Homo sapiens OX=9606 GN=PRRC2C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q6PJ69|TRI65_HUMAN	Tripartite motif-containing protein 65 OS=Homo sapiens OX=9606 GN=TRIM65 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|Q14240|IF4A2_HUMAN	Eukaryotic initiation factor 4A-II OS=Homo sapiens OX=9606 GN=EIF4A2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|O76094-2|SRP72_HUMAN	Isoform 2 of Signal recognition particle subunit SRP72 OS=Homo sapiens OX=9606 GN=SRP72	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	437-UNIMOD:188,439-UNIMOD:188	0.04	24.0	1	1	1
PRT	sp|Q04726-2|TLE3_HUMAN	Isoform 2 of Transducin-like enhancer protein 3 OS=Homo sapiens OX=9606 GN=TLE3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q14676-4|MDC1_HUMAN	Isoform 4 of Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens OX=9606 GN=MDC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	934-UNIMOD:267	0.01	24.0	1	1	1
PRT	sp|P46013-2|KI67_HUMAN	Isoform Short of Proliferation marker protein Ki-67 OS=Homo sapiens OX=9606 GN=MKI67	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	1343-UNIMOD:188,1364-UNIMOD:188	0.01	24.0	1	1	1
PRT	sp|O00410-2|IPO5_HUMAN	Isoform 2 of Importin-5 OS=Homo sapiens OX=9606 GN=IPO5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	169-UNIMOD:4,178-UNIMOD:188	0.03	24.0	2	1	0
PRT	sp|Q86XP3-2|DDX42_HUMAN	Isoform 2 of ATP-dependent RNA helicase DDX42 OS=Homo sapiens OX=9606 GN=DDX42	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|P26641|EF1G_HUMAN	Elongation factor 1-gamma OS=Homo sapiens OX=9606 GN=EEF1G PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	194-UNIMOD:4	0.05	24.0	1	1	1
PRT	sp|P14868-2|SYDC_HUMAN	Isoform 2 of Aspartate--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=DARS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	234-UNIMOD:4	0.04	24.0	1	1	1
PRT	sp|P23919-2|KTHY_HUMAN	Isoform 2 of Thymidylate kinase OS=Homo sapiens OX=9606 GN=DTYMK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	5-UNIMOD:267,16-UNIMOD:267	0.07	24.0	1	1	1
PRT	sp|Q08945|SSRP1_HUMAN	FACT complex subunit SSRP1 OS=Homo sapiens OX=9606 GN=SSRP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|P06576|ATPB_HUMAN	ATP synthase subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|P12955-3|PEPD_HUMAN	Isoform 3 of Xaa-Pro dipeptidase OS=Homo sapiens OX=9606 GN=PEPD	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|P54652|HSP72_HUMAN	Heat shock-related 70 kDa protein 2 OS=Homo sapiens OX=9606 GN=HSPA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|O60506|HNRPQ_HUMAN	Heterogeneous nuclear ribonucleoprotein Q OS=Homo sapiens OX=9606 GN=SYNCRIP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	237-UNIMOD:4,244-UNIMOD:267	0.02	24.0	1	1	1
PRT	sp|P22314|UBA1_HUMAN	Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.02	24.0	1	1	0
PRT	sp|Q06124|PTN11_HUMAN	Tyrosine-protein phosphatase non-receptor type 11 OS=Homo sapiens OX=9606 GN=PTPN11 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.04	24.0	1	1	0
PRT	sp|P62191|PRS4_HUMAN	26S proteasome regulatory subunit 4 OS=Homo sapiens OX=9606 GN=PSMC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	293-UNIMOD:188,294-UNIMOD:267	0.05	24.0	1	1	0
PRT	sp|P43686|PRS6B_HUMAN	26S proteasome regulatory subunit 6B OS=Homo sapiens OX=9606 GN=PSMC4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	409-UNIMOD:188,418-UNIMOD:188	0.03	24.0	1	1	1
PRT	sp|A0AVT1|UBA6_HUMAN	Ubiquitin-like modifier-activating enzyme 6 OS=Homo sapiens OX=9606 GN=UBA6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	721-UNIMOD:4,727-UNIMOD:267	0.01	24.0	1	1	1
PRT	sp|P02768|ALBU_HUMAN	Serum albumin OS=Homo sapiens OX=9606 GN=ALB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|O14990|IPP2C_HUMAN	Protein phosphatase inhibitor 2 family member C OS=Homo sapiens OX=9606 GN=PPP1R2C PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	40-UNIMOD:188	0.12	24.0	1	1	1
PRT	sp|Q14997|PSME4_HUMAN	Proteasome activator complex subunit 4 OS=Homo sapiens OX=9606 GN=PSME4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q9Y6K1|DNM3A_HUMAN	DNA (cytosine-5)-methyltransferase 3A OS=Homo sapiens OX=9606 GN=DNMT3A PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	621-UNIMOD:188	0.02	24.0	1	1	1
PRT	sp|Q9BYB0|SHAN3_HUMAN	SH3 and multiple ankyrin repeat domains protein 3 OS=Homo sapiens OX=9606 GN=SHANK3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	1509-UNIMOD:267,1527-UNIMOD:188	0.01	24.0	1	1	1
PRT	sp|P28290|ITPI2_HUMAN	Protein ITPRID2 OS=Homo sapiens OX=9606 GN=ITPRID2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	976-UNIMOD:35	0.02	24.0	1	1	1
PRT	sp|P16444|DPEP1_HUMAN	Dipeptidase 1 OS=Homo sapiens OX=9606 GN=DPEP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	154-UNIMOD:267	0.06	24.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	GHVSSHDEQQVEAGAVQLR	1	sp|Q92667-2|AKAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	19-UNIMOD:267	ms_run[2]:scan=4000	26.404	2	2055.9961	2055.9961	K	A	31	50
PSM	GHYTEGAELVDSVLDVVRK	2	sp|Q13509|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0		ms_run[2]:scan=11120	71.645	2	2086.0695	2086.0695	K	E	104	123
PSM	MRYVASYLLAALGGNSSPSAK	3	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	1-UNIMOD:35	ms_run[2]:scan=10522	67.505	2	2171.1045	2171.1045	-	D	1	22
PSM	GNFGGSFAGSFGGAGGHAPGVAR	4	sp|P52272-2|HNRPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0		ms_run[2]:scan=6910	44.185	2	2033.9456	2033.9456	R	K	589	612
PSM	KVEHEISEGNVATAAAAALASAATK	5	sp|Q92922|SMRC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0		ms_run[2]:scan=9212	58.862	2	2409.25	2409.2500	K	A	856	881
PSM	TNHIGHTGYLNTVTVSPDGSLCASGGK	6	sp|P63244|RACK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	22-UNIMOD:4	ms_run[2]:scan=6099	39.186	2	2742.3031	2742.3031	K	D	186	213
PSM	WNTEDKVSHVSTGGGASLELLEGK	7	sp|P00558-2|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0		ms_run[2]:scan=7398	47.218	2	2513.2398	2513.2398	K	V	355	379
PSM	HIDCAAIYGNEPEIGEALKEDVGPGK	8	sp|P14550|AK1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	4-UNIMOD:4,19-UNIMOD:188,26-UNIMOD:188	ms_run[2]:scan=8203	52.28	3	2793.3682	2793.3682	R	A	43	69
PSM	SHTSEGAHLDITPNSGAAGNSAGPK	9	sp|Q92597-3|NDRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	25-UNIMOD:188	ms_run[2]:scan=3381	22.686	2	2381.1303	2381.1303	R	S	283	308
PSM	DKVAGHSLGYGFVNYVTAK	10	sp|Q15717|ELAV1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0		ms_run[2]:scan=7708	49.142	2	2025.032	2025.0320	R	D	54	73
PSM	GNFGGSFAGSFGGAGGHAPGVAR	11	sp|P52272-2|HNRPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	23-UNIMOD:267	ms_run[2]:scan=6909	44.179	2	2043.9539	2043.9539	R	K	589	612
PSM	HIDCAAIYGNEPEIGEALKEDVGPGK	12	sp|P14550|AK1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	4-UNIMOD:4	ms_run[2]:scan=8192	52.211	3	2781.328	2781.3280	R	A	43	69
PSM	HIIENAKQDVDDEYGVSQALAR	13	sp|P51532-5|SMCA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0		ms_run[2]:scan=6550	41.957	3	2470.2088	2470.2088	R	G	705	727
PSM	HTAMVSWGGVSIPNSPFR	14	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	18-UNIMOD:267	ms_run[2]:scan=10004	64.103	2	1951.9602	1951.9602	K	V	743	761
PSM	HVNGQDQIVPGLYACGEAACASVHGANR	15	sp|P31040-3|SDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	15-UNIMOD:4,20-UNIMOD:4	ms_run[2]:scan=7318	46.702	3	2950.3563	2950.3563	R	L	279	307
PSM	KDHADVSNQLYACYAIGK	16	sp|P21281|VATB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	13-UNIMOD:4	ms_run[2]:scan=5955	38.304	2	2051.9735	2051.9735	R	D	413	431
PSM	KEGGLGPLNIPLLADVTR	17	sp|P32119|PRDX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0		ms_run[2]:scan=12033	78.305	2	1862.0625	1862.0625	R	R	92	110
PSM	KNDPQSITADDLHQLLVVAR	18	sp|Q9BTE3-3|MCMBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0		ms_run[2]:scan=9952	63.764	2	2232.1862	2232.1862	R	C	407	427
PSM	TNHIGHTGYLNTVTVSPDGSLCASGGK	19	sp|P63244|RACK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	22-UNIMOD:4,27-UNIMOD:188	ms_run[2]:scan=6096	39.168	2	2748.3233	2748.3233	K	D	186	213
PSM	TFEHVTSEIGAEEAEEVGVEHLLR	20	sp|P51665|PSMD7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46.0		ms_run[1]:scan=9986	63.9853	3	2680.310084	2680.298040	K	D	154	178
PSM	GHVSSHDEQQVEAGAVQLR	21	sp|Q92667-2|AKAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=4012	26.474	2	2045.9879	2045.9879	K	A	31	50
PSM	GSHLDQGEAAVAFKPTSNR	22	sp|Q12929-2|EPS8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=4279	28.108	2	1983.9763	1983.9763	R	H	241	260
PSM	HAAENPGKYNILGTNTIMDK	23	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=6431	41.222	2	2186.079	2186.0790	K	M	498	518
PSM	HIYYITGETKDQVANSAFVER	24	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=6464	41.403	2	2440.2023	2440.2023	K	L	490	511
PSM	HQGVMVGMGQKDSYVGDEAQSK	25	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	11-UNIMOD:188,22-UNIMOD:188	ms_run[2]:scan=4368	28.653	2	2362.1084	2362.1084	R	R	40	62
PSM	IKGGADVSGGVSAPDISLGEGHLSVK	26	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	2-UNIMOD:188,26-UNIMOD:188	ms_run[2]:scan=7197	45.944	2	2461.3215	2461.3215	K	G	5566	5592
PSM	RGYQLSDVDGVTCEDIDECALPTGGHICSYR	27	sp|P23142-2|FBLN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	13-UNIMOD:4,19-UNIMOD:4,28-UNIMOD:4	ms_run[2]:scan=8426	53.734	3	3542.5501	3542.5501	R	C	467	498
PSM	SHMMDVQGSTQDSAIKDFVLK	28	sp|P13667|PDIA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=7897	50.311	2	2336.1141	2336.1141	R	Y	371	392
PSM	TFEHVTSEIGAEEAEEVGVEHLLR	29	sp|P51665|PSMD7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	24-UNIMOD:267	ms_run[2]:scan=9985	63.979	3	2690.3063	2690.3063	K	D	154	178
PSM	AHDGGIYAISWSPDSTHLLSASGDK	30	sp|O75083-3|WDR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	25-UNIMOD:188	ms_run[2]:scan=8981	57.382	3	2590.2395	2590.2395	K	T	92	117
PSM	FNAHGDANTIVCNSKDGGAWGTEQR	31	sp|P09382|LEG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	12-UNIMOD:4	ms_run[2]:scan=5333	34.475	3	2704.2048	2704.2048	R	E	50	75
PSM	GHDDLGDHYLDCGDLSNALK	32	sp|Q13098-5|CSN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	12-UNIMOD:4	ms_run[2]:scan=7497	47.83	2	2213.9648	2213.9648	R	C	160	180
PSM	GHDDLGDHYLDCGDLSNALK	33	sp|Q13098-5|CSN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	12-UNIMOD:4,20-UNIMOD:188	ms_run[2]:scan=7507	47.889	2	2219.9849	2219.9849	R	C	160	180
PSM	HAAENPGKYNILGTNTIMDK	34	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	8-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=6443	41.29	2	2198.1193	2198.1193	K	M	498	518
PSM	HEVTICNYEASANPADHR	35	sp|Q9GZP4-2|PITH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	6-UNIMOD:4,18-UNIMOD:267	ms_run[2]:scan=4342	28.494	2	2092.926	2092.9260	R	V	181	199
PSM	HVNGQDQIVPGLYACGEAACASVHGANR	36	sp|P31040-3|SDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	15-UNIMOD:4,20-UNIMOD:4,28-UNIMOD:267	ms_run[2]:scan=7308	46.643	3	2960.3645	2960.3645	R	L	279	307
PSM	KDHADVSNQLYACYAIGK	37	sp|P21281|VATB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	1-UNIMOD:188,13-UNIMOD:4,18-UNIMOD:188	ms_run[2]:scan=5962	38.349	2	2064.0137	2064.0137	R	D	413	431
PSM	KPTDGASSSNCVTDISHLVR	38	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	11-UNIMOD:4	ms_run[2]:scan=6078	39.055	2	2143.0328	2143.0328	R	K	698	718
PSM	NVLSDSRPAMAPGSSHLGAPASTTTAADATPSGSLAR	39	sp|Q9BR76|COR1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=6289	40.352	3	3521.7169	3521.7169	R	A	410	447
PSM	SEASAFGASHHVAYFEASAK	40	sp|P10301|RRAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	20-UNIMOD:188	ms_run[2]:scan=5624	36.282	2	2071.9695	2071.9695	R	L	155	175
PSM	SGYHQSASEHGLVVIAPDTSPR	41	sp|P10768|ESTD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=5155	33.401	2	2307.1244	2307.1244	K	G	65	87
PSM	STDHPKYSDMIVAAIQAEK	42	sp|P07305-2|H10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	6-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=8573	54.678	2	2115.0709	2115.0709	K	N	5	24
PSM	TFEHVTSEIGAEEAEEVGVEHLLR	43	sp|P51665|PSMD7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	24-UNIMOD:267	ms_run[2]:scan=9988	63.997	2	2690.3063	2690.3063	K	D	154	178
PSM	VLHEAEGHIVTCETNTGEVYR	44	sp|P62318-2|SMD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	12-UNIMOD:4	ms_run[2]:scan=4613	30.143	2	2413.1332	2413.1332	K	G	9	30
PSM	AHEGEIEDLALGPDGKLVTVGR	45	sp|Q9HCU5|PREB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=7890	50.263	2	2275.1808	2275.1808	K	D	194	216
PSM	ALQALQQEHKAEIITVSDGR	46	sp|Q9BRG1|VPS25_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=5695	36.724	2	2206.1706	2206.1706	R	G	152	172
PSM	ALVDHENVISCPHLGASTK	47	sp|O43175|SERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	11-UNIMOD:4,19-UNIMOD:188	ms_run[2]:scan=5438	35.131	2	2053.0358	2053.0358	R	E	271	290
PSM	EKYPSHSFIGEESVAAGEK	48	sp|P29218-2|IMPA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	2-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=4803	31.28	2	2076.0203	2076.0203	K	S	60	79
PSM	GHASAPYFGKEEPSVAPSSTGK	49	sp|Q8N183|NDUF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=4321	28.364	2	2203.0546	2203.0546	K	T	131	153
PSM	GHYTEGAELVDSVLDVVRK	50	sp|Q13509|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=11267	72.65	2	2086.0695	2086.0695	K	E	104	123
PSM	HAEQERDELADEITNSASGK	51	sp|P35580|MYH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=5419	35.014	2	2199.004	2199.0040	R	S	1705	1725
PSM	HCDEVGFNAEEAHNIVK	52	sp|P51808|DYLT3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	2-UNIMOD:4	ms_run[2]:scan=5241	33.91	2	1967.8796	1967.8796	R	E	7	24
PSM	HCQLEPDHEGVPEETDDFGEFR	53	sp|Q9Y5L0-5|TNPO3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	2-UNIMOD:4	ms_run[2]:scan=6821	43.635	2	2642.098	2642.0980	R	M	379	401
PSM	HEVTICNYEASANPADHR	54	sp|Q9GZP4-2|PITH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	6-UNIMOD:4	ms_run[2]:scan=4341	28.488	2	2082.9178	2082.9178	R	V	181	199
PSM	HIYYITGETKDQVANSAFVER	55	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=6462	41.392	3	2440.2023	2440.2023	K	L	490	511
PSM	HQILEQAVEDYAETVHQLSK	56	sp|Q01082-3|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	20-UNIMOD:188	ms_run[2]:scan=11127	71.69	3	2343.1802	2343.1802	K	T	1621	1641
PSM	HTHVQDGEAGGITQQIGATNVPLEAINEQTK	57	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	31-UNIMOD:188	ms_run[2]:scan=7732	49.296	3	3261.6321	3261.6321	R	M	653	684
PSM	IGEHTPSALAIMENANVLAR	58	sp|P04075-2|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	20-UNIMOD:267	ms_run[2]:scan=10311	66.102	2	2116.0974	2116.0974	K	Y	208	228
PSM	KPTDGASSSNCVTDISHLVR	59	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	11-UNIMOD:4	ms_run[2]:scan=6084	39.093	2	2143.0328	2143.0328	R	K	698	718
PSM	NVIIWGNHSSTQYPDVNHAK	60	sp|P40925-2|MDHC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	20-UNIMOD:188	ms_run[2]:scan=5886	37.878	2	2285.1285	2285.1285	K	V	91	111
PSM	SGYHQSASEHGLVVIAPDTSPR	61	sp|P10768|ESTD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	22-UNIMOD:267	ms_run[2]:scan=5172	33.504	2	2317.1326	2317.1326	K	G	65	87
PSM	SHMMDVQGSTQDSAIKDFVLK	62	sp|P13667|PDIA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	16-UNIMOD:188,21-UNIMOD:188	ms_run[2]:scan=7891	50.269	2	2348.1543	2348.1543	R	Y	371	392
PSM	VKLDSPAGTALSPSGHTK	63	sp|P32322-3|P5CR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=3887	25.728	2	1764.937	1764.9370	K	L	317	335
PSM	VLHEAEGHIVTCETNTGEVYR	64	sp|P62318-2|SMD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	12-UNIMOD:4,21-UNIMOD:267	ms_run[2]:scan=4621	30.19	2	2423.1415	2423.1415	K	G	9	30
PSM	TGVHHYSGNNIELGTACGK	65	sp|P62888|RL30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	17-UNIMOD:4,19-UNIMOD:188	ms_run[1]:scan=3603	24.02083	2	2020.935028	2019.952802	K	Y	69	88
PSM	AHVLAASVEQATENFLEKGDK	66	sp|P35221-2|CTNA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	18-UNIMOD:188,21-UNIMOD:188	ms_run[2]:scan=9814	62.839	2	2268.1789	2268.1789	K	I	58	79
PSM	AHVLAASVEQATENFLEKGDK	67	sp|P35221-2|CTNA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	18-UNIMOD:188,21-UNIMOD:188	ms_run[2]:scan=9822	62.897	2	2268.1789	2268.1789	K	I	58	79
PSM	DSGPLPTPPGVSLLGEPPKDYR	68	sp|Q8IY67-2|RAVR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=9369	59.87	2	2291.1798	2291.1798	K	I	482	504
PSM	FCKYEHDDIVSTVSVLSSGTQAVSGSK	69	sp|Q9BQA1|MEP50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	2-UNIMOD:4,3-UNIMOD:188,27-UNIMOD:188	ms_run[2]:scan=8494	54.176	2	2912.4265	2912.4265	K	D	119	146
PSM	HIDCAAIYGNEPEIGEALKEDVGPGK	70	sp|P14550|AK1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	4-UNIMOD:4	ms_run[2]:scan=8207	52.303	2	2781.328	2781.3280	R	A	43	69
PSM	HIDCAHVYQNENEVGVAIQEK	71	sp|P15121|ALDR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	4-UNIMOD:4	ms_run[2]:scan=5473	35.346	3	2452.1441	2452.1441	R	L	42	63
PSM	HQGVMVGMGQKDSYVGDEAQSK	72	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	11-UNIMOD:188,22-UNIMOD:188	ms_run[2]:scan=4366	28.643	3	2362.1084	2362.1084	R	R	40	62
PSM	HSQAVEELAEQLEQTKR	73	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=7275	46.432	2	1995.0021	1995.0021	K	V	1194	1211
PSM	HVGPGVLSMANAGPNTNGSQFFICTIK	74	sp|P30405|PPIF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	24-UNIMOD:4	ms_run[2]:scan=10206	65.425	3	2816.3738	2816.3738	K	T	134	161
PSM	KCFSIDNPGYEPEVVAVHPGGDTVAIGGVDGNVR	75	sp|O75083-3|WDR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	2-UNIMOD:4	ms_run[2]:scan=8563	54.614	3	3524.6994	3524.6994	R	L	297	331
PSM	KGSYNPVTHIYTAQDVK	76	sp|P06865-2|HEXA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=4760	31.015	2	1919.9741	1919.9741	R	E	32	49
PSM	RPTPQDSPIFLPVDDTSFR	77	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:267,19-UNIMOD:267	ms_run[2]:scan=9397	60.049	2	2207.1126	2207.1126	R	W	1405	1424
PSM	RWLLLCNPGLADTIVEK	78	sp|P11216|PYGB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	6-UNIMOD:4	ms_run[2]:scan=10675	68.607	2	1997.0768	1997.0768	R	I	491	508
PSM	SKCEELSGLHGQLQEAR	79	sp|Q9P2E9-3|RRBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	3-UNIMOD:4	ms_run[2]:scan=4307	28.274	2	1940.9374	1940.9374	R	A	498	515
PSM	YDKSLHQAIEGDTSGDFLK	80	sp|P08133-2|ANXA6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	3-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=6584	42.169	2	2135.0574	2135.0574	K	A	613	632
PSM	EKYPSHSFIGEESVAAGEK	81	sp|P29218|IMPA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0		ms_run[1]:scan=4801	31.267521666666667	2	2064.984118	2063.980000	K	S	60	79
PSM	CEAFGWHAIIVDGHSVEELCK	82	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:4,20-UNIMOD:4	ms_run[2]:scan=9038	57.747	2	2456.1253	2456.1253	R	A	206	227
PSM	EIGNLLHPSVPISNDEDVDNKVER	83	sp|P49591|SYSC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=7323	46.734	3	2688.3355	2688.3355	R	I	134	158
PSM	ELFSPLHALNFGIGGDTTR	84	sp|P68402-3|PA1B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	19-UNIMOD:267	ms_run[2]:scan=11460	74.014	2	2054.0461	2054.0461	R	H	61	80
PSM	FNAHGDANTIVCNSKDGGAWGTEQR	85	sp|P09382|LEG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	12-UNIMOD:4	ms_run[2]:scan=5337	34.499	2	2704.2048	2704.2048	R	E	50	75
PSM	HCDEVGFNAEEAHNIVK	86	sp|P51808|DYLT3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	2-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=5242	33.916	2	1973.8997	1973.8997	R	E	7	24
PSM	HGFELVELSPEELPEEDDDFPESTGVKR	87	sp|Q6PD74-2|AAGAB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=10179	65.254	3	3199.4833	3199.4833	K	I	25	53
PSM	HIIENAKQDVDDEYGVSQALAR	88	sp|P51532-5|SMCA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=6542	41.904	2	2470.2088	2470.2088	R	G	705	727
PSM	HIYYITGETKDQVANSAFVER	89	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=6636	42.49	2	2440.2023	2440.2023	K	L	490	511
PSM	HTAMVSWGGVSIPNSPFR	90	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=10015	64.173	2	1941.952	1941.9520	K	V	743	761
PSM	ICNAVSPDKDVDGFHVINVGR	91	sp|P13995-2|MTDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	2-UNIMOD:4	ms_run[2]:scan=7067	45.144	2	2311.1379	2311.1379	R	M	42	63
PSM	IKQHLENDPGSNEDTDIPK	92	sp|O43396|TXNL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=3101	21.018	3	2149.0287	2149.0287	K	G	103	122
PSM	KDMSGHYQNALYLGDVSER	93	sp|P53621|COPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=6043	38.846	2	2182.0113	2182.0113	R	V	727	746
PSM	KVNAEGSVDSVFSQVCTHLDALK	94	sp|P00568|KAD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	16-UNIMOD:4	ms_run[2]:scan=10873	69.958	3	2503.2377	2503.2377	R	-	172	195
PSM	LHPVILASIVDSYER	95	sp|O00303|EIF3F_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	15-UNIMOD:267	ms_run[2]:scan=10192	65.337	2	1720.9387	1720.9387	R	R	94	109
PSM	LLHVFACACPGCSTGGAR	96	sp|Q9BRP1|PDD2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	7-UNIMOD:4,9-UNIMOD:4,12-UNIMOD:4,18-UNIMOD:267	ms_run[2]:scan=5903	37.978	2	1942.884	1942.8840	R	S	74	92
PSM	LNQSQREELGLIEQAYDNPHEALSR	97	sp|Q6P2Q9|PRP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=8897	56.852	3	2909.4268	2909.4268	R	I	856	881
PSM	LTLYDIAHTPGVAADLSHIETK	98	sp|P40926-2|MDHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	22-UNIMOD:188	ms_run[2]:scan=10374	66.516	2	2370.2527	2370.2527	R	A	53	75
PSM	MHDLNTDQENLVGTHDAPIR	99	sp|O43684-2|BUB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:35	ms_run[2]:scan=4973	32.287	2	2291.0601	2291.0601	K	C	81	101
PSM	NHAVVCQGCHNAIDPEVQR	100	sp|Q9UGI8-2|TES_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	6-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=3154	21.327	2	2203.0011	2203.0011	K	V	347	366
PSM	NHEEEVKGLQAQIASSGLTVEVDAPK	101	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=8144	51.897	2	2748.393	2748.3930	K	S	216	242
PSM	RFDEILEASDGIMVAR	102	sp|P14618-3|KPYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=9392	60.015	2	1840.9256	1840.9256	R	G	264	280
PSM	RLPGAIDVIGQTITISR	103	sp|Q6UN15-4|FIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=9802	62.763	2	1809.0472	1809.0472	R	V	294	311
PSM	SFHSFYQLLQGGSEQMLR	104	sp|O94832|MYO1D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	18-UNIMOD:267	ms_run[2]:scan=11521	74.47	2	2137.029	2137.0290	R	S	200	218
PSM	VADPDHDHTGFLTEYVATR	105	sp|P28482|MK01_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	19-UNIMOD:267	ms_run[2]:scan=6931	44.308	2	2153.0053	2153.0053	R	W	173	192
PSM	VLSKEFHLNESGDPSSK	106	sp|Q01105-3|SET_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=4371	28.671	2	1872.9218	1872.9218	K	S	126	143
PSM	VVVKAPDEETLIALLAHAK	107	sp|Q9Y3E5|PTH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	4-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=11098	71.503	3	2028.2022	2028.2022	K	M	116	135
PSM	CEAFGWHAIIVDGHSVEELCK	108	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:385,1-UNIMOD:4,20-UNIMOD:4,21-UNIMOD:188	ms_run[1]:scan=10724	68.94580333333333	3	2445.1062	2445.1182	R	A	206	227
PSM	AFTHTAQYDEAISDYFRK	109	sp|P31939|PUR9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0		ms_run[1]:scan=7820	49.84495166666667	2	2163.011091	2162.006883	K	Q	178	196
PSM	TGVHHYSGNNIELGTACGK	110	sp|P62888|RL30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	17-UNIMOD:4	ms_run[1]:scan=3605	24.03283	2	2014.913999	2013.932673	K	Y	69	88
PSM	AHLLAEVIENLECDPR	111	sp|Q96C86|DCPS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	13-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=11206	72.211	2	1887.9388	1887.9388	R	H	295	311
PSM	ATDAMAHVAGFTVAHDVSAR	112	sp|Q96GK7|FAH2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=6386	40.953	2	2025.9691	2025.9691	K	D	175	195
PSM	AYCHILLGNYCVAVADAKK	113	sp|Q9Y2Z0-2|SGT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:4,11-UNIMOD:4,18-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=7295	46.562	2	2177.1164	2177.1164	R	S	52	71
PSM	AYCHILLGNYCVAVADAKK	114	sp|Q9Y2Z0-2|SGT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=7296	46.568	2	2165.0762	2165.0762	R	S	52	71
PSM	CSALATQYMHCVNHAK	115	sp|Q9NX63|MIC19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:4,11-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=4564	29.847	2	1895.8536	1895.8536	K	Q	204	220
PSM	DGNVLLHEMQIQHPTASLIAK	116	sp|P40227|TCPZ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=8723	55.63	2	2314.2104	2314.2104	K	V	59	80
PSM	DKVAGHSLGYGFVNYVTAK	117	sp|Q15717|ELAV1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	2-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=7709	49.148	2	2037.0722	2037.0722	R	D	54	73
PSM	ELFSPLHALNFGIGGDTTR	118	sp|P68402-3|PA1B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=11463	74.033	2	2044.0378	2044.0378	R	H	61	80
PSM	EVVHTVSLHEIDVINSR	119	sp|Q9Y230-2|RUVB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	17-UNIMOD:267	ms_run[2]:scan=6992	44.679	2	1956.0304	1956.0304	K	T	192	209
PSM	GHYTEGAELVDSVLDVVRK	120	sp|Q13509|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=11265	72.638	3	2086.0695	2086.0695	K	E	104	123
PSM	HCQLEPDHEGVPEETDDFGEFR	121	sp|Q9Y5L0-5|TNPO3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	2-UNIMOD:4,22-UNIMOD:267	ms_run[2]:scan=6827	43.673	3	2652.1062	2652.1062	R	M	379	401
PSM	HQGVMVGMGQKDSYVGDEAQSK	122	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=4370	28.664	2	2350.0682	2350.0682	R	R	40	62
PSM	HVAEVLEYTKDEQLESLFQR	123	sp|P05198|IF2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=9660	61.818	3	2433.2176	2433.2176	R	T	114	134
PSM	HVAEVLEYTKDEQLESLFQR	124	sp|P05198|IF2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=9663	61.837	2	2433.2176	2433.2176	R	T	114	134
PSM	HYNEEGSQVYNDAHILEK	125	sp|Q86U86-6|PB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=5600	36.132	2	2144.9763	2144.9763	R	L	599	617
PSM	IKGGADVSGGVSAPDISLGEGHLSVK	126	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	2-UNIMOD:188,26-UNIMOD:188	ms_run[2]:scan=7194	45.928	3	2461.3215	2461.3215	K	G	5566	5592
PSM	KEAESCDCLQGFQLTHSLGGGTGSGMGTLLLSK	127	sp|Q3ZCM7|TBB8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=9968	63.868	3	3438.6218	3438.6218	R	I	122	155
PSM	KVNAEGSVDSVFSQVCTHLDALK	128	sp|P00568|KAD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:188,16-UNIMOD:4,23-UNIMOD:188	ms_run[2]:scan=10876	69.981	3	2515.2779	2515.2779	R	-	172	195
PSM	LCSAHGVLVPGGFGVR	129	sp|P17812-2|PYRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	2-UNIMOD:4	ms_run[2]:scan=7138	45.573	2	1624.8508	1624.8508	K	G	130	146
PSM	LTLYDIAHTPGVAADLSHIETK	130	sp|P40926-2|MDHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=10369	66.487	3	2364.2325	2364.2325	R	A	53	75
PSM	NHEEEVKGLQAQIASSGLTVEVDAPK	131	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=8145	51.903	3	2748.393	2748.3930	K	S	216	242
PSM	NVIIWGNHSSTQYPDVNHAK	132	sp|P40925-2|MDHC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=5880	37.841	2	2279.1083	2279.1083	K	V	91	111
PSM	SHTEEDCTEELFDFLHAR	133	sp|P07919|QCR6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	7-UNIMOD:4,18-UNIMOD:267	ms_run[2]:scan=10492	67.302	2	2244.9621	2244.9621	R	D	61	79
PSM	SSGFPVHLLPDIAEPGSVAGR	134	sp|Q9UHJ6|SHPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=10184	65.285	2	2105.0906	2105.0906	R	T	219	240
PSM	TKENDAHLVEVNLNNIK	135	sp|Q9NYL9|TMOD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	2-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=6311	40.486	2	1962.0573	1962.0573	R	N	193	210
PSM	TQAIVCQQLDLTHLKER	136	sp|P61221|ABCE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:4	ms_run[2]:scan=6701	42.9	2	2052.0786	2052.0786	K	N	196	213
PSM	VLQHYQESDKGEELGPGNVQK	137	sp|Q9Y6C9|MTCH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=3609	24.057	2	2354.1503	2354.1503	K	E	91	112
PSM	SFHSFYQLLQGGSEQMLR	138	sp|O94832|MYO1D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	16-UNIMOD:35,18-UNIMOD:267	ms_run[1]:scan=10112	64.81035333333334	2	2154.028882	2153.023943	R	S	200	218
PSM	HTGPGILSMANAGPNTNGSQFFICTAK	139	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	9-UNIMOD:35,24-UNIMOD:4,27-UNIMOD:188	ms_run[1]:scan=8492	54.163758333333334	3	2815.316405	2812.336813	K	T	92	119
PSM	AHVLAASVEQATENFLEKGDK	140	sp|P35221-2|CTNA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=9827	62.932	2	2256.1386	2256.1386	K	I	58	79
PSM	ALVDHENVISCPHLGASTK	141	sp|O43175|SERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	11-UNIMOD:4	ms_run[2]:scan=5443	35.158	2	2047.0157	2047.0157	R	E	271	290
PSM	ASVHTLSGHTNAVATVR	142	sp|O43660-2|PLRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=2810	19.277	2	1719.9016	1719.9016	K	C	312	329
PSM	CPSIAAAIAAVNALHGR	143	sp|Q14498-3|RBM39_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=10640	68.375	2	1700.902	1700.9020	K	W	456	473
PSM	CPSIAAAIAAVNALHGR	144	sp|Q14498-3|RBM39_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:4	ms_run[2]:scan=10641	68.381	2	1690.8937	1690.8937	K	W	456	473
PSM	DGNVLLHEMQIQHPTASLIAK	145	sp|P40227|TCPZ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	21-UNIMOD:188	ms_run[2]:scan=8722	55.624	2	2320.2305	2320.2305	K	V	59	80
PSM	EGHPVTSEPSRPEPAVFK	146	sp|Q16762|THTR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=3912	25.88	2	1962.9799	1962.9799	K	A	137	155
PSM	GHYTEGAELVDSVLDVVRK	147	sp|Q13509|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=11117	71.628	3	2086.0695	2086.0695	K	E	104	123
PSM	GSTHPQPGVSPPAAPAAPGPK	148	sp|O94925-2|GLSK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	21-UNIMOD:188	ms_run[2]:scan=3694	24.577	2	1926.0055	1926.0055	K	D	86	107
PSM	GTNDMKQQHVIETLIGK	149	sp|P48643-2|TCPE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=6750	43.199	2	1910.9884	1910.9884	K	K	404	421
PSM	GYAFVHFETQEAADKAIEK	150	sp|Q13310-2|PABP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	15-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=7034	44.944	2	2165.0832	2165.0832	K	M	139	158
PSM	HFNALGGWGELQNSVK	151	sp|P09960|LKHA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	16-UNIMOD:188	ms_run[2]:scan=8593	54.812	2	1761.8894	1761.8894	R	T	340	356
PSM	HIQQVDCSGNDLEQLHIK	152	sp|P52948-6|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	7-UNIMOD:4,18-UNIMOD:188	ms_run[2]:scan=5829	37.547	3	2139.0474	2139.0474	R	V	1602	1620
PSM	HQILEQAVEDYAETVHQLSK	153	sp|Q01082-3|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	20-UNIMOD:188	ms_run[2]:scan=11135	71.742	2	2343.1802	2343.1802	K	T	1621	1641
PSM	IHFPLATYAPVISAEK	154	sp|P68363-2|TBA1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=9688	62.003	2	1755.956	1755.9560	R	A	149	165
PSM	KGLPLGSAVSSPVLFSPVGR	155	sp|Q8WUM0|NU133_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=9598	61.408	2	1967.1204	1967.1204	R	R	35	55
PSM	KVSQPIEGHAASFAQFK	156	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=5238	33.893	2	1843.9581	1843.9581	R	M	189	206
PSM	LLEQKVELAQLQEEWNEHNAK	157	sp|Q9H307|PININ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:188,21-UNIMOD:188	ms_run[2]:scan=8488	54.14	3	2560.3324	2560.3324	R	I	208	229
PSM	NHAVVCQGCHNAIDPEVQR	158	sp|Q9UGI8-2|TES_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:4,9-UNIMOD:4,19-UNIMOD:267	ms_run[2]:scan=3152	21.315	2	2213.0094	2213.0094	K	V	347	366
PSM	NQQITHANNTVSNFKR	159	sp|Q92598-2|HS105_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=2646	18.319	2	1870.9398	1870.9398	K	F	54	70
PSM	RPTPQDSPIFLPVDDTSFR	160	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=9373	59.896	2	2187.096	2187.0960	R	W	1405	1424
PSM	SGYHQSASEHGLVVIAPDTSPR	161	sp|P10768|ESTD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=5159	33.423	3	2307.1244	2307.1244	K	G	65	87
PSM	SHTEEDCTEELFDFLHAR	162	sp|P07919|QCR6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	7-UNIMOD:4	ms_run[2]:scan=10493	67.308	2	2234.9539	2234.9539	R	D	61	79
PSM	SLSEINKPNFYNNDFDDDFSHR	163	sp|Q5QJE6|TDIF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=7930	50.528	3	2673.1732	2673.1732	R	S	251	273
PSM	STDRLPSAHTCFNQLDLPAYESFEK	164	sp|Q7Z6Z7-2|HUWE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	11-UNIMOD:4	ms_run[2]:scan=8990	57.438	2	2925.3603	2925.3603	R	L	4315	4340
PSM	TVLQRPLSLIQGPPGTGK	165	sp|Q92900-2|RENT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=7954	50.681	2	1861.0785	1861.0785	K	T	481	499
PSM	VAEKLDEIYVAGLVAHSDLDER	166	sp|O60506-4|HNRPQ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=9692	62.027	2	2441.2438	2441.2438	K	A	39	61
PSM	HVGPGVLSMANAGPNTNGSQFFICTIK	167	sp|P30405|PPIF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	24-UNIMOD:4,27-UNIMOD:188	ms_run[1]:scan=10452	67.03304166666666	3	2823.381364	2822.393934	K	T	134	161
PSM	QHDQLEAQKLEYHQVIQQMEQK	168	sp|P80303|NUCB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:28	ms_run[1]:scan=7770	49.532775	3	2733.3182	2733.3175	R	K	378	400
PSM	KFDLNSPWEAFPVYR	169	sp|O75489|NDUS3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0		ms_run[1]:scan=11113	71.60000666666666	2	1868.921130	1867.925720	R	Q	232	247
PSM	AFTHTAQYDEAISDYFRK	170	sp|P31939-2|PUR9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=7817	49.828	3	2162.0069	2162.0069	K	Q	177	195
PSM	AGKVEAQHILASAPTDR	171	sp|Q53H96-2|P5CR3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=3984	26.306	2	1762.9326	1762.9326	R	N	30	47
PSM	ALPGQLKPFETLLSQNQGGK	172	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=10107	64.776	2	2125.1532	2125.1532	K	T	122	142
PSM	ATDAMAHVAGFTVAHDVSAR	173	sp|Q96GK7|FAH2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	20-UNIMOD:267	ms_run[2]:scan=6385	40.947	2	2035.9773	2035.9773	K	D	175	195
PSM	AVEHINKTIAPALVSK	174	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=4535	29.668	2	1689.9778	1689.9778	K	K	65	81
PSM	DNHLLGTFDLTGIPPAPR	175	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=10218	65.5	2	1933.0058	1933.0058	K	G	475	493
PSM	EAIVNSCVFVHQTLHQANAR	176	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	7-UNIMOD:4	ms_run[2]:scan=6547	41.934	2	2293.1386	2293.1386	R	L	3141	3161
PSM	FNAHGDANTIVCNSKDGGAWGTEQR	177	sp|P09382|LEG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	12-UNIMOD:4	ms_run[2]:scan=5330	34.453	3	2704.2048	2704.2048	R	E	50	75
PSM	GFAFVTFDDHDSVDKIVIQK	178	sp|P09651-3|ROA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	15-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=9789	62.68	2	2292.1829	2292.1829	R	Y	147	167
PSM	GFAFVTFDDHDTVDKIVVQK	179	sp|P51991-2|ROA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	15-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=9621	61.562	2	2292.1829	2292.1829	R	Y	146	166
PSM	GLDVDSLVIEHIQVNKAPK	180	sp|P18621-2|RL17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	16-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=8869	56.678	2	2086.1825	2086.1825	K	M	68	87
PSM	GVEVDPSLIKDTWHQVYR	181	sp|O60313-13|OPA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=9268	59.221	2	2141.0906	2141.0906	R	R	789	807
PSM	GVNWAAFHPTMPLIVSGADDR	182	sp|P53621|COPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	21-UNIMOD:267	ms_run[2]:scan=11101	71.522	2	2263.1083	2263.1083	R	Q	207	228
PSM	GVNWAAFHPTMPLIVSGADDR	183	sp|P53621|COPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=11100	71.515	2	2253.1001	2253.1001	R	Q	207	228
PSM	HASPILPITEFSDIPR	184	sp|P42167|LAP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=10048	64.389	2	1791.9519	1791.9519	K	R	304	320
PSM	HESAEIFVVCQGFLAPDKVDSK	185	sp|Q8IY81|SPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	10-UNIMOD:4,18-UNIMOD:188,22-UNIMOD:188	ms_run[2]:scan=9086	58.067	2	2487.2507	2487.2507	R	F	188	210
PSM	HFNALGGWGELQNSVK	186	sp|P09960|LKHA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=8596	54.828	2	1755.8693	1755.8693	R	T	340	356
PSM	HIDCAHVYQNENEVGVAIQEK	187	sp|P15121|ALDR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:4	ms_run[2]:scan=5474	35.352	2	2452.1441	2452.1441	R	L	42	63
PSM	HLGGIPWTYAEDAVPTLTPCR	188	sp|P31930|QCR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	20-UNIMOD:4	ms_run[2]:scan=10682	68.649	2	2353.1525	2353.1525	K	F	249	270
PSM	IGGGDTTEHIQTHFESK	189	sp|O14497-3|ARI1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=3883	25.705	2	1855.8701	1855.8701	R	T	1463	1480
PSM	IHFPLATYAPVISAEK	190	sp|P68363-2|TBA1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=9533	60.973	2	1755.956	1755.9560	R	A	149	165
PSM	IYKEIECSIAGAHEK	191	sp|Q6I9Y2|THOC7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	7-UNIMOD:4	ms_run[2]:scan=4781	31.146	2	1746.8611	1746.8611	K	I	84	99
PSM	KLFIGGLSFETTDESLR	192	sp|P09651-3|ROA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=9938	63.67	2	1911.9942	1911.9942	R	S	15	32
PSM	KQYDAYGSAGFDPGASGSQHSYWK	193	sp|Q96EY1-2|DNJA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=6233	39.995	3	2606.1462	2606.1462	R	G	152	176
PSM	KSDIYVCMISFAHNVAAQGK	194	sp|P50395-2|GDIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:188,7-UNIMOD:4,20-UNIMOD:188	ms_run[2]:scan=10423	66.837	2	2250.1328	2250.1328	R	Y	284	304
PSM	KVSQPIEGHAASFAQFK	195	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=5246	33.942	2	1855.9983	1855.9983	R	M	189	206
PSM	LDKSQIHDIVLVGGSTR	196	sp|P11142-2|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=6281	40.302	2	1837.0058	1837.0058	K	I	326	343
PSM	LHETVDATSETHIYQVR	197	sp|Q9P2I0|CPSF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	17-UNIMOD:267	ms_run[2]:scan=4802	31.274	2	2007.9889	2007.9889	K	L	593	610
PSM	LLEQKVELAQLQEEWNEHNAK	198	sp|Q9H307|PININ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=8481	54.095	3	2548.2922	2548.2922	R	I	208	229
PSM	LNDGHFMPVLGFGTYAPPEVPR	199	sp|P42330|AK1C3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=11054	71.194	2	2413.1889	2413.1889	K	S	10	32
PSM	LTLYDIAHTPGVAADLSHIETK	200	sp|P40926-2|MDHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=10373	66.51	2	2364.2325	2364.2325	R	A	53	75
PSM	LVSNHSLHETSSVFVDSLTK	201	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	20-UNIMOD:188	ms_run[2]:scan=7140	45.583	2	2205.1373	2205.1373	R	A	2513	2533
PSM	MHDLNTDQENLVGTHDAPIR	202	sp|O43684-2|BUB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:35	ms_run[2]:scan=4958	32.195	3	2291.0601	2291.0601	K	C	81	101
PSM	NTHATTHNAYDLEVIDIFK	203	sp|P09874|PARP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=10068	64.514	2	2201.0753	2201.0753	K	I	820	839
PSM	NTHATTHNAYDLEVIDIFK	204	sp|P09874|PARP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	19-UNIMOD:188	ms_run[2]:scan=10070	64.526	2	2207.0954	2207.0954	K	I	820	839
PSM	NYLHYSLYDQAEKLVSK	205	sp|O43242-2|PSMD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	13-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=8674	55.311	2	2082.0825	2082.0825	R	S	119	136
PSM	PKFYCDYCDTYLTHDSPSVR	206	sp|P09234|RU1C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	5-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=6693	42.849	3	2523.0835	2523.0835	M	K	2	22
PSM	TKPADMVIEAYGHGQR	207	sp|O94903|PLPHP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=5480	35.388	2	1771.8676	1771.8676	K	T	48	64
PSM	VADPDHDHTGFLTEYVATR	208	sp|P28482|MK01_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=6933	44.32	2	2142.997	2142.9970	R	W	173	192
PSM	VAEEHAPSIVFIDEIDAIGTKR	209	sp|P62191-2|PRS4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=10784	69.351	2	2409.254	2409.2540	R	Y	200	222
PSM	VEDVLGKGWENHVEGQK	210	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	7-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=5708	36.804	2	1934.9889	1934.9889	R	L	665	682
PSM	CSDAAGYPHATHDLEGPPLDAYSIQGQHTISPLDLAK	211	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:385,1-UNIMOD:4,37-UNIMOD:188	ms_run[1]:scan=10012	64.15510666666667	4	3933.8602	3933.8570	R	L	201	238
PSM	AADKLIQNLDANHDGR	212	sp|Q96FQ6|S10AG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=4611	30.132	2	1749.8758	1749.8758	K	I	58	74
PSM	AAPRPAPVAQPPAAAPPSAVGSSAAAPR	213	sp|Q9Y6H1|CHCH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	4-UNIMOD:267,28-UNIMOD:267	ms_run[2]:scan=4731	30.841	2	2552.3726	2552.3726	R	Q	24	52
PSM	AFAHITGGGLLENIPR	214	sp|P22102|PUR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	16-UNIMOD:267	ms_run[2]:scan=8725	55.642	2	1674.9081	1674.9081	K	V	677	693
PSM	AHLLAEVIENLECDPR	215	sp|Q96C86|DCPS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	13-UNIMOD:4	ms_run[2]:scan=11204	72.199	2	1877.9305	1877.9305	R	H	295	311
PSM	AIMTYVSSFYHAFSGAQKAETAANR	216	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=11430	73.809	2	2720.3017	2720.3017	K	I	256	281
PSM	CYSCGEFGHIQKDCTK	217	sp|P62633-7|CNBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:4,4-UNIMOD:4,12-UNIMOD:188,14-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=3466	23.179	2	2000.8582	2000.8582	K	V	102	118
PSM	DKVAGHSLGYGFVNYVTAK	218	sp|Q15717|ELAV1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=7706	49.13	3	2025.032	2025.0320	R	D	54	73
PSM	EVVHTVSLHEIDVINSR	219	sp|Q9Y230-2|RUVB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=6993	44.685	2	1946.0221	1946.0221	K	T	192	209
PSM	FAEVECLAESHQHLSK	220	sp|Q14839|CHD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=5186	33.583	2	1889.9037	1889.9037	R	E	1822	1838
PSM	FITHAPPGEFNEVFNDVR	221	sp|P52907|CAZA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	18-UNIMOD:267	ms_run[2]:scan=8973	57.33	2	2098.0148	2098.0148	K	L	20	38
PSM	GRESVLIISTDPAHNISDAFDQK	222	sp|O43681|ASNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=8943	57.144	3	2512.2558	2512.2558	K	F	64	87
PSM	GVEAVAIHGGKDQEER	223	sp|Q9UJV9|DDX41_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=2109	15.111	2	1693.8384	1693.8384	K	T	456	472
PSM	GYAFVHFETQEAADKAIEK	224	sp|Q13310-2|PABP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=7018	44.839	3	2153.0429	2153.0429	K	M	139	158
PSM	HAAENPGKYNILGTNTIMDK	225	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	18-UNIMOD:35	ms_run[2]:scan=5378	34.754	2	2202.0739	2202.0739	K	M	498	518
PSM	HAAENPGKYNILGTNTIMDK	226	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	8-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=6434	41.242	3	2198.1193	2198.1193	K	M	498	518
PSM	HCDEVGFNAEEAHNIVK	227	sp|P51808|DYLT3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=5239	33.899	3	1973.8997	1973.8997	R	E	7	24
PSM	HELQANCYEEVKDR	228	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:4	ms_run[2]:scan=2856	19.542	2	1789.8053	1789.8053	K	C	133	147
PSM	HSQAVEELAEQLEQTKR	229	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=7270	46.404	3	1995.0021	1995.0021	K	V	1194	1211
PSM	HVGMAVAGLLADAR	230	sp|P25788-2|PSA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=7881	50.207	2	1379.7344	1379.7344	R	S	73	87
PSM	IECEIKINHEGEVNR	231	sp|Q16576|RBBP7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:4	ms_run[2]:scan=3622	24.141	2	1838.8945	1838.8945	K	A	114	129
PSM	IHEGCEEPATHNALAK	232	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=1635	12.36	2	1781.8462	1781.8462	R	I	866	882
PSM	IQVHYYEDGNVQLVSHK	233	sp|P47755|CAZA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=5636	36.358	3	2028.0065	2028.0065	K	D	194	211
PSM	IRMENILSGNPLLNLTGPSQPQANFK	234	sp|Q9P013|CWC15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=11840	76.82	3	2851.5014	2851.5014	R	V	158	184
PSM	KLESVAEEHEILTK	235	sp|Q8TCG1-2|CIP2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=4427	29.004	2	1624.8672	1624.8672	R	S	557	571
PSM	KQELEEICHDLEAR	236	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	8-UNIMOD:4	ms_run[2]:scan=6457	41.363	2	1768.8414	1768.8414	K	V	910	924
PSM	KVETDHIVAAVGLEPNVELAK	237	sp|O95831-5|AIFM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=7612	48.556	2	2231.2161	2231.2161	R	T	36	57
PSM	KYEDICPSTHNMDVPNIK	238	sp|Q9GZV4|IF5A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:4	ms_run[2]:scan=5779	37.238	2	2159.998	2159.9980	K	R	68	86
PSM	LCLTLHNNEGSYLAHTQGK	239	sp|Q15428|SF3A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:4	ms_run[2]:scan=5995	38.559	2	2155.048	2155.0480	K	K	58	77
PSM	LLIHQSLAGGIIGVK	240	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=8019	51.071	2	1517.9293	1517.9293	R	G	125	140
PSM	LMNSKGEYQGVFHCAVETAK	241	sp|Q9UBX3|DIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	14-UNIMOD:4	ms_run[2]:scan=6087	39.11	2	2268.0667	2268.0667	R	L	227	247
PSM	LTLSALLDGKNVNAGGHK	242	sp|P21796|VDAC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	10-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=7594	48.442	2	1819.0355	1819.0355	K	L	257	275
PSM	LVQAEYWHDPIKEDVYR	243	sp|P50897|PPT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=7245	46.243	2	2160.064	2160.0640	R	N	180	197
PSM	NVIIWGNHSSTQYPDVNHAK	244	sp|P40925-2|MDHC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=5953	38.295	3	2279.1083	2279.1083	K	V	91	111
PSM	RVNQAIWLLCTGAR	245	sp|P46782|RS5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	10-UNIMOD:4	ms_run[2]:scan=8337	53.13	2	1656.8882	1656.8882	R	E	146	160
PSM	SLIIDEGEDDLGRGGHPLSK	246	sp|O14618|CCS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=6618	42.38	2	2107.0546	2107.0546	R	I	197	217
PSM	STDHPKYSDMIVAAIQAEK	247	sp|P07305-2|H10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=8574	54.684	2	2103.0307	2103.0307	K	N	5	24
PSM	TQIAICPNNHEVHIYEK	248	sp|O15143|ARC1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=5537	35.738	2	2071.0252	2071.0252	R	S	21	38
PSM	TTGIVMDSGDGVTHTVPIYEGYALPHAILR	249	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=10214	65.475	2	3182.607	3182.6070	R	L	148	178
PSM	TTHFVEGGDAGNREDQINR	250	sp|P18124|RL7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=2806	19.255	2	2114.973	2114.9730	K	L	224	243
PSM	TTTVVNVEGDALGAGILHHLNQK	251	sp|P43007-2|SATT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	23-UNIMOD:188	ms_run[2]:scan=9161	58.543	2	2392.2806	2392.2806	R	A	160	183
PSM	VLHEAEGHIVTCETNTGEVYR	252	sp|P62318-2|SMD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	12-UNIMOD:4	ms_run[2]:scan=4609	30.12	3	2413.1332	2413.1332	K	G	9	30
PSM	VLKQVHPDTGISSK	253	sp|Q99880|H2B1L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=1995	14.447	2	1519.8761	1519.8761	K	A	45	59
PSM	VLQHYQESDKGEELGPGNVQK	254	sp|Q9Y6C9|MTCH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=3598	23.987	3	2354.1503	2354.1503	K	E	91	112
PSM	VLQHYQESDKGEELGPGNVQK	255	sp|Q9Y6C9|MTCH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	10-UNIMOD:188,21-UNIMOD:188	ms_run[2]:scan=3614	24.09	3	2366.1905	2366.1905	K	E	91	112
PSM	VSEMWNEVHEEKEQAAK	256	sp|Q15257|PTPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	12-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=4551	29.761	2	2054.977	2054.9770	R	Q	70	87
PSM	VYYFNHITNASQWERPSGNSSSGGK	257	sp|Q13526|PIN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=6796	43.477	2	2785.2845	2785.2845	R	N	22	47
PSM	YKPAVNQIECHPYLTQEK	258	sp|P15121|ALDR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	10-UNIMOD:4	ms_run[2]:scan=5094	33.029	2	2217.0888	2217.0888	K	L	178	196
PSM	YEELQSLAGKHGDDLR	259	sp|P05787|K2C8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=5151	33.374048333333334	2	1829.892072	1829.890791	K	R	286	302
PSM	IQEIIEQLDVTTSEYEKEK	260	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=9347	59.73127333333333	2	2295.156766	2294.152939	R	L	371	390
PSM	QLFHPEQLITGKEDAANNYAR	261	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:28	ms_run[1]:scan=9108	58.205605000000006	2	2397.1613	2397.1708	R	G	85	106
PSM	MDSTANEVEAVKVHSFPTLK	262	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	1-UNIMOD:35	ms_run[1]:scan=6939	44.355885	2	2219.082841	2218.093984	K	F	425	445
PSM	KLAEEEDLFDSAHPEEGDLDLASESTAHAQSSK	263	sp|Q15424|SAFB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	1-UNIMOD:188,33-UNIMOD:188	ms_run[1]:scan=7617	48.587245	4	3569.668079	3567.652768	R	A	253	286
PSM	AFGFSHLEALLDDSK	264	sp|Q96FW1|OTUB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	15-UNIMOD:188	ms_run[2]:scan=11119	71.639	2	1654.8298	1654.8298	R	E	95	110
PSM	AFGFSHLEALLDDSK	265	sp|Q96FW1|OTUB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=11116	71.622	2	1648.8097	1648.8097	R	E	95	110
PSM	AGGAAVVITEPEHTKER	266	sp|Q9P258|RCC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=2859	19.563	2	1763.9166	1763.9166	K	V	78	95
PSM	DGNVLLHEMQIQHPTASLIAK	267	sp|P40227|TCPZ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	21-UNIMOD:188	ms_run[2]:scan=8721	55.619	3	2320.2305	2320.2305	K	V	59	80
PSM	DSFDDRGPSLNPVLDYDHGSR	268	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=7439	47.476	3	2361.0622	2361.0622	R	S	187	208
PSM	EGDYVLFHHEGGVDVGDVDAK	269	sp|P53396|ACLY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	21-UNIMOD:188	ms_run[2]:scan=6984	44.627	2	2263.0489	2263.0489	R	A	128	149
PSM	EHTSYKQQLEAVNEAIK	270	sp|O95347-2|SMC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=5830	37.552	2	1999.0413	1999.0413	R	S	832	849
PSM	EVAGAKPHITAAEGK	271	sp|Q16891-3|MIC60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=1419	11.129	2	1477.7889	1477.7889	K	L	284	299
PSM	FAEVECLAESHQHLSK	272	sp|Q14839|CHD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:4	ms_run[2]:scan=5190	33.611	2	1883.8836	1883.8836	R	E	1822	1838
PSM	FDATSMHVKPQVAAQQK	273	sp|P09327|VILI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=4233	27.827	2	1884.9516	1884.9516	K	M	375	392
PSM	GFAFVTFDDHDSVDKIVIQK	274	sp|P09651-3|ROA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=9773	62.574	2	2280.1426	2280.1426	R	Y	147	167
PSM	GFAFVTFDDHDTVDKIVVQK	275	sp|P51991-2|ROA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=9622	61.568	2	2280.1426	2280.1426	R	Y	146	166
PSM	GGSGSHNWGTVKDELTESPK	276	sp|Q8NC51-2|PAIRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=5208	33.724	2	2084.9763	2084.9763	R	Y	211	231
PSM	GHAAFTSDPKPTIEVSGK	277	sp|P00390-5|GSHR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=4166	27.414	2	1840.9319	1840.9319	R	K	172	190
PSM	GPIKFNVWDTAGQEK	278	sp|P62826|RAN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=7666	48.882	2	1688.8522	1688.8522	R	F	57	72
PSM	GSTHPQPGVSPPAAPAAPGPK	279	sp|O94925-2|GLSK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=3650	24.31	2	1919.9854	1919.9854	K	D	86	107
PSM	GYAFVHFETQEAADKAIEK	280	sp|Q13310-2|PABP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=7023	44.869	2	2153.0429	2153.0429	K	M	139	158
PSM	GYAFVHFETQEAADKAIEK	281	sp|Q13310-2|PABP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	15-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=7025	44.886	3	2165.0832	2165.0832	K	M	139	158
PSM	GYLNKDTHDQLSEPSEVR	282	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=4298	28.219	2	2086.992	2086.9920	R	S	3964	3982
PSM	HDGKEVDEGAWETK	283	sp|Q86UE4|LYRIC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=2616	18.141	2	1599.7165	1599.7165	R	I	182	196
PSM	HESGASIKIDEPLEGSEDR	284	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=4940	32.084	2	2067.9709	2067.9709	R	I	391	410
PSM	HEVTICNYEASANPADHR	285	sp|Q9GZP4-2|PITH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:4,18-UNIMOD:267	ms_run[2]:scan=4339	28.477	3	2092.926	2092.9260	R	V	181	199
PSM	HIVVSCAAGVTISSVEKK	286	sp|Q96C36|P5CR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:4	ms_run[2]:scan=5614	36.221	3	1884.0139	1884.0139	R	L	90	108
PSM	HQILEQAVEDYAETVHQLSK	287	sp|Q01082-3|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=11143	71.793	2	2337.1601	2337.1601	K	T	1621	1641
PSM	HQVLNDRDEEVELCSSVECK	288	sp|O75153|CLU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	14-UNIMOD:4,19-UNIMOD:4	ms_run[2]:scan=5468	35.312	3	2445.09	2445.0900	R	G	533	553
PSM	HQVLNDRDEEVELCSSVECK	289	sp|O75153|CLU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	14-UNIMOD:4,19-UNIMOD:4	ms_run[2]:scan=5470	35.324	2	2445.09	2445.0900	R	G	533	553
PSM	HTFEEAEKGFDETLAK	290	sp|P42345|MTOR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=6375	40.886	2	1850.8687	1850.8687	R	E	236	252
PSM	HYGPGWVSMANAGK	291	sp|P23284|PPIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	14-UNIMOD:188	ms_run[2]:scan=5757	37.109	2	1479.7024	1479.7024	K	D	132	146
PSM	IGKVDCTQHYELCSGNQVR	292	sp|Q8NBS9-2|TXND5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=4106	27.044	2	2263.0474	2263.0474	K	G	134	153
PSM	IHFPLATYAPVISAEK	293	sp|P68363-2|TBA1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	16-UNIMOD:188	ms_run[2]:scan=9557	61.143	2	1761.9761	1761.9761	R	A	149	165
PSM	IHNAENIQPGEQKYEYK	294	sp|Q04637-6|IF4G1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	13-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=3233	21.803	2	2072.0366	2072.0366	K	S	385	402
PSM	IKPAATSHVEGSGGVSAK	295	sp|Q96ME7-2|ZN512_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=1296	10.429	2	1694.8951	1694.8951	R	G	6	24
PSM	IRYESGDHVAVYPANDSALVNQLGK	296	sp|P16435|NCPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=7238	46.203	3	2715.3616	2715.3616	K	I	312	337
PSM	KAALEAQNALHNMK	297	sp|Q92879-5|CELF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=3406	22.824	2	1549.8438	1549.8438	R	V	53	67
PSM	KAALEAQNALHNMK	298	sp|Q92879-5|CELF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=3408	22.833	2	1537.8035	1537.8035	R	V	53	67
PSM	KFACNGTVIEHPEYGEVIQLQGDQR	299	sp|P41567|EIF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	4-UNIMOD:4	ms_run[2]:scan=7177	45.821	3	2887.3923	2887.3923	K	K	66	91
PSM	KLTDIINNDHENVK	300	sp|Q8N335|GPD1L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=4681	30.547	2	1663.8932	1663.8932	R	Y	51	65
PSM	KYEDICPSTHNMDVPNIK	301	sp|Q9GZV4|IF5A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:188,6-UNIMOD:4,18-UNIMOD:188	ms_run[2]:scan=5778	37.232	2	2172.0382	2172.0382	K	R	68	86
PSM	LEQSGCYHHCVDENIER	302	sp|Q969G9|NKD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=2990	20.351	2	2144.9004	2144.9004	R	R	239	256
PSM	LLTQHENIKNEIDNYEEDYQK	303	sp|Q01082-3|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=6929	44.297	3	2635.2402	2635.2402	K	M	1087	1108
PSM	LNQSQREELGLIEQAYDNPHEALSR	304	sp|Q6P2Q9|PRP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=8908	56.921	2	2909.4268	2909.4268	R	I	856	881
PSM	LNQSQREELGLIEQAYDNPHEALSR	305	sp|Q6P2Q9|PRP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:267,25-UNIMOD:267	ms_run[2]:scan=8905	56.904	3	2929.4433	2929.4433	R	I	856	881
PSM	LVSNHSLHETSSVFVDSLTK	306	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=7143	45.606	2	2199.1172	2199.1172	R	A	2513	2533
PSM	MDSTANEVEAVKVHSFPTLK	307	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	12-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=7244	46.237	2	2214.1393	2214.1393	K	F	425	445
PSM	NNRQPYAVSELAGHQTSAESWGTGR	308	sp|P36578|RL4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=6159	39.548	3	2715.275	2715.2750	K	A	47	72
PSM	NVLGHMQQGGAPSPFDR	309	sp|Q01813-2|PFKAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=6271	40.239	2	1809.8581	1809.8581	K	N	659	676
PSM	RLPGAIDVIGQTITISR	310	sp|Q6UN15-4|FIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:267,17-UNIMOD:267	ms_run[2]:scan=9803	62.769	2	1829.0638	1829.0638	R	V	294	311
PSM	SHTEEDCTEELFDFLHAR	311	sp|P07919|QCR6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	7-UNIMOD:4,18-UNIMOD:267	ms_run[2]:scan=10490	67.29	3	2244.9621	2244.9621	R	D	61	79
PSM	SHTEEDCTEELFDFLHAR	312	sp|P07919|QCR6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	7-UNIMOD:4	ms_run[2]:scan=10499	67.349	3	2234.9539	2234.9539	R	D	61	79
PSM	SIYGEKFEDENFILK	313	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=8607	54.894	2	1842.9442	1842.9442	K	H	77	92
PSM	TGVELGKPTHFTVNAK	314	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	7-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=4706	30.699	2	1709.9503	1709.9503	R	A	885	901
PSM	TPSIQPSLLPHAAPFAK	315	sp|P35658-2|NU214_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=8035	51.174	2	1773.9778	1773.9778	R	S	1010	1027
PSM	TYEEGLKHEANNPQLK	316	sp|P31948-2|STIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	7-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=3438	23.011	2	1881.9623	1881.9623	R	E	141	157
PSM	VFQSLPHENKPLTLSNYQTNK	317	sp|P04080|CYTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	10-UNIMOD:188,21-UNIMOD:188	ms_run[2]:scan=6124	39.332	2	2469.3055	2469.3055	R	A	69	90
PSM	VFQSLPHENKPLTLSNYQTNK	318	sp|P04080|CYTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=6131	39.376	3	2457.2652	2457.2652	R	A	69	90
PSM	VSGGLEVLAEKCPNLTHLNLSGNK	319	sp|P39687|AN32A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	12-UNIMOD:4	ms_run[2]:scan=8887	56.79	2	2549.3272	2549.3272	R	I	76	100
PSM	VVGSVGQHTGEPVEELALSHCGR	320	sp|Q9H6Y2-2|WDR55_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	21-UNIMOD:4,23-UNIMOD:267	ms_run[2]:scan=6008	38.637	3	2427.184	2427.1840	R	F	68	91
PSM	IGGVQQDTILAEGLHFR	321	sp|Q99623|PHB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	17-UNIMOD:267	ms_run[1]:scan=9303	59.44595666666667	2	1863.988881	1862.987815	R	I	55	72
PSM	GQHEPSKPPPAGETVTGGFGAK	322	sp|Q9H6F5|CCD86_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=3470	23.203145000000003	2	2149.064573	2148.059982	R	K	191	213
PSM	AAGGGSYKGHVDILAPTVQELAALEK	323	sp|Q92499-3|DDX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=10166	65.168	2	2594.3704	2594.3704	R	E	567	593
PSM	AAPRPAPVAQPPAAAPPSAVGSSAAAPR	324	sp|Q9Y6H1|CHCH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=4685	30.57	3	2532.3561	2532.3561	R	Q	24	52
PSM	ASIHEAWTDGKEAMLK	325	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	11-UNIMOD:188,14-UNIMOD:35,16-UNIMOD:188	ms_run[2]:scan=4692	30.613	2	1813.9071	1813.9071	K	H	422	438
PSM	AVHEQLAALSQAPVNKPK	326	sp|Q15059-2|BRD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=4604	30.089	2	1900.053	1900.0530	K	K	472	490
PSM	CEAFGWHAIIVDGHSVEELCK	327	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:4,20-UNIMOD:4,21-UNIMOD:188	ms_run[2]:scan=9028	57.681	3	2462.1454	2462.1454	R	A	206	227
PSM	DFTVSAMHGDMDQKER	328	sp|P60842-2|IF4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=5008	32.505	2	1865.8036	1865.8036	R	D	296	312
PSM	DTSNHFHVFVGDLSPEITTEDIK	329	sp|P31483-2|TIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=9630	61.621	2	2600.2395	2600.2395	K	A	90	113
PSM	EINNAHAILTDATKR	330	sp|Q9H3Z4-2|DNJC5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=4628	30.232	2	1665.8798	1665.8798	K	N	59	74
PSM	EVAGAKPHITAAEGK	331	sp|Q16891-3|MIC60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=1418	11.125	2	1489.8291	1489.8291	K	L	284	299
PSM	GSTHPQPGVSPPAAPAAPGPK	332	sp|O94925-2|GLSK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=3669	24.426	2	1919.9854	1919.9854	K	D	86	107
PSM	HAAENPGKYNILGTNTIMDK	333	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=6433	41.237	3	2186.079	2186.0790	K	M	498	518
PSM	HEVTICNYEASANPADHR	334	sp|Q9GZP4-2|PITH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:4	ms_run[2]:scan=4331	28.425	3	2082.9178	2082.9178	R	V	181	199
PSM	HIQQVDCSGNDLEQLHIK	335	sp|P52948-6|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	7-UNIMOD:4	ms_run[2]:scan=5820	37.492	3	2133.0273	2133.0273	R	V	1602	1620
PSM	HNPTVTGHQEQTYLQK	336	sp|Q71RC2-7|LARP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	16-UNIMOD:188	ms_run[2]:scan=2537	17.655	2	1885.9378	1885.9378	R	E	413	429
PSM	HQGVMVGMGQKDSYVGDEAQSK	337	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=4369	28.66	3	2350.0682	2350.0682	R	R	40	62
PSM	HTENEEDKVSSSSFR	338	sp|Q13057|COASY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=2164	15.413	2	1750.7758	1750.7758	R	Q	323	338
PSM	IANCIVHSTDKGPNSALVQQLIK	339	sp|Q5H9R7-3|PP6R3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	4-UNIMOD:4	ms_run[2]:scan=7674	48.932	2	2505.3373	2505.3373	R	D	413	436
PSM	IAQPGDHVSVTGIFLPILR	340	sp|P33993-2|MCM7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	19-UNIMOD:267	ms_run[2]:scan=11926	77.449	2	2042.1552	2042.1552	R	T	264	283
PSM	IHEGCEEPATHNALAK	341	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	5-UNIMOD:4	ms_run[2]:scan=1636	12.366	2	1775.8261	1775.8261	R	I	866	882
PSM	IHFPLATYAPVISAEK	342	sp|P68363-2|TBA1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	16-UNIMOD:188	ms_run[2]:scan=9406	60.102	2	1761.9761	1761.9761	R	A	149	165
PSM	IHFPLATYAPVISAEK	343	sp|P68363-2|TBA1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	16-UNIMOD:188	ms_run[2]:scan=9715	62.176	2	1761.9761	1761.9761	R	A	149	165
PSM	KIWCFGPDGTGPNILTDITK	344	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:188,4-UNIMOD:4,20-UNIMOD:188	ms_run[2]:scan=11270	72.668	2	2244.1651	2244.1651	R	G	648	668
PSM	KLDEAVAEAHLGK	345	sp|P23526-2|SAHH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=3792	25.149	2	1379.7409	1379.7409	K	L	361	374
PSM	LCSAHGVLVPGGFGVR	346	sp|P17812-2|PYRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=7139	45.578	2	1634.859	1634.8590	K	G	130	146
PSM	LGEVVNTHGPVEPDKDNIR	347	sp|P30419-2|NMT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=4503	29.472	2	2088.06	2088.0600	K	Q	48	67
PSM	LHPVILASIVDSYER	348	sp|O00303|EIF3F_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=10198	65.374	2	1710.9305	1710.9305	R	R	94	109
PSM	LKGSGVTTYSVHPGTVQSELVR	349	sp|Q8TC12-2|RDH11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=5838	37.602	3	2314.2281	2314.2281	R	H	207	229
PSM	LLEGEESRLESGMQNMSIHTK	350	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=7639	48.717	2	2388.1413	2388.1413	K	T	394	415
PSM	LVSNHSLHETSSVFVDSLTK	351	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	20-UNIMOD:188	ms_run[2]:scan=7134	45.552	3	2205.1373	2205.1373	R	A	2513	2533
PSM	NHQEEDLTEFLCANHVLK	352	sp|Q9BT09|CNPY3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	12-UNIMOD:4	ms_run[2]:scan=9241	59.045	2	2196.027	2196.0270	R	G	183	201
PSM	NYLHYSLYDQAEKLVSK	353	sp|O43242-2|PSMD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=8662	55.235	2	2070.0422	2070.0422	R	S	119	136
PSM	RISIVENCFGAAGQPLTIPGR	354	sp|Q9H8W4|PKHF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:267,8-UNIMOD:4,21-UNIMOD:267	ms_run[2]:scan=8653	55.181	3	2275.201	2275.2010	R	V	14	35
PSM	SHGKDEECVLEAENK	355	sp|Q9UHQ4|BAP29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	8-UNIMOD:4	ms_run[2]:scan=2219	15.756	2	1743.7734	1743.7734	K	K	164	179
PSM	SIYGEKFEDENFILK	356	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=8609	54.906	2	1830.904	1830.9040	K	H	77	92
PSM	SKHEEIDLVSLEEFYK	357	sp|Q13769|THOC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=9726	62.251	2	1964.9731	1964.9731	K	E	152	168
PSM	TPNDGSYEQHISHMQK	358	sp|Q86YS7|C2CD5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=3063	20.788	2	1870.8268	1870.8268	K	K	601	617
PSM	TTGIVMDSGDGVTHTVPIYEGYALPHAILR	359	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:35,30-UNIMOD:267	ms_run[2]:scan=9851	63.096	3	3208.6102	3208.6102	R	L	148	178
PSM	VAEEHAPSIVFIDEIDAIGTKR	360	sp|P62191-2|PRS4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=10771	69.261	3	2409.254	2409.2540	R	Y	200	222
PSM	VAHEEERVGLNAQAACAPR	361	sp|P48681|NEST_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	16-UNIMOD:4	ms_run[2]:scan=3270	22.026	3	2077.0123	2077.0123	R	C	142	161
PSM	VAHEEERVGLNAQAACAPR	362	sp|P48681|NEST_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	16-UNIMOD:4	ms_run[2]:scan=3274	22.05	2	2077.0123	2077.0123	R	C	142	161
PSM	VIISAPSADAPMFVMGVNHEKYDNSLK	363	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	21-UNIMOD:188,27-UNIMOD:188	ms_run[2]:scan=9183	58.678	2	2944.4866	2944.4866	R	I	119	146
PSM	VSGGLEVLAEKCPNLTHLNLSGNK	364	sp|P39687|AN32A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	12-UNIMOD:4	ms_run[2]:scan=8880	56.744	3	2549.3272	2549.3272	R	I	76	100
PSM	YASICQQNGIVPIVEPEILPDGDHDLKR	365	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	5-UNIMOD:4	ms_run[1]:scan=9566	61.19931333333333	3	3175.599524	3175.597199	R	C	174	202
PSM	GTNDMKQQHVIETLIGK	366	sp|P48643|TCPE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	6-UNIMOD:188,17-UNIMOD:188	ms_run[1]:scan=6747	43.18345	2	1923.038876	1923.028655	K	K	497	514
PSM	CSDAAGYPHATHDLEGPPLDAYSIQGQHTISPLDLAK	367	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:385,1-UNIMOD:4,37-UNIMOD:188	ms_run[1]:scan=10039	64.33107166666667	3	3933.8594	3933.8570	R	L	201	238
PSM	ALELDHKNAQAQQEFK	368	sp|Q99615|DNJC7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=3657	24.35545666666667	2	1869.937432	1868.938075	R	N	122	138
PSM	ALVDHENVISCPHLGASTK	369	sp|O43175|SERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	11-UNIMOD:4,19-UNIMOD:188	ms_run[2]:scan=5434	35.104	3	2053.0358	2053.0358	R	E	271	290
PSM	AVEHINKTIAPALVSK	370	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	7-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=4519	29.571	2	1702.018	1702.0180	K	K	65	81
PSM	AVLSAEQLRDEEVHAGLGELLR	371	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9866	63.196	2	2404.271	2404.2710	K	S	95	117
PSM	CEAFGWHAIIVDGHSVEELCK	372	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:4,20-UNIMOD:4,21-UNIMOD:188	ms_run[2]:scan=9020	57.628	2	2462.1454	2462.1454	R	A	206	227
PSM	CSALATQYMHCVNHAK	373	sp|Q9NX63|MIC19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=4565	29.853	2	1889.8335	1889.8335	K	Q	204	220
PSM	DKFNECGHVLYADIK	374	sp|P52272-2|HNRPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:4	ms_run[2]:scan=5908	38.011	2	1807.8563	1807.8563	K	M	632	647
PSM	DLAAFDKSHDQAVR	375	sp|P09960|LKHA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=3910	25.868	2	1571.7692	1571.7692	K	T	574	588
PSM	ELQELVQYPVEHPDKFLK	376	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=8524	54.369	2	2211.1576	2211.1576	R	F	488	506
PSM	GAPLVKPLPVNPTDPAVTGPDIFAK	377	sp|Q9H3S7|PTN23_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9707	62.124	3	2513.3894	2513.3894	K	L	335	360
PSM	GAPLVKPLPVNPTDPAVTGPDIFAK	378	sp|Q9H3S7|PTN23_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9717	62.188	2	2513.3894	2513.3894	K	L	335	360
PSM	GHGDSVDQLCWHPSNPDLFVTASGDK	379	sp|Q96J01-2|THOC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	10-UNIMOD:4,26-UNIMOD:188	ms_run[2]:scan=8555	54.563	2	2844.2869	2844.2869	R	T	97	123
PSM	GLDVDSLVIEHIQVNKAPK	380	sp|P18621-2|RL17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=8870	56.684	2	2074.1423	2074.1423	K	M	68	87
PSM	GLLKPGLNVVLEGPK	381	sp|Q99848|EBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=8101	51.612	2	1544.9693	1544.9693	R	K	30	45
PSM	HAEQERDELADEITNSASGK	382	sp|P35580|MYH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=5428	35.07	3	2199.004	2199.0040	R	S	1705	1725
PSM	HIVVSCAAGVTISSVEKK	383	sp|Q96C36|P5CR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:4,17-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=5615	36.226	3	1896.0541	1896.0541	R	L	90	108
PSM	HNPTVTGHQEQTYLQK	384	sp|Q71RC2-7|LARP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=2524	17.578	2	1879.9177	1879.9177	R	E	413	429
PSM	HQEGEIFDTEKEK	385	sp|Q02878|RL6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	11-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=2702	18.652	2	1600.7772	1600.7772	R	Y	227	240
PSM	HTGPGILSMANAGPNTNGSQFFICTAK	386	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	24-UNIMOD:4	ms_run[2]:scan=9540	61.022	3	2790.3218	2790.3218	K	T	92	119
PSM	HTHVQDGEAGGITQQIGATNVPLEAINEQTK	387	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=7703	49.108	2	3255.612	3255.6120	R	M	653	684
PSM	HVGMAVAGLLADAR	388	sp|P25788-2|PSA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:267	ms_run[2]:scan=7876	50.175	2	1389.7426	1389.7426	R	S	73	87
PSM	HVGPGVLSMANAGPNTNGSQFFICTIK	389	sp|P30405|PPIF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	24-UNIMOD:4	ms_run[2]:scan=10209	65.44	2	2816.3738	2816.3738	K	T	134	161
PSM	HYGPGWVSMANAGK	390	sp|P23284|PPIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=5752	37.076	2	1473.6823	1473.6823	K	D	132	146
PSM	IEKVEHSDLSFSK	391	sp|P61769|B2MG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=3589	23.932	2	1529.8128	1529.8128	R	D	66	79
PSM	IHFPLATYAPVISAEK	392	sp|P68363-2|TBA1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9380	59.942	2	1755.956	1755.9560	R	A	149	165
PSM	IHNAENIQPGEQKYEYK	393	sp|Q04637-6|IF4G1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=3247	21.885	2	2059.9963	2059.9963	K	S	385	402
PSM	IHVELSEKGEATQK	394	sp|Q15075|EEA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=2818	19.323	2	1567.8206	1567.8206	R	L	363	377
PSM	IKNPFLSLAACVMPSR	395	sp|Q92616|GCN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	11-UNIMOD:4	ms_run[2]:scan=11741	76.092	2	1802.9535	1802.9535	R	L	897	913
PSM	IKQHLENDPGSNEDTDIPK	396	sp|O43396|TXNL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=3103	21.029	2	2161.069	2161.0690	K	G	103	122
PSM	IQEIIEQLDVTTSEYEKEK	397	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	17-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=9331	59.627	2	2306.1932	2306.1932	R	L	371	390
PSM	IVKEAHEPLAVADAK	398	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=3080	20.892	2	1589.8777	1589.8777	K	L	79	94
PSM	IYESHVGISSHEGK	399	sp|Q04446|GLGB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:188	ms_run[2]:scan=2087	14.982	2	1547.7675	1547.7675	R	V	199	213
PSM	KDMSGHYQNALYLGDVSER	400	sp|P53621|COPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=6042	38.84	3	2182.0113	2182.0113	R	V	727	746
PSM	KECENCDCLQGFQLTHSLGGGTGSGMGTLLISK	401	sp|Q13509|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:4,6-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=9937	63.664	3	3554.6262	3554.6262	R	V	122	155
PSM	KGVLFGVPGAFTPGCSK	402	sp|P30044-2|PRDX5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	15-UNIMOD:4	ms_run[2]:scan=8475	54.055	2	1720.8971	1720.8971	K	T	34	51
PSM	KLAEEEDLFDSAHPEEGDLDLASESTAHAQSSK	403	sp|Q14151|SAFB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=7628	48.651	3	3555.6125	3555.6125	R	A	252	285
PSM	KLDEAVAEAHLGK	404	sp|P23526-2|SAHH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=3778	25.069	2	1391.7811	1391.7811	K	L	361	374
PSM	KYSCVILDEAHER	405	sp|Q9H6R0-2|DHX33_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:4	ms_run[2]:scan=4541	29.699	2	1618.7773	1618.7773	R	T	14	27
PSM	LTVNYEQCASGVHGPEGFHYK	406	sp|P19525-2|E2AK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	8-UNIMOD:4,21-UNIMOD:188	ms_run[2]:scan=6301	40.424	2	2398.1108	2398.1108	R	C	114	135
PSM	LTVNYEQCASGVHGPEGFHYK	407	sp|P19525-2|E2AK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	8-UNIMOD:4	ms_run[2]:scan=6308	40.469	2	2392.0906	2392.0906	R	C	114	135
PSM	LYGPTNFAPIINHVAR	408	sp|Q99829|CPNE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	16-UNIMOD:267	ms_run[2]:scan=9090	58.091	2	1791.966	1791.9660	R	F	385	401
PSM	LYHNEVEIEKLNK	409	sp|Q14683|SMC1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=4345	28.512	2	1627.857	1627.8570	K	E	228	241
PSM	MHDLNTDQENLVGTHDAPIR	410	sp|O43684-2|BUB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:35,20-UNIMOD:267	ms_run[2]:scan=4967	32.252	3	2301.0683	2301.0683	K	C	81	101
PSM	NLQNLLILTAIKADR	411	sp|Q00610-2|CLH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=11165	71.933	2	1695.0043	1695.0043	R	T	1023	1038
PSM	NTEIGFLQDALSKPHGTVK	412	sp|Q6PI48|SYDM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=8123	51.756	2	2054.0797	2054.0797	R	A	350	369
PSM	PPSAFFLFCSEYRPK	413	sp|P09429|HMGB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	9-UNIMOD:4	ms_run[2]:scan=10459	67.08	2	1844.892	1844.8920	R	I	98	113
PSM	QIIEQDKHALLDVTPK	414	sp|Q9UDY2-5|ZO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	7-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=5811	37.438	2	1859.0555	1859.0555	R	A	781	797
PSM	SEASAFGASHHVAYFEASAK	415	sp|P10301|RRAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	20-UNIMOD:188	ms_run[2]:scan=5623	36.277	3	2071.9695	2071.9695	R	L	155	175
PSM	SHMMDVQGSTQDSAIKDFVLK	416	sp|P13667|PDIA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:35	ms_run[2]:scan=7279	46.459	2	2352.109	2352.1090	R	Y	371	392
PSM	SHMMDVQGSTQDSAIKDFVLK	417	sp|P13667|PDIA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=7888	50.252	3	2336.1141	2336.1141	R	Y	371	392
PSM	SLYHDISGDTSGDYRK	418	sp|P50995-2|ANX11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=4285	28.147	2	1812.8279	1812.8279	K	I	447	463
PSM	SSGFPVHLLPDIAEPGSVAGR	419	sp|Q9UHJ6|SHPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	21-UNIMOD:267	ms_run[2]:scan=10191	65.331	3	2115.0988	2115.0988	R	T	219	240
PSM	SSTATHPPGPAVQLNKTPSSSK	420	sp|Q14684-2|RRP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=2991	20.357	3	2191.1233	2191.1233	K	K	643	665
PSM	STDRLPSAHTCFNQLDLPAYESFEK	421	sp|Q7Z6Z7-2|HUWE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	11-UNIMOD:4	ms_run[2]:scan=8989	57.432	3	2925.3603	2925.3603	R	L	4315	4340
PSM	STGEAFVQFASQEIAEK	422	sp|P31943|HNRH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	17-UNIMOD:188	ms_run[2]:scan=10293	65.985	2	1846.9044	1846.9044	R	A	151	168
PSM	TKPSDEEMLFIYGHYK	423	sp|P07108|ACBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=7764	49.493	2	1968.9694	1968.9694	K	Q	18	34
PSM	TLSDYNIQKESTLHLVLR	424	sp|P62987|RL40_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=7895	50.294	2	2129.1481	2129.1481	R	L	55	73
PSM	TMSAQIEGGVHGLHSYEK	425	sp|P20839-2|IMDH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	18-UNIMOD:188	ms_run[2]:scan=5532	35.704	2	1948.9408	1948.9408	R	R	469	487
PSM	TQIAICPNNHEVHIYEK	426	sp|O15143|ARC1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:4	ms_run[2]:scan=5540	35.756	2	2065.0051	2065.0051	R	S	21	38
PSM	TTGIVMDSGDGVTHTVPIYEGYALPHAILR	427	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:35,30-UNIMOD:267	ms_run[2]:scan=9697	62.061	3	3208.6102	3208.6102	R	L	148	178
PSM	TTGIVMDSGDGVTHTVPIYEGYALPHAILR	428	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	30-UNIMOD:267	ms_run[2]:scan=10203	65.405	3	3192.6153	3192.6153	R	L	148	178
PSM	TTGIVMDSGDGVTHTVPIYEGYALPHAILR	429	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=10205	65.42	3	3182.607	3182.6070	R	L	148	178
PSM	VFQSLPHENKPLTLSNYQTNK	430	sp|P04080|CYTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=6125	39.339	2	2457.2652	2457.2652	R	A	69	90
PSM	VFYELQHSDKPVGTK	431	sp|Q93009-3|UBP7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=4380	28.722	2	1746.8941	1746.8941	R	K	247	262
PSM	VFYELQHSDKPVGTK	432	sp|Q93009-3|UBP7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	10-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=4389	28.772	2	1758.9343	1758.9343	R	K	247	262
PSM	VHTFVVDCSNREDIYSSAK	433	sp|Q8NBQ5|DHB11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	8-UNIMOD:4	ms_run[2]:scan=5266	34.066	2	2226.0375	2226.0375	K	K	87	106
PSM	VRGLPWSCSADEVQR	434	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	8-UNIMOD:4	ms_run[2]:scan=6140	39.432	2	1758.8472	1758.8472	K	F	15	30
PSM	VSGGLEVLAEKCPNLTHLNLSGNK	435	sp|P39687|AN32A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	11-UNIMOD:188,12-UNIMOD:4,24-UNIMOD:188	ms_run[2]:scan=8895	56.842	3	2561.3674	2561.3674	R	I	76	100
PSM	QLEAIDQLHLEYAKR	436	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:28,14-UNIMOD:188,15-UNIMOD:267	ms_run[1]:scan=9362	59.829248333333325	2	1824.9725	1824.9700	K	A	522	537
PSM	QLFHPEQLITGKEDAANNYAR	437	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:28	ms_run[1]:scan=9096	58.1301	3	2397.1665	2397.1708	R	G	85	106
PSM	HVNGQDQIVPGLYACGEAACASVHGANR	438	sp|P31040|SDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	15-UNIMOD:4,20-UNIMOD:4,28-UNIMOD:267	ms_run[1]:scan=7561	48.231653333333334	3	2961.342487	2960.364526	R	L	424	452
PSM	FGNQADHFLGSLAFAK	439	sp|Q9H488|OFUT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	16-UNIMOD:188	ms_run[1]:scan=9412	60.13141666666666	2	1727.880898	1727.872684	R	L	44	60
PSM	TQLIAHDKEVYDIAFSR	440	sp|P61962|DCAF7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=7394	47.19157166666667	2	2006.028842	2005.026891	K	A	168	185
PSM	AGVENGKPTHFTVYTK	441	sp|O75369-5|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	7-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=3420	22.905	2	1759.9296	1759.9296	K	G	858	874
PSM	AIMTYVSSFYHAFSGAQKAETAANR	442	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=11419	73.738	3	2720.3017	2720.3017	K	I	256	281
PSM	ALELDHKNAQAQQEFK	443	sp|Q99615-2|DNJC7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	7-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=3656	24.35	2	1880.9783	1880.9783	R	N	66	82
PSM	AVLSAEQLRDEEVHAGLGELLR	444	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	9-UNIMOD:267,22-UNIMOD:267	ms_run[2]:scan=9898	63.408	2	2424.2876	2424.2876	K	S	95	117
PSM	CIDLDTEEHIYHLK	445	sp|Q9H4L5-8|OSBL3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=6965	44.507	2	1790.8605	1790.8605	K	V	114	128
PSM	DIDFLAEKDHTTLLSEVMTPR	446	sp|P20839-2|IMDH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=11061	71.242	2	2430.2101	2430.2101	R	I	137	158
PSM	EAIVNSCVFVHQTLHQANAR	447	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	7-UNIMOD:4,20-UNIMOD:267	ms_run[2]:scan=6546	41.928	2	2303.1469	2303.1469	R	L	3141	3161
PSM	EGQGLGKHEQGLSTALSVEK	448	sp|Q96I25|SPF45_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=4834	31.465	2	2067.0596	2067.0596	R	T	250	270
PSM	EIGNLLHPSVPISNDEDVDNKVER	449	sp|P49591|SYSC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=7331	46.783	2	2688.3355	2688.3355	R	I	134	158
PSM	EVVHTVSLHEIDVINSR	450	sp|Q9Y230-2|RUVB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=6983	44.621	2	1946.0221	1946.0221	K	T	192	209
PSM	GAVLPHFNVLFDGLSK	451	sp|Q08AM6|VAC14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=11207	72.217	2	1712.925	1712.9250	R	L	126	142
PSM	GHAAFTSDPKPTIEVSGK	452	sp|P00390-5|GSHR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	10-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=4171	27.447	2	1852.9722	1852.9722	R	K	172	190
PSM	GLLKPGLNVVLEGPK	453	sp|Q99848|EBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=8103	51.623	2	1532.929	1532.9290	R	K	30	45
PSM	GQHEPSKPPPAGETVTGGFGAK	454	sp|Q9H6F5|CCD86_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	7-UNIMOD:188,22-UNIMOD:188	ms_run[2]:scan=3472	23.214	2	2160.1002	2160.1002	R	K	191	213
PSM	HCQLEPDHEGVPEETDDFGEFR	455	sp|Q9Y5L0-5|TNPO3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:4,22-UNIMOD:267	ms_run[2]:scan=6829	43.684	2	2652.1062	2652.1062	R	M	379	401
PSM	HEKEIDAYIVQAK	456	sp|Q9H6H4-2|REEP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=4549	29.749	2	1554.8445	1554.8445	R	E	99	112
PSM	HELQANCYEEVKDR	457	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	7-UNIMOD:4	ms_run[2]:scan=2851	19.514	3	1789.8053	1789.8053	K	C	133	147
PSM	HESAEIFVVCQGFLAPDKVDSK	458	sp|Q8IY81|SPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	10-UNIMOD:4	ms_run[2]:scan=9076	58.003	2	2475.2104	2475.2104	R	F	188	210
PSM	HGAGAEISTVHPEQYAK	459	sp|Q8TBX8-2|PI42C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=3618	24.115	3	1793.8697	1793.8697	K	R	346	363
PSM	HGAGAEISTVNPEQYSKR	460	sp|P48426-2|PI42A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=4173	27.459	2	1942.9497	1942.9497	K	F	320	338
PSM	HLMLPDFDLLEDIESK	461	sp|P13010|XRCC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=12781	84.635	2	1913.9445	1913.9445	R	I	82	98
PSM	HLVYESDQNKDGK	462	sp|O43852-9|CALU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	10-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=1115	9.3929	2	1543.7669	1543.7669	R	L	111	124
PSM	IGEHTPSALAIMENANVLAR	463	sp|P04075-2|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=10287	65.944	2	2106.0892	2106.0892	K	Y	208	228
PSM	IQHSITAQDHQPTPDSCIISMVVGQLK	464	sp|P61970|NTF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	17-UNIMOD:4	ms_run[2]:scan=11106	71.557	3	3002.4954	3002.4954	K	A	64	91
PSM	ISVYYNEASSHKYVPR	465	sp|Q13509|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=4728	30.824	2	1911.9479	1911.9479	R	A	47	63
PSM	KETSGTQGIEGHLK	466	sp|P56181-2|NDUV3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=1948	14.183	2	1483.7631	1483.7631	R	G	352	366
PSM	KIPNPDFFEDLEPFR	467	sp|P27824-3|CALX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=11744	76.117	2	1862.9203	1862.9203	R	M	293	308
PSM	LHIIEVGTPPTGNQPFPK	468	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	18-UNIMOD:188	ms_run[2]:scan=7496	47.824	2	1950.067	1950.0670	K	K	228	246
PSM	LKVPPAINQFTQALDR	469	sp|P62424|RL7A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=10239	65.636	2	1810.0101	1810.0101	R	Q	74	90
PSM	LLIHQSLAGGIIGVK	470	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	15-UNIMOD:188	ms_run[2]:scan=8021	51.083	2	1523.9495	1523.9495	R	G	125	140
PSM	LPNFGSHVLTPAEMEAFK	471	sp|Q14C86-3|GAPD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	18-UNIMOD:188	ms_run[2]:scan=9759	62.477	2	1993.0075	1993.0075	R	Q	871	889
PSM	LTLYDIAHTPGVAADLSHIETK	472	sp|P40926-2|MDHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=10530	67.561	2	2364.2325	2364.2325	R	A	53	75
PSM	LYGPTNFAPIINHVAR	473	sp|Q99829|CPNE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=9095	58.124	2	1781.9577	1781.9577	R	F	385	401
PSM	MCKQDPSVLHTEEMR	474	sp|Q8NFI4|F10A5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:4	ms_run[2]:scan=3522	23.517	2	1859.8328	1859.8328	K	F	15	30
PSM	NFPNAIEHTLQWAR	475	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	14-UNIMOD:267	ms_run[2]:scan=9410	60.121	2	1705.8564	1705.8564	K	D	596	610
PSM	NNRQPYAVSELAGHQTSAESWGTGR	476	sp|P36578|RL4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=6178	39.662	2	2715.275	2715.2750	K	A	47	72
PSM	PKFYCDYCDTYLTHDSPSVR	477	sp|P09234|RU1C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	5-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=6697	42.871	2	2523.0835	2523.0835	M	K	2	22
PSM	SHTSEGAHLDITPNSGAAGNSAGPK	478	sp|Q92597-3|NDRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	25-UNIMOD:188	ms_run[2]:scan=3382	22.692	3	2381.1303	2381.1303	R	S	283	308
PSM	SKHEEIDLVSLEEFYK	479	sp|Q13769|THOC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=9700	62.079	2	1977.0134	1977.0134	K	E	152	168
PSM	TCQQTWEKLHAATSK	480	sp|P21283|VATC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:4	ms_run[2]:scan=3891	25.755	2	1787.8625	1787.8625	K	N	14	29
PSM	TGVHHYSGNNIELGTACGK	481	sp|P62888|RL30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	17-UNIMOD:4	ms_run[2]:scan=3226	21.757	2	2013.9327	2013.9327	K	Y	69	88
PSM	TTGIVMDSGDGVTHTVPIYEGYALPHAILR	482	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=10368	66.481	3	3182.607	3182.6070	R	L	148	178
PSM	VFNTTPDDLDLHVIYDVSHNIAK	483	sp|Q9Y3I0|RTCB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	23-UNIMOD:188	ms_run[2]:scan=11186	72.075	2	2631.3276	2631.3276	K	V	335	358
PSM	VPTISINKTDGCHAYLSK	484	sp|Q01518-2|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	12-UNIMOD:4	ms_run[2]:scan=5412	34.967	2	2003.0146	2003.0146	K	N	404	422
PSM	VPTISINKTDGCHAYLSK	485	sp|Q01518-2|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	8-UNIMOD:188,12-UNIMOD:4,18-UNIMOD:188	ms_run[2]:scan=5413	34.973	2	2015.0549	2015.0549	K	N	404	422
PSM	VYAILTHGIFSGPAISR	486	sp|P60891-2|PRPS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=9736	62.321	2	1800.9887	1800.9887	R	I	177	194
PSM	YTEFYHVPTHSDASK	487	sp|Q96HC4-3|PDLI5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=4313	28.313	2	1780.8057	1780.8057	R	K	124	139
PSM	QLEAIDQLHLEYAKR	488	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:28	ms_run[1]:scan=9365	59.84577333333333	2	1808.9440	1808.9416	K	A	522	537
PSM	CPSIAAAIAAVNALHGR	489	sp|Q14498|RBM39_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=12837	85.17546833333334	2	1673.8620	1673.8666	K	W	478	495
PSM	HVNGQDQIVPGLYACGEAACASVHGANR	490	sp|P31040|SDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	15-UNIMOD:4,20-UNIMOD:4	ms_run[1]:scan=7551	48.166005	3	2951.336785	2950.356257	R	L	424	452
PSM	ATDAMAHVAGFTVAHDVSAR	491	sp|Q96GK7|FAH2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=6389	40.97486666666667	3	2025.963364	2025.969058	K	D	175	195
PSM	KHQVSVEGTNQTDVK	492	sp|Q14676|MDC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=1145	9.564328333333334	2	1668.854729	1668.843112	K	A	540	555
PSM	AAPRPAPVAQPPAAAPPSAVGSSAAAPR	493	sp|Q9Y6H1|CHCH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=4700	30.661	2	2532.3561	2532.3561	R	Q	24	52
PSM	ADIEMPFDPSKVVASGPGLEHGK	494	sp|O75369-5|FLNB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	11-UNIMOD:188,23-UNIMOD:188	ms_run[2]:scan=9112	58.235	3	2392.2136	2392.2136	K	V	1125	1148
PSM	ADLTEYLSTHYKAPR	495	sp|P31930|QCR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7013	44.807	2	1763.8842	1763.8842	R	M	214	229
PSM	AEKVHELNEEIGK	496	sp|Q9NQ29-2|LUC7L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=2684	18.551	2	1494.7678	1494.7678	K	L	123	136
PSM	AQQNNVEHKVETFSGVYK	497	sp|P62081|RS7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	9-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=5578	35.993	2	2089.0631	2089.0631	K	K	161	179
PSM	ASIHEAWTDGKEAMLK	498	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	11-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=6024	38.734	2	1797.9122	1797.9122	K	H	422	438
PSM	ASVHTLSGHTNAVATVR	499	sp|O43660-2|PLRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	17-UNIMOD:267	ms_run[2]:scan=2802	19.23	3	1729.9099	1729.9099	K	C	312	329
PSM	ATDAMAHVAGFTVAHDVSAR	500	sp|Q96GK7|FAH2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	20-UNIMOD:267	ms_run[2]:scan=6372	40.87	3	2035.9773	2035.9773	K	D	175	195
PSM	DAHSIHGTNPQYLVEK	501	sp|Q8NAV1|PR38A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=4274	28.074	2	1807.8853	1807.8853	K	I	8	24
PSM	DHASIQMNVAEVDKVTGR	502	sp|P63220|RS21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=6652	42.588	2	1968.9687	1968.9687	K	F	28	46
PSM	DSFDDRGPSLNPVLDYDHGSR	503	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:267,21-UNIMOD:267	ms_run[2]:scan=7432	47.435	3	2381.0787	2381.0787	R	S	187	208
PSM	DTSNHFHVFVGDLSPEITTEDIK	504	sp|P31483-2|TIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	23-UNIMOD:188	ms_run[2]:scan=9638	61.672	2	2606.2596	2606.2596	K	A	90	113
PSM	EGDYVLFHHEGGVDVGDVDAK	505	sp|P53396|ACLY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=6987	44.646	2	2257.0287	2257.0287	R	A	128	149
PSM	EGQEDQGLTKDFSNSPLHR	506	sp|O95758-7|PTBP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=5733	36.96	3	2157.0087	2157.0087	R	F	345	364
PSM	EGQEDQGLTKDFSNSPLHR	507	sp|O95758-7|PTBP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=5755	37.093	2	2157.0087	2157.0087	R	F	345	364
PSM	EGQEDQGLTKDYGNSPLHR	508	sp|P26599|PTBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=4346	28.518	2	2142.993	2142.9930	R	F	419	438
PSM	ELQPGSHIQSDKEIDAFVR	509	sp|Q8NE62|CHDH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=6413	41.113	2	2168.0862	2168.0862	K	A	485	504
PSM	ESLCDSPHQNLSRPLLENK	510	sp|O15042-2|SR140_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	4-UNIMOD:4	ms_run[2]:scan=5064	32.853	2	2236.0906	2236.0906	R	L	62	81
PSM	FGMTPSKGVLFYGPPGCGK	511	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:188,17-UNIMOD:4,19-UNIMOD:188	ms_run[2]:scan=8081	51.482	2	2011.0098	2011.0098	K	T	506	525
PSM	FKEANNFLWPFK	512	sp|P18124|RL7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=10669	68.565	2	1539.7874	1539.7874	R	L	201	213
PSM	FKGFPQPILSEDGSR	513	sp|Q9NZM1-2|MYOF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7329	46.767	2	1676.8522	1676.8522	R	I	1641	1656
PSM	FLSSAAAVSKEHPVVISK	514	sp|P27708|PYR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=5192	33.622	2	1869.036	1869.0360	R	F	1110	1128
PSM	GFFIKPTVFGGVQDDMR	515	sp|P30837|AL1B1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9890	63.355	3	1912.9506	1912.9506	R	I	395	412
PSM	GIYLRDPVQVAAPSDHGVGIEPVFPENTENSEK	516	sp|P29144|TPP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9230	58.975	3	3563.7532	3563.7532	R	I	532	565
PSM	GLGTDEDSLIEIICSR	517	sp|P07355-2|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	14-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=11653	75.399	2	1786.8646	1786.8646	K	T	138	154
PSM	GYLNKDTHDQLSEPSEVR	518	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=4295	28.203	3	2086.992	2086.9920	R	S	3964	3982
PSM	HCDEVGFNAEEAHNIVK	519	sp|P51808|DYLT3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:4	ms_run[2]:scan=5237	33.888	3	1967.8796	1967.8796	R	E	7	24
PSM	HEKEIDAYIVQAK	520	sp|Q9H6H4-2|REEP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=4542	29.705	2	1542.8042	1542.8042	R	E	99	112
PSM	HFNALGGWGELQNSVK	521	sp|P09960|LKHA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	16-UNIMOD:188	ms_run[2]:scan=8595	54.823	3	1761.8894	1761.8894	R	T	340	356
PSM	HGAGAEISTVNPEQYSKR	522	sp|P48426-2|PI42A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=4148	27.301	3	1942.9497	1942.9497	K	F	320	338
PSM	HIVVSCAAGVTISSIEKK	523	sp|P32322-3|P5CR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:4	ms_run[2]:scan=6292	40.368	2	1898.0295	1898.0295	R	L	117	135
PSM	HIVVSCAAGVTISSVEKK	524	sp|Q96C36|P5CR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:4	ms_run[2]:scan=5629	36.311	2	1884.0139	1884.0139	R	L	90	108
PSM	HLVYESDQNKDGK	525	sp|O43852-9|CALU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=1116	9.3981	2	1531.7267	1531.7267	R	L	111	124
PSM	HTGPGILSMANAGPNTNGSQFFICTAK	526	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	9-UNIMOD:35,24-UNIMOD:4,27-UNIMOD:188	ms_run[2]:scan=8230	52.446	2	2812.3368	2812.3368	K	T	92	119
PSM	HTGPGILSMANAGPNTNGSQFFICTAK	527	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	24-UNIMOD:4,27-UNIMOD:188	ms_run[2]:scan=9516	60.855	2	2796.3419	2796.3419	K	T	92	119
PSM	IANCIVHSTDKGPNSALVQQLIK	528	sp|Q5H9R7-3|PP6R3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	4-UNIMOD:4	ms_run[2]:scan=7681	48.976	3	2505.3373	2505.3373	R	D	413	436
PSM	IEKVEHSDLSFSK	529	sp|P61769|B2MG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=3597	23.981	2	1517.7726	1517.7726	R	D	66	79
PSM	IHVELSEKGEATQK	530	sp|Q15075|EEA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	8-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=2819	19.329	2	1579.8608	1579.8608	R	L	363	377
PSM	IKVDEFVTHNLSFDEINK	531	sp|P11766|ADHX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=8825	56.373	3	2159.1301	2159.1301	K	A	340	358
PSM	KECENCDCLQGFQLTHSLGGGTGSGMGTLLISK	532	sp|Q13509|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:188,3-UNIMOD:4,6-UNIMOD:4,8-UNIMOD:4,33-UNIMOD:188	ms_run[2]:scan=9942	63.699	3	3566.6665	3566.6665	R	V	122	155
PSM	KNDPQSITADDLHQLLVVAR	533	sp|Q9BTE3-3|MCMBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9927	63.6	3	2232.1862	2232.1862	R	C	407	427
PSM	KTANDMIHAENMR	534	sp|P26038|MOES_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=2972	20.242	2	1529.7079	1529.7079	K	L	538	551
PSM	KVVENEIYSESHR	535	sp|Q96I51-2|RCC1L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=2649	18.338	2	1588.7845	1588.7845	R	V	209	222
PSM	LFLFHTSLPIAEAPGK	536	sp|P53992|SC24C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	16-UNIMOD:188	ms_run[2]:scan=10399	66.678	2	1745.9812	1745.9812	K	L	639	655
PSM	LGATIEHISVSPAGDLFCTSHSDNK	537	sp|Q8IWA0|WDR75_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	18-UNIMOD:4,25-UNIMOD:188	ms_run[2]:scan=8300	52.891	3	2661.28	2661.2800	R	I	289	314
PSM	LGETYKDHENIVIAK	538	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=4375	28.697	2	1728.9046	1728.9046	K	M	410	425
PSM	LICCDILDVLDKHLIPAANTGESK	539	sp|P62258-2|1433E_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:4,4-UNIMOD:4,12-UNIMOD:188,24-UNIMOD:188	ms_run[2]:scan=12138	79.14	2	2706.4123	2706.4123	K	V	73	97
PSM	LLEGEESRLESGMQNMSIHTK	540	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	16-UNIMOD:35	ms_run[2]:scan=6181	39.68	2	2404.1363	2404.1363	K	T	394	415
PSM	LLEGEESRLESGMQNMSIHTK	541	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7634	48.691	3	2388.1413	2388.1413	K	T	394	415
PSM	MDSTANEVEAVKVHSFPTLK	542	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7243	46.231	2	2202.0991	2202.0991	K	F	425	445
PSM	NKITLQDVVSHSK	543	sp|P46940|IQGA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=4819	31.376	2	1467.8045	1467.8045	K	K	923	936
PSM	NVLGHMQQGGAPSPFDR	544	sp|Q01813-2|PFKAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	17-UNIMOD:267	ms_run[2]:scan=6287	40.336	2	1819.8663	1819.8663	K	N	659	676
PSM	NVTHIDQALQEAHR	545	sp|Q5HYK3|COQ5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=4207	27.664	2	1630.8176	1630.8176	R	V	221	235
PSM	RPTPQDSPIFLPVDDTSFR	546	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9372	59.891	3	2187.096	2187.0960	R	W	1405	1424
PSM	RQFASQANVVGPWIQTK	547	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7311	46.661	2	1929.0221	1929.0221	R	M	652	669
PSM	RVNQAIWLLCTGAR	548	sp|P46782|RS5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:267,10-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=8333	53.103	2	1676.9048	1676.9048	R	E	146	160
PSM	SFVPDKGAHYCVPCYENK	549	sp|Q13643|FHL3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	11-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=5582	36.021	2	2169.9612	2169.9612	R	F	140	158
PSM	SHGKDEECVLEAENK	550	sp|Q9UHQ4|BAP29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	4-UNIMOD:188,8-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=2193	15.592	2	1755.8136	1755.8136	K	K	164	179
PSM	SHGLFGLNENQLR	551	sp|Q96H79|ZCCHL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7103	45.359	2	1483.7532	1483.7532	K	I	142	155
PSM	SLSNTKPTVNEHDLLK	552	sp|O75351|VPS4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=4663	30.443	2	1794.9476	1794.9476	R	L	417	433
PSM	SNYNFEKPFLWLAR	553	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=11162	71.915	2	1783.9046	1783.9046	K	K	153	167
PSM	SPSGSQRPSVSDDTEHLVNGR	554	sp|P16144-2|ITB4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:267,21-UNIMOD:267	ms_run[2]:scan=4069	26.82	2	2244.0634	2244.0634	R	M	1356	1377
PSM	SSGFPVHLLPDIAEPGSVAGR	555	sp|Q9UHJ6|SHPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	21-UNIMOD:267	ms_run[2]:scan=10219	65.506	2	2115.0988	2115.0988	R	T	219	240
PSM	TDRYTIHSQLEHLQSK	556	sp|Q9BWJ5|SF3B5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:1	ms_run[2]:scan=5727	36.922	2	1996.9967	1996.9967	M	Y	2	18
PSM	TGVHHYSGNNIELGTACGK	557	sp|P62888|RL30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	17-UNIMOD:4,19-UNIMOD:188	ms_run[2]:scan=3238	21.831	2	2019.9528	2019.9528	K	Y	69	88
PSM	THPSVVPGSIAFSLPQR	558	sp|P46459|NSF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=8111	51.674	2	1791.9632	1791.9632	K	K	51	68
PSM	TKPSDEEMLFIYGHYK	559	sp|P07108|ACBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7769	49.527	2	1956.9291	1956.9292	K	Q	18	34
PSM	TMSAQIEGGVHGLHSYEK	560	sp|P20839-2|IMDH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=5530	35.692	2	1942.9207	1942.9207	R	R	469	487
PSM	TTGIVMDSGDGVTHTVPIYEGYALPHAILR	561	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:35	ms_run[2]:scan=9752	62.43	4	3198.6019	3198.6019	R	L	148	178
PSM	VANYCSTHLLEHITTNEDFR	562	sp|O75688-5|PPM1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	5-UNIMOD:4	ms_run[2]:scan=7526	48.003	2	2419.1227	2419.1227	R	A	67	87
PSM	VGIIPPKGCLLYGPPGTGK	563	sp|P62333|PRS10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:188,9-UNIMOD:4,19-UNIMOD:188	ms_run[2]:scan=7794	49.686	2	1935.1054	1935.1054	R	T	162	181
PSM	VLKQVHPDTGISSK	564	sp|Q99880|H2B1L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=1992	14.433	2	1507.8358	1507.8358	K	A	45	59
PSM	VRGLPWSCSADEVQR	565	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:267,8-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=6138	39.422	2	1778.8637	1778.8637	K	F	15	30
PSM	VWAHYEEQPVEEVMPVLEEKER	566	sp|Q7KZF4|SND1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=8956	57.222	3	2725.3058	2725.3058	K	S	657	679
PSM	LVSNHSLHETSSVFVDSLTK	567	sp|P21333|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	20-UNIMOD:188	ms_run[1]:scan=7664	48.87081833333333	3	2206.123170	2205.137291	R	A	2521	2541
PSM	TEELNREVAGHTEQLQMSR	568	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=5002	32.471898333333336	3	2228.069731	2227.065143	R	S	275	294
PSM	QQREDITQSAQHALR	569	sp|Q12906|ILF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:28	ms_run[1]:scan=4650	30.365403333333333	2	1762.8702	1762.8705	R	L	309	324
PSM	FRISLGLPVGAVINCADNTGAK	570	sp|P62829|RL23_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	2-UNIMOD:267,15-UNIMOD:4,22-UNIMOD:188	ms_run[1]:scan=10926	70.29588666666668	2	2289.234683	2288.228185	K	N	14	36
PSM	GLKYQEGGVESAFHK	571	sp|P40121|CAPG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=4599	30.060986666666665	2	1649.820707	1648.820920	R	T	113	128
PSM	AAVHLEGKIEQAQR	572	sp|P18206-2|VINC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=2888	19.72	2	1548.8372	1548.8372	K	W	489	503
PSM	AAVHTYGIASVPNQPLKK	573	sp|Q9UHI6|DDX20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=4864	31.639	2	1893.0472	1893.0472	K	Q	457	475
PSM	AEHDSILAEKAEK	574	sp|P26639|SYTC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=1833	13.513	2	1439.7256	1439.7256	K	D	66	79
PSM	AITACAELHDLKEVVLENQK	575	sp|Q9ULE6|PALD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	5-UNIMOD:4	ms_run[2]:scan=9215	58.879	2	2280.1784	2280.1784	R	K	378	398
PSM	ASIHEAWTDGKEAMLK	576	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6028	38.757	2	1785.872	1785.8720	K	H	422	438
PSM	DNHLLGTFDLTGIPPAPR	577	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	18-UNIMOD:267	ms_run[2]:scan=10235	65.611	2	1943.014	1943.0140	K	G	475	493
PSM	DTSNHFHVFVGDLSPEITTEDIK	578	sp|P31483-2|TIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9637	61.667	3	2600.2395	2600.2395	K	A	90	113
PSM	EDVFVHQTAIKK	579	sp|P16989-2|YBOX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=3181	21.486	2	1413.7616	1413.7616	K	N	114	126
PSM	EESGKPGAHVTVK	580	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=837	7.8345	2	1337.6939	1337.6939	R	K	88	101
PSM	ELKGELYCLPCHDK	581	sp|P48059|LIMS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	8-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=5086	32.982	2	1760.8226	1760.8226	R	M	174	188
PSM	FIQENIFGICPHMTEDNKDLIQGK	582	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	10-UNIMOD:4	ms_run[2]:scan=9444	60.335	2	2846.3731	2846.3731	K	D	235	259
PSM	GHGDSVDQLCWHPSNPDLFVTASGDK	583	sp|Q96J01-2|THOC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	10-UNIMOD:4,26-UNIMOD:188	ms_run[2]:scan=8585	54.761	3	2844.2869	2844.2869	R	T	97	123
PSM	GQHEPSKPPPAGETVTGGFGAK	584	sp|Q9H6F5|CCD86_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:188,22-UNIMOD:188	ms_run[2]:scan=3469	23.197	3	2160.1002	2160.1002	R	K	191	213
PSM	GVVHDDMECSHYMK	585	sp|P50579-3|MAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:4	ms_run[2]:scan=3434	22.985	2	1706.6851	1706.6851	K	N	349	363
PSM	GYFEYIEENKYSR	586	sp|Q00839-2|HNRPU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=7184	45.866	2	1696.7733	1696.7733	R	A	237	250
PSM	HESAEIFVVCQGFLAPDKVDSK	587	sp|Q8IY81|SPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	10-UNIMOD:4	ms_run[2]:scan=9068	57.951	3	2475.2104	2475.2104	R	F	188	210
PSM	HETLTSLNLEKK	588	sp|Q96A26|F162A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	11-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=3804	25.215	2	1423.8074	1423.8074	R	A	129	141
PSM	HGGTIPIVPTAEFQDR	589	sp|P00367-2|DHE3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=7230	46.15	2	1736.8846	1736.8846	K	I	314	330
PSM	HIVAVLPEIDPVLFQGK	590	sp|Q9UJ70|NAGK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	17-UNIMOD:188	ms_run[2]:scan=11380	73.458	2	1880.0867	1880.0867	R	I	245	262
PSM	HLMLPDFDLLEDIESK	591	sp|P13010|XRCC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:35,16-UNIMOD:188	ms_run[2]:scan=12447	81.655	2	1935.9595	1935.9595	R	I	82	98
PSM	HTGPGILSMANAGPNTNGSQFFICTAK	592	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:35,24-UNIMOD:4,27-UNIMOD:188	ms_run[2]:scan=8216	52.358	3	2812.3368	2812.3368	K	T	92	119
PSM	HTGPGILSMANAGPNTNGSQFFICTAK	593	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:35,24-UNIMOD:4	ms_run[2]:scan=8225	52.414	3	2806.3167	2806.3167	K	T	92	119
PSM	ICNAVSPDKDVDGFHVINVGR	594	sp|P13995-2|MTDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:4	ms_run[2]:scan=7064	45.128	4	2311.1379	2311.1379	R	M	42	63
PSM	IIHDFPQFYPLGIVQHD	595	sp|P35244|RFA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=11174	71.991	2	2038.0312	2038.0312	K	-	105	122
PSM	IPIFSAAGLPHNEIAAQICR	596	sp|P21281|VATB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	19-UNIMOD:4	ms_run[2]:scan=9709	62.136	3	2177.1415	2177.1415	K	Q	189	209
PSM	IRYESGDHVAVYPANDSALVNQLGK	597	sp|P16435|NCPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=7234	46.174	2	2715.3616	2715.3616	K	I	312	337
PSM	ISVAGVTSSNVGYLAHAIHQVTK	598	sp|P00505-2|AATM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10328	66.219	2	2351.2597	2351.2597	R	-	365	388
PSM	IVKEAHEPLAVADAK	599	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=3079	20.886	2	1601.918	1601.9180	K	L	79	94
PSM	IYKEIECSIAGAHEK	600	sp|Q6I9Y2|THOC7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:4	ms_run[2]:scan=4779	31.135	3	1746.8611	1746.8611	K	I	84	99
PSM	KEGGLGPLNIPLLADVTR	601	sp|P32119|PRDX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=11904	77.29	2	1862.0625	1862.0625	R	R	92	110
PSM	KPIDYTVLDDVGHGVK	602	sp|Q8IZP0-10|ABI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6919	44.239	3	1754.9203	1754.9203	R	H	139	155
PSM	KPTDGASSSNCVTDISHLVR	603	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	11-UNIMOD:4	ms_run[2]:scan=6075	39.041	3	2143.0328	2143.0328	R	K	698	718
PSM	KSDIYVCMISFAHNVAAQGK	604	sp|P50395-2|GDIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:188,7-UNIMOD:4,20-UNIMOD:188	ms_run[2]:scan=10421	66.825	3	2250.1328	2250.1328	R	Y	284	304
PSM	KVMSQEIQEQLHK	605	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=4093	26.965	2	1596.8294	1596.8294	K	Q	3254	3267
PSM	KYEDICPSTHNMDVPNIK	606	sp|Q9GZV4|IF5A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	6-UNIMOD:4	ms_run[2]:scan=5776	37.222	3	2159.998	2159.9980	K	R	68	86
PSM	LDLSHCSHLTDQSSNLLTAVGSSTR	607	sp|Q9Y2K7-4|KDM2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	6-UNIMOD:4,25-UNIMOD:267	ms_run[2]:scan=8176	52.108	2	2708.3063	2708.3063	R	Y	527	552
PSM	LGTGFSDEELEEHHQSLK	608	sp|P18858-3|DNLI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	18-UNIMOD:188	ms_run[2]:scan=5357	34.621	2	2060.9746	2060.9746	K	A	765	783
PSM	LLHEVQELTTEVEKIK	609	sp|Q13561|DCTN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9615	61.524	2	1908.0568	1908.0568	R	T	106	122
PSM	LLHVFACACPGCSTGGAR	610	sp|Q9BRP1|PDD2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:4,9-UNIMOD:4,12-UNIMOD:4,18-UNIMOD:267	ms_run[2]:scan=5884	37.867	3	1942.884	1942.8840	R	S	74	92
PSM	LLTQHENIKNEIDNYEEDYQK	611	sp|Q01082-3|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6960	44.477	2	2635.2402	2635.2402	K	M	1087	1108
PSM	LQMEAPHIIVGTPGR	612	sp|P60842-2|IF4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	15-UNIMOD:267	ms_run[2]:scan=7091	45.291	2	1627.8744	1627.8744	K	V	147	162
PSM	LSYLEEAVMHLDHSDPITR	613	sp|Q6P2E9-2|EDC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=11008	70.878	2	2225.0787	2225.0787	K	D	956	975
PSM	LTLYDIAHTPGVAADLSHIETK	614	sp|P40926-2|MDHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10518	67.481	3	2364.2325	2364.2325	R	A	53	75
PSM	LTLYDIAHTPGVAADLSHIETK	615	sp|P40926-2|MDHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	22-UNIMOD:188	ms_run[2]:scan=10521	67.499	2	2370.2527	2370.2527	R	A	53	75
PSM	LVSGWVKPIIIGR	616	sp|O75874|IDHC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8542	54.481	2	1436.8868	1436.8868	R	H	120	133
PSM	LYKEELEQTYHAK	617	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=3726	24.762	2	1662.8656	1662.8656	R	L	259	272
PSM	NFAADHFNQEILPVFLNANR	618	sp|Q6PI48|SYDM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	20-UNIMOD:267	ms_run[2]:scan=11420	73.744	2	2339.1686	2339.1686	R	N	389	409
PSM	NQVDSETHCHAER	619	sp|Q9NRW3|ABC3C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:4	ms_run[2]:scan=678	6.9465	2	1581.659	1581.6590	R	C	57	70
PSM	NYKSEEEFIHINNK	620	sp|Q15046|SYK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=4896	31.83	2	1763.8479	1763.8479	R	L	162	176
PSM	NYKSEEEFIHINNK	621	sp|Q15046|SYK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=4897	31.835	2	1775.8881	1775.8881	R	L	162	176
PSM	QELSHALYQHDAACR	622	sp|Q9UMS4|PRP19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=3225	21.751	2	1807.8299	1807.8299	R	V	101	116
PSM	QLEAIDQLHLEYAKR	623	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=7101	45.348	2	1825.9686	1825.9686	K	A	522	537
PSM	RISISTSGGSFR	624	sp|P13647|K2C5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:267,12-UNIMOD:267	ms_run[2]:scan=4544	29.721	2	1286.6846	1286.6846	K	N	73	85
PSM	RPSENLGQVLFGER	625	sp|Q99805|TM9S2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8191	52.205	2	1600.8322	1600.8322	K	I	91	105
PSM	SEHPGLSIGDTAKK	626	sp|P26583|HMGB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=2392	16.796	2	1438.7416	1438.7416	K	L	115	129
PSM	SGYHQSASEHGLVVIAPDTSPR	627	sp|P10768|ESTD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	22-UNIMOD:267	ms_run[2]:scan=5154	33.396	3	2317.1326	2317.1326	K	G	65	87
PSM	SHMMDVQGSTQDSAIKDFVLK	628	sp|P13667|PDIA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	16-UNIMOD:188,21-UNIMOD:188	ms_run[2]:scan=7898	50.317	3	2348.1543	2348.1543	R	Y	371	392
PSM	SIFQHIQSAQSQR	629	sp|Q9Y2W1|TR150_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:267	ms_run[2]:scan=4850	31.557	2	1538.7829	1538.7829	R	S	609	622
PSM	SPKPLLTGLMWAQQGTTPGTPK	630	sp|Q13724-2|MOGS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:188,22-UNIMOD:188	ms_run[2]:scan=9391	60.009	2	2320.2652	2320.2652	R	L	5	27
PSM	TATPQQAQEVHEKLR	631	sp|P60174|TPIS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=2457	17.184	2	1734.9013	1734.9013	K	G	213	228
PSM	TFVNITPAEVGVLVGKDR	632	sp|P07737|PROF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10280	65.899	2	1914.0575	1914.0575	K	S	39	57
PSM	THPSVVPGSIAFSLPQR	633	sp|P46459|NSF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	17-UNIMOD:267	ms_run[2]:scan=8100	51.606	2	1801.9714	1801.9714	K	K	51	68
PSM	TLVVHEKADDLGK	634	sp|P00441|SODC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=2716	18.733	2	1435.8074	1435.8074	R	G	117	130
PSM	TPHVLVLGSGVYR	635	sp|P27708|PYR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6561	42.024	2	1396.7827	1396.7827	R	I	932	945
PSM	TSLHIVDFLVQNSGNLDKQTGK	636	sp|O43150-2|ASAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	18-UNIMOD:188,22-UNIMOD:188	ms_run[2]:scan=10163	65.15	3	2425.3004	2425.3004	R	G	599	621
PSM	TTGIVMDSGDGVTHTVPIYEGYALPHAILR	637	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	6-UNIMOD:35	ms_run[2]:scan=9740	62.35	3	3198.6019	3198.6019	R	L	148	178
PSM	TYEEGLKHEANNPQLK	638	sp|P31948-2|STIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=3432	22.972	2	1869.9221	1869.9221	R	E	141	157
PSM	VIISAPSADAPMFVMGVNHEKYDNSLK	639	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9178	58.645	2	2932.4463	2932.4463	R	I	119	146
PSM	VINAAHSFYNGTTTLPISDEDRTPR	640	sp|P49915-2|GUAA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	22-UNIMOD:267,25-UNIMOD:267	ms_run[2]:scan=7053	45.061	3	2794.3789	2794.3789	K	K	197	222
PSM	VNVCEHCLVANHAK	641	sp|O95159|ZFPL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	4-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=2685	18.557	2	1649.7766	1649.7766	R	C	21	35
PSM	VSGHVITDIVEGKK	642	sp|P54886-2|P5CS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5363	34.66	2	1480.8249	1480.8249	K	V	333	347
PSM	VVVKAPDEETLIALLAHAK	643	sp|Q9Y3E5|PTH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	4-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=11103	71.534	2	2028.2022	2028.2022	K	M	116	135
PSM	QLEAIDQLHLEYAKR	644	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:28,14-UNIMOD:188,15-UNIMOD:267	ms_run[1]:scan=9353	59.771480000000004	3	1824.9750	1824.9700	K	A	522	537
PSM	NSPLNKAEVHESYK	645	sp|Q15067|ACOX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=2609	18.097235	2	1614.804140	1614.800185	K	H	638	652
PSM	ADFCIIHYAGKVDYK	646	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:4	ms_run[2]:scan=7187	45.883	2	1798.8712	1798.8712	K	A	566	581
PSM	AELRDDPIISTHLAK	647	sp|O00231|PSD11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5466	35.301	2	1677.905	1677.9050	R	L	311	326
PSM	AFQYVETHGEVCPANWTPDSPTIKPSPAASK	648	sp|P30048-2|PRDX3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:4	ms_run[2]:scan=7552	48.172	3	3384.6085	3384.6085	K	E	200	231
PSM	ALESPERPFLAILGGAK	649	sp|P00558-2|PGK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=10590	68.018	2	1767.9883	1767.9883	K	V	172	189
PSM	AMDDGVKELLTVGQEHWK	650	sp|Q9Y5X1|SNX9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	7-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=10238	65.629	2	2067.0498	2067.0498	K	R	408	426
PSM	CFSEENHEPLRTQCALAASK	651	sp|Q96QK1|VPS35_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=4490	29.392	2	2347.0685	2347.0685	K	L	640	660
PSM	CNILHADIKPDNILVNESK	652	sp|Q13523|PRP4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:4	ms_run[2]:scan=7412	47.312	2	2192.126	2192.1260	R	T	809	828
PSM	CYSCGEFGHIQKDCTK	653	sp|P62633-7|CNBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:4,4-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=3468	23.191	2	1988.8179	1988.8179	K	V	102	118
PSM	DKFNECGHVLYADIK	654	sp|P52272-2|HNRPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:188,6-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=5900	37.96	2	1819.8966	1819.8966	K	M	632	647
PSM	DLKPENVLLDAHMNAK	655	sp|P54646|AAPK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7223	46.106	3	1806.9298	1806.9298	R	I	139	155
PSM	DNGKHALIIYDDLSK	656	sp|P25705-2|ATPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=6641	42.521	2	1712.9136	1712.9136	R	Q	252	267
PSM	ELKGELYCLPCHDK	657	sp|P48059|LIMS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:188,8-UNIMOD:4,11-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=5077	32.927	2	1772.8628	1772.8628	R	M	174	188
PSM	FCKYEHDDIVSTVSVLSSGTQAVSGSK	658	sp|Q9BQA1|MEP50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:4	ms_run[2]:scan=8483	54.105	3	2900.3862	2900.3862	K	D	119	146
PSM	FIQENIFGICPHMTEDNKDLIQGK	659	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	10-UNIMOD:4,13-UNIMOD:35	ms_run[2]:scan=8507	54.261	3	2862.368	2862.3681	K	D	235	259
PSM	FIQENIFGICPHMTEDNKDLIQGK	660	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	10-UNIMOD:4	ms_run[2]:scan=9441	60.318	3	2846.3731	2846.3731	K	D	235	259
PSM	FKEANNFLWPFK	661	sp|P18124|RL7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=10667	68.553	2	1551.8277	1551.8277	R	L	201	213
PSM	GFETVSYLLEGGSMAHEDFCGHTGK	662	sp|O00625|PIR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	20-UNIMOD:4	ms_run[2]:scan=10350	66.365	2	2728.1898	2728.1898	R	M	60	85
PSM	GHASAPYFGKEEPSVAPSSTGK	663	sp|Q8N183|NDUF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	10-UNIMOD:188,22-UNIMOD:188	ms_run[2]:scan=4330	28.42	3	2215.0948	2215.0948	K	T	131	153
PSM	GHVSSHDEQQVEAGAVQLR	664	sp|Q92667-2|AKAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	19-UNIMOD:267	ms_run[2]:scan=4003	26.42	3	2055.9961	2055.9961	K	A	31	50
PSM	GLDVDSLVIEHIQVNKAPK	665	sp|P18621-2|RL17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	16-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=8862	56.633	3	2086.1825	2086.1825	K	M	68	87
PSM	GNDISSGTVLSDYVGSGPPKGTGLHR	666	sp|P30086|PEBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7205	45.993	3	2570.2725	2570.2725	K	Y	94	120
PSM	GVDEVTIVNILTNR	667	sp|P07355-2|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=11562	74.765	2	1541.8413	1541.8413	K	S	68	82
PSM	HDAATCFVDAGNAFKK	668	sp|P54920|SNAA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:4,15-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=5743	37.023	3	1762.85	1762.8500	K	A	79	95
PSM	HDADGQATLLNLLLR	669	sp|O43242-2|PSMD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	15-UNIMOD:267	ms_run[2]:scan=12071	78.599	2	1658.8979	1658.8979	R	N	104	119
PSM	HETLTSLNLEKK	670	sp|Q96A26|F162A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=3805	25.22	2	1411.7671	1411.7671	R	A	129	141
PSM	HIGSIDPTCNVADVVKDAYETAK	671	sp|Q15120|PDK3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	9-UNIMOD:4	ms_run[2]:scan=9608	61.477	3	2502.2061	2502.2061	K	M	183	206
PSM	HIYYITGETKDQVANSAFVER	672	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	10-UNIMOD:188,21-UNIMOD:267	ms_run[2]:scan=6456	41.358	2	2456.2307	2452.2425	K	L	490	511
PSM	HIYYITGETKDQVANSAFVER	673	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	10-UNIMOD:188,21-UNIMOD:267	ms_run[2]:scan=6688	42.816	2	2456.2307	2452.2425	K	L	490	511
PSM	HLGVCISVANNR	674	sp|O43390-4|HNRPR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	5-UNIMOD:4	ms_run[2]:scan=4645	30.337	2	1338.6827	1338.6827	K	L	135	147
PSM	HNSSGSILFLGR	675	sp|P30740-2|ILEU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6940	44.362	2	1286.6731	1286.6731	R	F	213	225
PSM	HSGNITFDEIVNIAR	676	sp|P30050-2|RL12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9530	60.951	2	1684.8533	1684.8533	K	Q	67	82
PSM	IHFPLATYAPVISAEK	677	sp|P68363-2|TBA1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	16-UNIMOD:188	ms_run[2]:scan=9248	59.091	2	1761.9761	1761.9761	R	A	149	165
PSM	ILEVNHVNVEGATHK	678	sp|Q96L92|SNX27_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=4216	27.719	2	1658.874	1658.8740	R	Q	101	116
PSM	IYKEIECSIAGAHEK	679	sp|Q6I9Y2|THOC7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:188,7-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=4780	31.141	3	1758.9013	1758.9013	K	I	84	99
PSM	KGDECELLGHSK	680	sp|P49411|EFTU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	5-UNIMOD:4	ms_run[2]:scan=1972	14.326	2	1371.6453	1371.6453	K	N	286	298
PSM	KIPNPDFFEDLEPFR	681	sp|P27824-3|CALX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=11608	75.078	2	1862.9203	1862.9203	R	M	293	308
PSM	KNIPEGSHQYELLK	682	sp|Q9H8S9-2|MOB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=4092	26.959	2	1654.8679	1654.8679	K	H	17	31
PSM	KPIDYTILDDIGHGVK	683	sp|Q9NYB9-3|ABI2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=8716	55.585	3	1794.9919	1794.9919	R	V	94	110
PSM	KYEDICPSTHNMDVPNIK	684	sp|Q9GZV4|IF5A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:188,6-UNIMOD:4,18-UNIMOD:188	ms_run[2]:scan=5771	37.191	3	2172.0382	2172.0382	K	R	68	86
PSM	LCLTLHNNEGSYLAHTQGK	685	sp|Q15428|SF3A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:4	ms_run[2]:scan=5996	38.565	3	2155.048	2155.0480	K	K	58	77
PSM	LEQSGCYHHCVDENIER	686	sp|Q969G9|NKD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=2988	20.339	3	2144.9004	2144.9004	R	R	239	256
PSM	LHIIEVGTPPTGNQPFPK	687	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7495	47.818	2	1944.0469	1944.0469	K	K	228	246
PSM	LIALLEVLSQKR	688	sp|O75369-5|FLNB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=11376	73.435	2	1381.8657	1381.8657	R	M	50	62
PSM	LKVPPAINQFTQALDR	689	sp|P62424|RL7A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=10282	65.916	3	1810.0101	1810.0101	R	Q	74	90
PSM	LNQSQREELGLIEQAYDNPHEALSR	690	sp|Q6P2Q9|PRP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:267,25-UNIMOD:267	ms_run[2]:scan=8906	56.909	4	2929.4433	2929.4433	R	I	856	881
PSM	LPGDKGLVLMSR	691	sp|P27824-3|CALX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6355	40.763	2	1284.7224	1284.7224	K	A	6	18
PSM	LVLEHSKDDDNLDSLLDSVVGLK	692	sp|Q69YN4-3|VIR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	7-UNIMOD:188,23-UNIMOD:188	ms_run[2]:scan=12160	79.313	3	2535.3471	2535.3471	K	Q	1459	1482
PSM	LYKEELEQTYHAK	693	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=3728	24.778	2	1650.8253	1650.8253	R	L	259	272
PSM	MDSTANEVEAVKVHSFPTLK	694	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:35,12-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=6991	44.673	2	2230.1342	2230.1342	K	F	425	445
PSM	MGLVDQLVEPLGPGLKPPEER	695	sp|P40939|ECHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:35	ms_run[2]:scan=9872	63.236	3	2289.2039	2289.2039	K	T	215	236
PSM	NHAVVCQGCHNAIDPEVQR	696	sp|Q9UGI8-2|TES_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:4,9-UNIMOD:4,19-UNIMOD:267	ms_run[2]:scan=3151	21.31	3	2213.0094	2213.0094	K	V	347	366
PSM	NQQITHANNTVSNFKR	697	sp|Q92598-2|HS105_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=2645	18.314	3	1870.9398	1870.9398	K	F	54	70
PSM	NTEIGFLQDALSKPHGTVK	698	sp|Q6PI48|SYDM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=8138	51.86	2	2066.1199	2066.1199	R	A	350	369
PSM	NVKESAAHDYTLR	699	sp|Q06124-3|PTN11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=2338	16.475	2	1502.7478	1502.7478	R	E	387	400
PSM	NVNVFKFIIPQIVK	700	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=12210	79.703	2	1657.9919	1657.9919	R	Y	114	128
PSM	PSKGPLQSVQVFGR	701	sp|P62249|RS16_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6726	43.052	2	1498.8256	1498.8256	M	K	2	16
PSM	QELSHALYQHDAACR	702	sp|Q9UMS4|PRP19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:4	ms_run[2]:scan=3223	21.74	2	1797.8217	1797.8217	R	V	101	116
PSM	QIATLHAQVADMKK	703	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=3721	24.736	2	1552.8395	1552.8395	K	K	1358	1372
PSM	RLPGAIDVIGQTITISR	704	sp|Q6UN15-4|FIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9804	62.775	3	1809.0472	1809.0472	R	V	294	311
PSM	SFLEEVLASGLHSR	705	sp|Q9NRW7|VPS45_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=11495	74.271	2	1543.7995	1543.7995	K	S	542	556
PSM	SGQKPVLDVHAELDR	706	sp|Q9Y6G9|DC1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=4936	32.057	2	1662.8689	1662.8689	K	I	487	502
PSM	SKCEELSGLHGQLQEAR	707	sp|Q9P2E9-3|RRBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:4	ms_run[2]:scan=4304	28.256	3	1940.9374	1940.9374	R	A	498	515
PSM	SKLTFSCLGGSDNFK	708	sp|Q15185-2|TEBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:188,7-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=6846	43.792	2	1671.8329	1671.8329	K	H	34	49
PSM	SLHQFLLEPITCHAWNR	709	sp|Q92747|ARC1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:1,12-UNIMOD:4	ms_run[2]:scan=11154	71.863	3	2163.0684	2163.0684	M	D	2	19
PSM	SLKAYGELPEHAK	710	sp|P47813|IF1AX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=3413	22.863	2	1453.7968	1453.7968	R	I	102	115
PSM	SPSGSQRPSVSDDTEHLVNGR	711	sp|P16144-2|ITB4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=4051	26.704	3	2224.0469	2224.0469	R	M	1356	1377
PSM	STDHPKYSDMIVAAIQAEK	712	sp|P07305-2|H10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=8576	54.697	3	2115.0709	2115.0709	K	N	5	24
PSM	TKGVDEVTIVNILTNR	713	sp|P07355-2|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:188,16-UNIMOD:267	ms_run[2]:scan=10261	65.778	2	1787.0124	1783.0242	K	S	66	82
PSM	TLEQHDNIVTHYK	714	sp|O60763|USO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=3125	21.158	2	1596.7896	1596.7896	K	N	644	657
PSM	TLHLQTGNLLNWGR	715	sp|P48507-2|GSH0_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:267	ms_run[2]:scan=9334	59.645	2	1631.8771	1631.8771	R	L	17	31
PSM	TTGIVMDSGDGVTHTVPIYEGYALPHAILR	716	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	30-UNIMOD:267	ms_run[2]:scan=10359	66.423	3	3192.6153	3192.6153	R	L	148	178
PSM	TTGIVMDSGDGVTHTVPIYEGYALPHAILR	717	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	30-UNIMOD:267	ms_run[2]:scan=10207	65.43	4	3192.6153	3192.6153	R	L	148	178
PSM	VADPDHDHTGFLTEYVATR	718	sp|P28482|MK01_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6927	44.287	3	2142.997	2142.9970	R	W	173	192
PSM	VFNTTPDDLDLHVIYDVSHNIAK	719	sp|Q9Y3I0|RTCB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=11190	72.104	2	2625.3075	2625.3075	K	V	335	358
PSM	VGERQPLLGPPESMR	720	sp|Q99613-2|EIF3C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5671	36.576	2	1664.8668	1664.8668	R	E	710	725
PSM	VNVCEHCLVANHAK	721	sp|O95159|ZFPL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:4,7-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=2681	18.535	2	1655.7968	1655.7968	R	C	21	35
PSM	YEDICPSTHNMDVPNIKR	722	sp|Q9GZV4|IF5A2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	5-UNIMOD:4	ms_run[2]:scan=5659	36.501	2	2188.0041	2188.0041	K	N	69	87
PSM	YGGPYHIGGSPFK	723	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:188	ms_run[2]:scan=6012	38.663	2	1384.6871	1384.6871	K	A	2493	2506
PSM	YGGPYHIGGSPFK	724	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6015	38.68	2	1378.667	1378.6670	K	A	2493	2506
PSM	ECEHCDCLQGFQLTHSLGGGTGSGMGTLLISK	725	sp|Q9BUF5|TBB6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	2-UNIMOD:4,5-UNIMOD:4,7-UNIMOD:4,32-UNIMOD:188	ms_run[1]:scan=9959	63.809084999999996	3	3455.562302	3455.567360	K	I	123	155
PSM	DVACGANHTLVLDSQKR	726	sp|Q9P258|RCC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	4-UNIMOD:4	ms_run[1]:scan=3874	25.64935	2	1883.934155	1882.931945	R	V	334	351
PSM	CPSIAAAIAAVNALHGR	727	sp|Q14498|RBM39_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:385,1-UNIMOD:4,17-UNIMOD:267	ms_run[1]:scan=12835	85.16353833333334	2	1683.8700	1683.8749	K	W	478	495
PSM	QLVARPDVVEMHDVTAQDPK	728	sp|Q13435|SF3B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:28	ms_run[1]:scan=7211	46.032779999999995	3	2230.1054	2230.1047	K	L	467	487
PSM	HVGPGVLSMANAGPNTNGSQFFICTIK	729	sp|P30405|PPIF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	24-UNIMOD:4	ms_run[1]:scan=10361	66.43431	3	2817.361163	2816.373805	K	T	134	161
PSM	QIVKDVLEGYNGTIFAYGQTSSGK	730	sp|O60282|KIF5C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=8266	52.67112333333333	3	2574.334997	2574.296583	K	T	69	93
PSM	TQHLSVETSYLQHESGR	731	sp|Q9Y276|BCS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=4748	30.941936666666663	3	1972.957188	1970.944617	R	I	74	91
PSM	HPHDIIDDINSGAVECPAS	732	sp|P30050|RL12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	16-UNIMOD:4	ms_run[1]:scan=7168	45.76531166666666	2	2045.905286	2045.911269	R	-	147	166
PSM	AFTHTAQYDEAISDYFRK	733	sp|P31939-2|PUR9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	17-UNIMOD:267,18-UNIMOD:188	ms_run[2]:scan=7818	49.833	2	2178.0353	2174.0471	K	Q	177	195
PSM	AHPLGDEGGTASKK	734	sp|Q9H7E9|CH033_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=728	7.2347	2	1378.7244	1378.7244	R	Q	57	71
PSM	ASIHEAWTDGKEAMLR	735	sp|P12814-2|ACTN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6261	40.173	2	1813.8781	1813.8781	K	Q	403	419
PSM	ATSHICEVEKEIALLK	736	sp|Q9UDT6-2|CLIP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	6-UNIMOD:4	ms_run[2]:scan=8368	53.347	2	1839.9764	1839.9764	K	A	385	401
PSM	DGVVEITGKHEER	737	sp|P04792|HSPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=2384	16.748	2	1467.7318	1467.7318	K	Q	115	128
PSM	DKADFCIIHYAGK	738	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	6-UNIMOD:4	ms_run[2]:scan=6069	39.002	2	1536.7395	1536.7395	K	V	564	577
PSM	DNHLLGTFDLTGIPPAPR	739	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	18-UNIMOD:267	ms_run[2]:scan=10441	66.956	2	1943.014	1943.0140	K	G	475	493
PSM	EDDRVAIHEAMEQQTISIAK	740	sp|P33992|MCM5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6714	42.978	2	2283.1165	2283.1165	R	A	452	472
PSM	EENVKADVFHAYLSLLK	741	sp|Q86VP6-3|CAND1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11313	72.973	2	1975.0415	1975.0415	R	Q	230	247
PSM	ELQELVQYPVEHPDKFLK	742	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	15-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=8512	54.291	2	2223.1978	2223.1978	R	F	488	506
PSM	ELYIQHAKEDETR	743	sp|Q00059-2|TFAM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=2694	18.609	2	1630.7951	1630.7951	K	Y	166	179
PSM	ERPISLGIFPLPAGDGLLTPDAQK	744	sp|O60271-5|JIP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11993	77.999	3	2504.3639	2504.3639	K	G	199	223
PSM	FDLSQNHPLGMAIFLK	745	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11144	71.799	2	1829.9498	1829.9498	K	N	1772	1788
PSM	FGDRFPAMSDAYDR	746	sp|P00491|PNPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	4-UNIMOD:267,14-UNIMOD:267	ms_run[2]:scan=6730	43.077	3	1666.7313	1666.7313	R	T	155	169
PSM	FITHAPPGEFNEVFNDVR	747	sp|P52907|CAZA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8953	57.205	3	2088.0065	2088.0065	K	L	20	38
PSM	GFAFVTFDDHDSVDKIVIQK	748	sp|P09651-3|ROA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9771	62.564	3	2280.1426	2280.1426	R	Y	147	167
PSM	GGSAAATSNPHHDNVR	749	sp|Q9GZY8-5|MFF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=552	6.25	2	1589.7295	1589.7295	R	Y	152	168
PSM	GLKYQEGGVESAFHK	750	sp|P40121-2|CAPG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	3-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=4589	30	2	1660.8612	1660.8612	R	T	113	128
PSM	GLTLAPGLSPARPLFGSDFEK	751	sp|Q8IU81|I2BP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10434	66.909	2	2172.1579	2172.1579	R	E	178	199
PSM	GNFGGSFAGSFGGAGGHAPGVAR	752	sp|P52272-2|HNRPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	23-UNIMOD:267	ms_run[2]:scan=6908	44.174	3	2043.9539	2043.9539	R	K	589	612
PSM	GNFGGSFAGSFGGAGGHAPGVAR	753	sp|P52272-2|HNRPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6917	44.23	3	2033.9456	2033.9456	R	K	589	612
PSM	GPHPSQGPIPFQQQK	754	sp|Q9C0J8|WDR33_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	15-UNIMOD:188	ms_run[2]:scan=3987	26.323	2	1650.8574	1650.8574	R	T	892	907
PSM	GQHEPSKPPPAGETVTGGFGAK	755	sp|Q9H6F5|CCD86_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=3478	23.251	3	2148.06	2148.0600	R	K	191	213
PSM	GVDEVTIVNILTNR	756	sp|P07355-2|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	14-UNIMOD:267	ms_run[2]:scan=11577	74.865	3	1551.8496	1551.8496	K	S	68	82
PSM	GVQLQTHPNVDKK	757	sp|P48444|COPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=1683	12.637	2	1474.8295	1474.8295	K	L	324	337
PSM	HADIVTTTTHK	758	sp|P34897-3|GLYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=1043	8.9869	2	1222.6306	1222.6306	K	T	249	260
PSM	HADQYKEQMEK	759	sp|P35580|MYH10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=903	8.2009	2	1405.6296	1405.6296	R	A	1864	1875
PSM	HASPILPITEFSDIPR	760	sp|P42167|LAP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10040	64.337	3	1791.9519	1791.9519	K	R	304	320
PSM	HESAEIFVVCQGFLAPDKVDSK	761	sp|Q8IY81|SPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	10-UNIMOD:4,18-UNIMOD:188,22-UNIMOD:188	ms_run[2]:scan=9063	57.917	3	2487.2507	2487.2507	R	F	188	210
PSM	HESGASIKIDEPLEGSEDR	762	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=4939	32.079	3	2067.9709	2067.9709	R	I	391	410
PSM	HFSVEGQLEFR	763	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6855	43.846	2	1347.6571	1347.6571	K	A	328	339
PSM	HLIPMNPNDDSLFK	764	sp|Q14651|PLSI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	14-UNIMOD:188	ms_run[2]:scan=8044	51.235	2	1645.823	1645.8230	K	S	144	158
PSM	HLMLPDFDLLEDIESK	765	sp|P13010|XRCC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	16-UNIMOD:188	ms_run[2]:scan=12780	84.629	2	1919.9646	1919.9646	R	I	82	98
PSM	HQEGEIFDTEKEK	766	sp|Q02878|RL6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=2707	18.682	3	1600.7772	1600.7772	R	Y	227	240
PSM	HQGVMVGMGQKDSYVGDEAQSK	767	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	8-UNIMOD:35	ms_run[2]:scan=3111	21.079	3	2366.0631	2366.0631	R	R	40	62
PSM	IDQVNQLLELDHQKR	768	sp|P61201|CSN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6921	44.249	2	1847.9854	1847.9854	R	G	402	417
PSM	INLWHLEITDR	769	sp|P63151|2ABA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9413	60.137	2	1408.7463	1408.7463	R	S	200	211
PSM	INLWHLEITDR	770	sp|P63151|2ABA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:267	ms_run[2]:scan=9417	60.164	2	1418.7546	1418.7546	R	S	200	211
PSM	IPKEQGVLSFWR	771	sp|P12236|ADT3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8761	55.906	2	1458.7983	1458.7983	R	G	61	73
PSM	IRAQTEGINISEEALNHLGEIGTK	772	sp|Q9Y265|RUVB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9238	59.026	3	2592.3507	2592.3507	K	T	377	401
PSM	ISCAGPQTYKEHLEGQK	773	sp|Q96KR1|ZFR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	3-UNIMOD:4	ms_run[2]:scan=3344	22.467	2	1944.9364	1944.9364	K	H	338	355
PSM	KGDECELLGHSK	774	sp|P49411|EFTU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:188,5-UNIMOD:4,12-UNIMOD:188	ms_run[2]:scan=1980	14.372	2	1383.6855	1383.6855	K	N	286	298
PSM	KLDAQVQELHAK	775	sp|P35580|MYH10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=2811	19.283	2	1378.7569	1378.7569	K	V	1256	1268
PSM	KLFIGGLSFETTDESLR	776	sp|P09651-3|ROA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9924	63.581	3	1911.9942	1911.9942	R	S	15	32
PSM	KPGGFDISLFYR	777	sp|P12956|XRCC6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9553	61.116	2	1398.7296	1398.7296	K	D	207	219
PSM	KVVENEIYSESHR	778	sp|Q96I51-2|RCC1L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=2635	18.256	3	1588.7845	1588.7845	R	V	209	222
PSM	LGETYKDHENIVIAK	779	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	6-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=4377	28.707	2	1740.9449	1740.9449	K	M	410	425
PSM	LIDVNHYAKDEVAAR	780	sp|Q13813-2|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5037	32.685	3	1712.8846	1712.8846	K	M	638	653
PSM	LLEFNQGKLPFAAAQIGNSFR	781	sp|P41250|GARS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11185	72.069	3	2320.2328	2320.2328	R	N	311	332
PSM	LMNSKGEYQGVFHCAVETAK	782	sp|Q9UBX3|DIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	14-UNIMOD:4	ms_run[2]:scan=6085	39.098	3	2268.0667	2268.0667	R	L	227	247
PSM	LTWHAYPEDAENKEK	783	sp|P45973|CBX5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=4464	29.231	2	1829.8584	1829.8584	R	E	172	187
PSM	LYGPTNFSPIINHVAR	784	sp|O75131|CPNE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	16-UNIMOD:267	ms_run[2]:scan=8536	54.44	2	1807.9609	1807.9609	K	F	391	407
PSM	NDPYHPDHFNCANCGK	785	sp|P48059|LIMS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:4,14-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=2648	18.332	2	1950.7833	1950.7833	K	E	151	167
PSM	NLEAQHKELEEK	786	sp|Q16181-2|SEPT7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=1375	10.878	2	1466.7365	1466.7365	K	R	388	400
PSM	NNRQPYAVSELAGHQTSAESWGTGR	787	sp|P36578|RL4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6165	39.588	4	2715.275	2715.2750	K	A	47	72
PSM	NQVDSETHCHAER	788	sp|Q9NRW3|ABC3C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	9-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=673	6.9196	2	1591.6673	1591.6673	R	C	57	70
PSM	PPSAFFLFCSEYRPK	789	sp|P09429|HMGB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	9-UNIMOD:4	ms_run[2]:scan=10455	67.052	3	1844.892	1844.8920	R	I	98	113
PSM	QLLHNFPPDQLTSSGAPFWSGPK	790	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10644	68.399	3	2523.2547	2523.2547	R	R	684	707
PSM	QLPAQPPEHAVDGEGFKNTLETSSLNFK	791	sp|Q14151|SAFB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8321	53.03	3	3053.5094	3053.5094	R	V	172	200
PSM	QQREDITQSAQHALR	792	sp|Q12906-5|ILF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	3-UNIMOD:267,15-UNIMOD:267	ms_run[2]:scan=3520	23.505	3	1799.9141	1799.9141	R	L	309	324
PSM	RLPGAIDVIGQTITISR	793	sp|Q6UN15-4|FIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:267,17-UNIMOD:267	ms_run[2]:scan=9817	62.862	3	1829.0638	1829.0638	R	V	294	311
PSM	RNEQNGAAAHVIAEDVK	794	sp|P24928-2|RPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=3273	22.044	2	1820.9129	1820.9129	R	L	292	309
PSM	SGEVLVNVKEHSR	795	sp|Q13347|EIF3I_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=2517	17.538	2	1452.7685	1452.7685	K	Q	177	190
PSM	SIFKPFIFVDDVK	796	sp|Q12765-3|SCRN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	4-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=10912	70.212	2	1565.8896	1565.8896	R	L	235	248
PSM	SIFQHIQSAQSQR	797	sp|Q9Y2W1|TR150_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=4845	31.527	2	1528.7746	1528.7746	R	S	609	622
PSM	SKYIHPDDELVLEDELQR	798	sp|P49005|DPOD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7423	47.38	3	2198.0855	2198.0855	R	I	124	142
PSM	SLCIPFKPLCELQPGAK	799	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	3-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=9936	63.658	2	1957.0165	1957.0165	K	C	1478	1495
PSM	SLSNTKPTVNEHDLLK	800	sp|O75351|VPS4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	6-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=4664	30.449	2	1806.9878	1806.9878	R	L	417	433
PSM	SPSGSQRPSVSDDTEHLVNGR	801	sp|P16144-2|ITB4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=4045	26.668	2	2224.0469	2224.0469	R	M	1356	1377
PSM	TELFIAAEGIHTGQFVYCGKK	802	sp|P62917|RL8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	18-UNIMOD:4	ms_run[2]:scan=8711	55.551	2	2368.1886	2368.1886	R	A	73	94
PSM	TGVHHYSGNNIELGTACGK	803	sp|P62888|RL30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	17-UNIMOD:4,19-UNIMOD:188	ms_run[2]:scan=3229	21.775	3	2019.9528	2019.9528	K	Y	69	88
PSM	THTVGSVAKVEQVK	804	sp|P09327|VILI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=2073	14.897	2	1481.8202	1481.8202	K	F	361	375
PSM	TIADHCPDSACKQDLLAYLQR	805	sp|P35221-2|CTNA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	6-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=7991	50.906	3	2474.1682	2474.1682	R	I	762	783
PSM	TIDDRIVHELNTTVPTASFAGK	806	sp|Q4VC31|CCD58_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8812	56.269	2	2384.2336	2384.2336	R	I	25	47
PSM	TTGIVMDSGDGVTHTVPIYEGYALPHAILR	807	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	30-UNIMOD:267	ms_run[2]:scan=10210	65.446	2	3192.6153	3192.6153	R	L	148	178
PSM	VADPDHDHTGFLTEYVATR	808	sp|P28482|MK01_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	19-UNIMOD:267	ms_run[2]:scan=6926	44.282	3	2153.0053	2153.0053	R	W	173	192
PSM	VAMSHFEPNEYIHYDLLEK	809	sp|Q99798|ACON_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	19-UNIMOD:188	ms_run[2]:scan=9099	58.148	3	2340.1192	2340.1192	K	N	32	51
PSM	VAVNDAHLLQYNHR	810	sp|P17931|LEG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=4699	30.655	2	1648.8434	1648.8434	K	V	211	225
PSM	VHLVGIDIFTGK	811	sp|Q9GZV4|IF5A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9408	60.111	2	1297.7394	1297.7394	K	K	56	68
PSM	VIHDNFGIVEGLMTTVHAITATQK	812	sp|P04406|G3P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:35	ms_run[2]:scan=11766	76.267	3	2610.3476	2610.3476	K	T	163	187
PSM	VINDKHDDVMAK	813	sp|Q99460-2|PSMD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	5-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=1319	10.559	2	1395.7219	1395.7219	K	F	716	728
PSM	VKEDPDGEHAR	814	sp|P52272-2|HNRPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=504	5.9879	2	1251.5844	1251.5844	K	R	144	155
PSM	VLRPPGGGSNFSLGFDEPTEQPVR	815	sp|Q9UK76|JUPI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	3-UNIMOD:267,24-UNIMOD:267	ms_run[2]:scan=8449	53.883	3	2575.2934	2575.2934	R	K	20	44
PSM	VPEGQHLFENLLR	816	sp|Q6ZMZ3-2|SYNE3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:267	ms_run[2]:scan=9056	57.871	2	1560.8288	1560.8288	R	L	847	860
PSM	VRGLPWSCSADEVQR	817	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	2-UNIMOD:267,8-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=6126	39.345	3	1778.8637	1778.8637	K	F	15	30
PSM	VTSAHKGPDETLR	818	sp|P22234|PUR6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=1034	8.9366	2	1409.7263	1409.7263	R	I	299	312
PSM	VVVKAPDEETLIALLAHAK	819	sp|Q9Y3E5|PTH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11104	71.54	2	2016.1619	2016.1619	K	M	116	135
PSM	YDVGGGERFDSLTDLVEHYK	820	sp|Q06124-3|PTN11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10154	65.092	3	2299.0757	2299.0757	K	K	179	199
PSM	YKVEYPIMYSTDPENGHIFNCIQR	821	sp|O14880|MGST3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	21-UNIMOD:4	ms_run[2]:scan=9037	57.741	3	2973.3789	2973.3789	K	A	36	60
PSM	SGPFGQIFRPDNFVFGQSGAGNNWAK	822	sp|Q13885|TBB2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=11765	76.26105	3	2798.312121	2797.336097	R	G	78	104
PSM	TTGIVMDSGDGVTHTVPIYEGYALPHAILR	823	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	6-UNIMOD:35,30-UNIMOD:267	ms_run[1]:scan=9705	62.113009999999996	4	3208.611585	3208.610219	R	L	148	178
PSM	MGAGLGHGMDR	824	sp|P52272|HNRPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	1-UNIMOD:35,11-UNIMOD:267	ms_run[1]:scan=1502	11.589881666666667	2	1126.491065	1126.488717	R	V	419	430
PSM	YASICQQNGIVPIVEPEILPDGDHDLKR	825	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	5-UNIMOD:4,27-UNIMOD:188,28-UNIMOD:267	ms_run[1]:scan=9416	60.157615	3	3191.626880	3191.625597	R	C	174	202
PSM	YASICQQNGIVPIVEPEILPDGDHDLKR	826	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	5-UNIMOD:4	ms_run[1]:scan=9696	62.055791666666664	3	3176.581882	3175.597199	R	C	174	202
PSM	TSSAQVEGGVHSLHSYEK	827	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=3651	24.315841666666667	2	1915.922703	1914.907169	R	R	494	512
PSM	ALVDHENVISCPHLGASTK	828	sp|O43175|SERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	11-UNIMOD:4,19-UNIMOD:188	ms_run[1]:scan=5437	35.12563	3	2053.046472	2053.035803	R	E	271	290
PSM	HVGPGVLSMANAGPNTNGSQFFICTIK	829	sp|P30405|PPIF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	9-UNIMOD:35,24-UNIMOD:4	ms_run[1]:scan=9287	59.34150166666667	3	2833.351933	2832.368720	K	T	134	161
PSM	QHDQLEAQKLEYHQVIQQMEQK	830	sp|P80303|NUCB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:28,9-UNIMOD:188,22-UNIMOD:188	ms_run[1]:scan=7771	49.53895	3	2745.3619	2745.3578	R	K	378	400
PSM	CYSCGEFGHIQKDCTK	831	sp|P62633|CNBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:385,1-UNIMOD:4,4-UNIMOD:4,14-UNIMOD:4	ms_run[1]:scan=5617	36.237165000000005	2	1971.7916	1971.7908	K	V	119	135
PSM	CLHMFLQEEAIDR	832	sp|Q9UMY4|SNX12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=11172	71.97959833333333	2	1643.7375	1643.7431	R	N	141	154
PSM	VRPDYTAQNLDHGK	833	sp|P82930|RT34_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	2-UNIMOD:267,14-UNIMOD:188	ms_run[1]:scan=2456	17.177858333333333	2	1629.820608	1628.824166	R	A	100	114
PSM	MVSGFIPLKPTVK	834	sp|P01023|A2MG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	1-UNIMOD:35	ms_run[1]:scan=6529	41.81998	2	1431.815792	1431.815959	K	M	1385	1398
PSM	CFVEHILCTKPLPCR	835	sp|Q99567|NUP88_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:385,1-UNIMOD:4,8-UNIMOD:4,10-UNIMOD:188,14-UNIMOD:4,15-UNIMOD:267	ms_run[1]:scan=9990	64.009005	2	1927.9479	1927.9436	K	Q	447	462
PSM	KQFLPVAFPVGNAFSYYQSNR	836	sp|Q9HD20|AT131_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=11440	73.87561333333333	3	2433.221662	2432.227716	K	G	187	208
PSM	AHCVTLVQLSISCDHLIDKDIGSK	837	sp|Q99829|CPNE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:1,3-UNIMOD:4,13-UNIMOD:4,19-UNIMOD:188,24-UNIMOD:188	ms_run[2]:scan=9962	63.827	3	2762.4134	2762.4134	M	S	2	26
PSM	AIETLSGKVELHGK	838	sp|Q9Y6M1-1|IF2B2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	8-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=4317	28.336	2	1492.8652	1492.8652	R	I	54	68
PSM	ANELPQPPVPEPANAGKR	839	sp|P78347-2|GTF2I_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5297	34.253	2	1883.9854	1883.9854	K	K	286	304
PSM	AQSLLSTDREASIDILHSIVK	840	sp|O00231|PSD11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10810	69.523	3	2295.2434	2295.2434	R	R	12	33
PSM	AVIHYRDDETMYVESK	841	sp|O15144|ARPC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:35	ms_run[2]:scan=4065	26.791	2	1970.9044	1970.9044	R	K	142	158
PSM	CPSIAAAIAAVNALHGR	842	sp|Q14498-3|RBM39_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:4	ms_run[2]:scan=10620	68.242	3	1690.8937	1690.8937	K	W	456	473
PSM	DDPSKPVHLTAFLGYK	843	sp|P39023|RL3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	5-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=7821	49.851	2	1798.9656	1798.9656	K	A	35	51
PSM	DGNVLLHEMQIQHPTASLIAK	844	sp|P40227|TCPZ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	9-UNIMOD:35	ms_run[2]:scan=6887	44.038	2	2330.2053	2330.2053	K	V	59	80
PSM	DSFDDRGPSLNPVLDYDHGSR	845	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7441	47.486	2	2361.0622	2361.0622	R	S	187	208
PSM	EGDIIPPLTGATPPLIGHLK	846	sp|Q12888|TP53B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10445	66.985	2	2038.1463	2038.1463	K	L	911	931
PSM	FAPPLVIKEDELR	847	sp|P04181-2|OAT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7873	50.158	2	1525.8504	1525.8504	R	E	276	289
PSM	FGMTPSKGVLFYGPPGCGK	848	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	17-UNIMOD:4	ms_run[2]:scan=8094	51.567	2	1998.9696	1998.9696	K	T	506	525
PSM	FHDNFGFDDLVR	849	sp|O00165-4|HAX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8927	57.041	2	1480.6735	1480.6735	R	D	75	87
PSM	FIQENIFGICPHMTEDNKDLIQGK	850	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	10-UNIMOD:4,18-UNIMOD:188,24-UNIMOD:188	ms_run[2]:scan=9454	60.403	2	2858.4134	2858.4134	K	D	235	259
PSM	FTDLLQLVEFHQLNR	851	sp|Q14451-4|GRB7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=12106	78.895	3	1871.9894	1871.9894	R	G	468	483
PSM	GFLGCFPDIIGTHK	852	sp|Q9Y5X1|SNX9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	5-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=10541	67.65	2	1566.796	1566.7960	K	G	498	512
PSM	GFLWDEGFHQLVVQR	853	sp|Q13724-2|MOGS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	15-UNIMOD:267	ms_run[2]:scan=10852	69.817	2	1839.9296	1839.9296	R	W	341	356
PSM	GGSGSHNWGTVKDELTESPK	854	sp|Q8NC51-2|PAIRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5218	33.78	3	2084.9763	2084.9763	R	Y	211	231
PSM	GHYTEGAELVDSVLDVVR	855	sp|Q13509|TBB3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	18-UNIMOD:267	ms_run[2]:scan=12003	78.069	2	1967.9828	1967.9828	K	K	104	122
PSM	GSNTTSHLHQAVAK	856	sp|P22695|QCR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	14-UNIMOD:188	ms_run[2]:scan=911	8.2483	2	1455.7526	1455.7526	R	A	302	316
PSM	GVDEVTIVNILTNR	857	sp|P07355-2|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	14-UNIMOD:267	ms_run[2]:scan=11549	74.681	2	1551.8496	1551.8496	K	S	68	82
PSM	GYLNKDTHDQLSEPSEVR	858	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	5-UNIMOD:188,18-UNIMOD:267	ms_run[2]:scan=4292	28.182	2	2103.0204	2099.0322	R	S	3964	3982
PSM	HADIVTTTTHK	859	sp|P34897-3|GLYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:188	ms_run[2]:scan=1044	8.9909	2	1228.6507	1228.6507	K	T	249	260
PSM	HDFSTVLTVFPILR	860	sp|Q9UPT5-2|EXOC7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=12378	81.042	2	1643.9035	1643.9035	R	H	342	356
PSM	HGAGAEISTVHPEQYAK	861	sp|Q8TBX8-2|PI42C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	17-UNIMOD:188	ms_run[2]:scan=3640	24.249	2	1799.8898	1799.8898	K	R	346	363
PSM	HIMSEPEEITTMSGQKLPLK	862	sp|Q9UKF6|CPSF3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	16-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=7214	46.05	3	2280.1896	2280.1896	K	M	366	386
PSM	HIVVSCAAGVTISSIEKK	863	sp|P32322-3|P5CR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	6-UNIMOD:4	ms_run[2]:scan=6283	40.312	3	1898.0295	1898.0295	R	L	117	135
PSM	HLCTNTWVTSTSIPIDTDEERPVMLK	864	sp|Q14571|ITPR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:4	ms_run[2]:scan=9031	57.699	3	3042.4791	3042.4791	R	I	391	417
PSM	HLIEQDFPGMR	865	sp|Q9H4M9|EHD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6307	40.464	2	1341.65	1341.6500	R	I	77	88
PSM	HLMLPDFDLLEDIESK	866	sp|P13010|XRCC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:35	ms_run[2]:scan=12455	81.714	3	1929.9394	1929.9394	R	I	82	98
PSM	HQVLNDRDEEVELCSSVECK	867	sp|O75153|CLU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	7-UNIMOD:267,14-UNIMOD:4,19-UNIMOD:4,20-UNIMOD:188	ms_run[2]:scan=5467	35.307	3	2461.1184	2457.1303	R	G	533	553
PSM	HSQAVEELAEQLEQTKR	868	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	16-UNIMOD:188,17-UNIMOD:267	ms_run[2]:scan=7273	46.42	2	2011.0305	2007.0424	K	V	1194	1211
PSM	HVAEVLEYTKDEQLESLFQR	869	sp|P05198|IF2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	10-UNIMOD:188,20-UNIMOD:267	ms_run[2]:scan=9668	61.87	2	2449.246	2445.2579	R	T	114	134
PSM	IAQPGDHVSVTGIFLPILR	870	sp|P33993-2|MCM7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11923	77.425	2	2032.1469	2032.1469	R	T	264	283
PSM	IGGGDTTEHIQTHFESK	871	sp|O14497-3|ARI1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	17-UNIMOD:188	ms_run[2]:scan=3873	25.643	2	1861.8902	1861.8902	R	T	1463	1480
PSM	IPGMLIIDTPGHESFSNLR	872	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	19-UNIMOD:267	ms_run[2]:scan=9783	62.639	3	2106.0807	2106.0807	R	N	695	714
PSM	IPNIYAIGDVVAGPMLAHK	873	sp|P09622-2|DLDH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11897	77.241	3	1978.071	1978.0710	K	A	248	267
PSM	IQVHYYEDGNVQLVSHK	874	sp|P47755|CAZA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5645	36.413	2	2028.0065	2028.0065	K	D	194	211
PSM	ISVYYNEASSHKYVPR	875	sp|Q13509|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=4745	30.925	3	1911.9479	1911.9479	R	A	47	63
PSM	KDHADVSNQLYACYAIGK	876	sp|P21281|VATB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:4	ms_run[2]:scan=5957	38.316	3	2051.9735	2051.9735	R	D	413	431
PSM	KIWCFGPDGTGPNILTDITK	877	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:188,4-UNIMOD:4,20-UNIMOD:188	ms_run[2]:scan=11280	72.744	3	2244.1651	2244.1651	R	G	648	668
PSM	KLAVNMVPFPR	878	sp|Q13509|TBB3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7499	47.842	2	1270.722	1270.7220	R	L	252	263
PSM	KLTDIINNDHENVK	879	sp|Q8N335|GPD1L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=4690	30.603	3	1663.8932	1663.8932	R	Y	51	65
PSM	KNIPEGSHQYELLK	880	sp|Q9H8S9-2|MOB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=4061	26.767	2	1666.9081	1666.9081	K	H	17	31
PSM	KVSQPIEGHAASFAQFK	881	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=5236	33.882	3	1855.9983	1855.9983	R	M	189	206
PSM	KVTTTVHNIIVGK	882	sp|P22059|OSBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=3789	25.129	2	1408.8402	1408.8402	K	L	577	590
PSM	LAHEDAECEKLMELYER	883	sp|Q9UG63|ABCF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	8-UNIMOD:4,10-UNIMOD:188,17-UNIMOD:267	ms_run[2]:scan=7189	45.895	2	2150.9947	2147.0066	R	L	179	196
PSM	LEAVSHTSDMHR	884	sp|Q01518-2|CAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:267	ms_run[2]:scan=1368	10.836	2	1391.6491	1391.6491	R	G	18	30
PSM	LFDHPESPTPNPTEPLFLAQAEVYK	885	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	25-UNIMOD:188	ms_run[2]:scan=10869	69.933	3	2845.427	2845.4270	R	E	968	993
PSM	LFLFHTSLPIAEAPGK	886	sp|P53992|SC24C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10389	66.614	2	1739.961	1739.9610	K	L	639	655
PSM	LGETYKDHENIVIAK	887	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=4373	28.682	3	1728.9046	1728.9046	K	M	410	425
PSM	LHPVILASIVDSYER	888	sp|O00303|EIF3F_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	15-UNIMOD:267	ms_run[2]:scan=10190	65.326	3	1720.9387	1720.9387	R	R	94	109
PSM	LLEFNQGKLPFAAAQIGNSFR	889	sp|P41250|GARS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11192	72.116	2	2320.2328	2320.2328	R	N	311	332
PSM	LNQSQREELGLIEQAYDNPHEALSR	890	sp|Q6P2Q9|PRP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8904	56.898	4	2909.4268	2909.4268	R	I	856	881
PSM	LQMEAPHIIVGTPGR	891	sp|P60842-2|IF4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7102	45.353	2	1617.8661	1617.8661	K	V	147	162
PSM	LTQQLEEERIQHQQK	892	sp|A0MZ66-2|SHOT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=2774	19.069	2	1906.9861	1906.9861	K	V	272	287
PSM	MRNGIDILVGTPGR	893	sp|Q9NR30-2|DDX21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7116	45.439	2	1497.8086	1497.8086	R	I	237	251
PSM	NLEAQHKELEEK	894	sp|Q16181-2|SEPT7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	7-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=1373	10.868	2	1478.7768	1478.7768	K	R	388	400
PSM	NLHIPTMENGPELILR	895	sp|O15382-2|BCAT2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	16-UNIMOD:267	ms_run[2]:scan=9951	63.758	2	1855.9854	1855.9854	R	F	264	280
PSM	NRTVPFCSTFAAFFTR	896	sp|P29401|TKT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:267,7-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=11756	76.195	2	1940.947	1940.9470	R	A	380	396
PSM	NVNIFKFIIPNVVK	897	sp|P00338-5|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=12304	80.463	2	1643.9763	1643.9763	R	Y	113	127
PSM	NYTEEEDRFLICMLHK	898	sp|O60264|SMCA5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:4	ms_run[2]:scan=9798	62.739	2	2096.9659	2096.9659	K	L	946	962
PSM	RIDALEFLPFEGK	899	sp|Q7Z4G4-3|TRM11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10905	70.167	2	1533.8191	1533.8191	K	V	127	140
PSM	RLTLEDLEDSWDR	900	sp|Q6P2Q9|PRP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:267,13-UNIMOD:267	ms_run[2]:scan=9885	63.321	2	1666.8066	1666.8066	R	G	1402	1415
PSM	RPVGASFSFGGK	901	sp|O94979-5|SC31A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=4951	32.151	2	1208.6302	1208.6302	R	L	392	404
PSM	SALQHEKEGYTIYK	902	sp|O75153|CLU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=3261	21.971	2	1665.8362	1665.8362	R	T	1164	1178
PSM	SFHSFYQLLQGGSEQMLR	903	sp|O94832|MYO1D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	16-UNIMOD:35,18-UNIMOD:267	ms_run[2]:scan=10099	64.719	3	2153.0239	2153.0239	R	S	200	218
PSM	SHMMDVQGSTQDSAIKDFVLK	904	sp|P13667|PDIA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	4-UNIMOD:35	ms_run[2]:scan=7154	45.674	3	2352.109	2352.1090	R	Y	371	392
PSM	SIFKPFIFVDDVK	905	sp|Q12765-3|SCRN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10921	70.267	2	1553.8494	1553.8494	R	L	235	248
PSM	SKYIHPDDELVLEDELQR	906	sp|P49005|DPOD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:188,18-UNIMOD:267	ms_run[2]:scan=7427	47.404	2	2214.1139	2210.1258	R	I	124	142
PSM	SLYHDISGDTSGDYRK	907	sp|P50995-2|ANX11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=4287	28.157	3	1812.8279	1812.8279	K	I	447	463
PSM	SPSGSQRPSVSDDTEHLVNGR	908	sp|P16144-2|ITB4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	7-UNIMOD:267,21-UNIMOD:267	ms_run[2]:scan=4077	26.869	3	2244.0634	2244.0634	R	M	1356	1377
PSM	SVAAIHPSLEIPMLIPK	909	sp|O60256-4|KPRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10918	70.244	2	1815.0328	1815.0328	R	E	147	164
PSM	TEELNREVAGHTEQLQMSR	910	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5003	32.477	2	2227.0651	2227.0651	R	S	275	294
PSM	TGDLGDINAEQLPGREHLNEPGTR	911	sp|Q9Y263|PLAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6294	40.38	2	2588.2579	2588.2579	K	E	326	350
PSM	TKPADMVIEAYGHGQR	912	sp|O94903|PLPHP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5482	35.403	3	1771.8676	1771.8676	K	T	48	64
PSM	TNHIGHTGYLNTVTVSPDGSLCASGGK	913	sp|P63244|RACK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	22-UNIMOD:4	ms_run[2]:scan=6129	39.366	3	2742.3031	2742.3031	K	D	186	213
PSM	TPSEALWKPTHEDSK	914	sp|Q9UKN8|TF3C4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	8-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=3704	24.636	2	1736.8772	1736.8772	K	I	591	606
PSM	TPSIQPSLLPHAAPFAK	915	sp|P35658-2|NU214_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	17-UNIMOD:188	ms_run[2]:scan=8034	51.168	2	1779.9979	1779.9979	R	S	1010	1027
PSM	VAMSHFEPNEYIHYDLLEK	916	sp|Q99798|ACON_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9100	58.154	3	2334.0991	2334.0991	K	N	32	51
PSM	VEQHVVDGKER	917	sp|Q9Y3I0|RTCB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=758	7.4022	2	1294.663	1294.6630	K	T	358	369
PSM	VFTTQELVQAFTHAPATLEADRGGK	918	sp|O95433-2|AHSA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=12009	78.117	2	2686.3715	2686.3715	R	F	225	250
PSM	VGERQPLLGPPESMR	919	sp|Q99613-2|EIF3C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	4-UNIMOD:267,15-UNIMOD:267	ms_run[2]:scan=5683	36.649	2	1684.8834	1684.8834	R	E	710	725
PSM	VGIIPPKGCLLYGPPGTGK	920	sp|P62333|PRS10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	7-UNIMOD:188,9-UNIMOD:4,19-UNIMOD:188	ms_run[2]:scan=7761	49.477	3	1935.1054	1935.1054	R	T	162	181
PSM	VGKDHTLEDEDVIQIVK	921	sp|Q9Y295|DRG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=6771	43.323	3	1949.0508	1949.0508	K	K	350	367
PSM	VHLVGIDIFTGK	922	sp|Q9GZV4|IF5A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:188	ms_run[2]:scan=9399	60.059	2	1303.7596	1303.7596	K	K	56	68
PSM	VINDKHDDVMAK	923	sp|Q99460-2|PSMD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=1321	10.568	2	1383.6816	1383.6816	K	F	716	728
PSM	VKVEHVVSVLEK	924	sp|Q9NYU2-2|UGGG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=4702	30.673	2	1376.843	1376.8430	K	K	560	572
PSM	VREFSITDVVPYPISLR	925	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:267,17-UNIMOD:267	ms_run[2]:scan=11558	74.74	2	2010.1053	2010.1053	K	W	389	406
PSM	VYYFNHITNASQWERPSGNSSSGGK	926	sp|Q13526|PIN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6800	43.505	3	2785.2845	2785.2845	R	N	22	47
PSM	YNIEKDIAAHIK	927	sp|P63167|DYL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	5-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=6612	42.345	2	1425.8019	1425.8019	K	K	32	44
PSM	VEDVLGKGWENHVEGQK	928	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	7-UNIMOD:188,17-UNIMOD:188	ms_run[1]:scan=5705	36.786273333333334	3	1935.991099	1934.988898	R	L	665	682
PSM	QLEAIDQLHLEYAKR	929	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:28	ms_run[1]:scan=9363	59.834466666666664	3	1808.9467	1808.9416	K	A	522	537
PSM	MGAGLGHGMDR	930	sp|P52272|HNRPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	1-UNIMOD:35	ms_run[1]:scan=1501	11.584615	2	1116.482910	1116.480448	R	V	419	430
PSM	MKQVEELYHSLLELGEK	931	sp|Q13813|SPTN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	1-UNIMOD:35,2-UNIMOD:188,17-UNIMOD:188	ms_run[1]:scan=10077	64.57180333333334	3	2074.082868	2073.085501	R	R	1066	1083
PSM	HTGPGILSMANAGPNTNGSQFFICTAK	932	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	24-UNIMOD:4,27-UNIMOD:188	ms_run[1]:scan=9852	63.101923333333325	3	2797.329088	2796.341898	K	T	92	119
PSM	IQAGEIGEMKDGVPEGAQLQGPVHR	933	sp|P16989|YBOX3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=6586	42.18007166666667	3	2616.312612	2615.312584	R	N	259	284
PSM	CEAFGWHAIIVDGHSVEELCK	934	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:385,1-UNIMOD:4,20-UNIMOD:4,21-UNIMOD:188	ms_run[1]:scan=10718	68.90487833333333	2	2445.1072	2445.1182	R	A	206	227
PSM	YASICQQNGIVPIVEPEILPDGDHDLKR	935	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	5-UNIMOD:4	ms_run[1]:scan=9418	60.16936833333334	3	3175.599524	3175.597199	R	C	174	202
PSM	MDSTANEVEAVKVHSFPTLK	936	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	1-UNIMOD:35	ms_run[1]:scan=6990	44.66638	2	2219.082841	2218.093984	K	F	425	445
PSM	QQREDITQSAQHALR	937	sp|Q12906|ILF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:28	ms_run[1]:scan=4644	30.330859999999998	3	1762.8732	1762.8705	R	L	309	324
PSM	TGVHHYSGNNIELGTACGK	938	sp|P62888|RL30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	17-UNIMOD:4,19-UNIMOD:188	ms_run[1]:scan=3600	23.99879	3	2019.932881	2019.952802	K	Y	69	88
PSM	FGNQADHFLGSLAFAK	939	sp|Q9H488|OFUT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	16-UNIMOD:188	ms_run[1]:scan=9390	60.00343	3	1727.879732	1727.872684	R	L	44	60
PSM	GRPTSTNPIASIFAWTR	940	sp|P48735|IDHP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	2-UNIMOD:267,17-UNIMOD:267	ms_run[1]:scan=11933	77.50091333333333	2	1893.990892	1893.996419	K	G	361	378
PSM	KEPFELEAFYTNLHEVPYPDAR	941	sp|O95757|HS74L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=10730	68.98689666666667	3	2664.272365	2664.286019	K	I	437	459
PSM	AIMTYVSSFYHAFSGAQKAETAANR	942	sp|P12814|ACTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=11444	73.90515166666667	4	2720.303935	2720.301685	K	I	237	262
PSM	AADKLIQNLDANHDGR	943	sp|Q96FQ6|S10AG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4608	30.116	3	1749.8758	1749.8758	K	I	58	74
PSM	ACDGNVDHAATHITNR	944	sp|Q9Y5A7-2|NUB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:4	ms_run[2]:scan=1942	14.144	2	1750.7805	1750.7805	R	R	399	415
PSM	AEKVHELNEEIGK	945	sp|Q9NQ29-2|LUC7L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	3-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=2680	18.529	2	1506.8081	1506.8081	K	L	123	136
PSM	ALETCGGDLKQAEIWLHK	946	sp|P43897-3|EFTS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	5-UNIMOD:4,10-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=7941	50.597	2	2080.0814	2080.0814	K	E	67	85
PSM	ALNMAIPGGPKFEPLVR	947	sp|Q6P2Q9|PRP8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9277	59.278	2	1808.9971	1808.9971	K	D	268	285
PSM	ALQALQQEHKAEIITVSDGR	948	sp|Q9BRG1|VPS25_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5685	36.665	3	2206.1706	2206.1706	R	G	152	172
PSM	AMDDGVKELLTVGQEHWK	949	sp|Q9Y5X1|SNX9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	7-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=10224	65.541	3	2067.0498	2067.0498	K	R	408	426
PSM	ANKLDHVVTIIK	950	sp|Q99873-5|ANM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4926	32	2	1349.8031	1349.8031	K	G	114	126
PSM	AQKLNEQHQLILSK	951	sp|Q8IYB5-3|SMAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3343	22.461	2	1648.9261	1648.9261	K	L	10	24
PSM	ASITPGTILIILTGR	952	sp|Q02878|RL6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=13339	91.593	2	1524.9239	1524.9239	R	H	142	157
PSM	AYSPELIVHPVLDSPNAVHEVEK	953	sp|Q8IW45|NNRD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7967	50.758	2	2542.3068	2542.3068	K	W	118	141
PSM	DGNVLLHEMQIQHPTASLIAK	954	sp|P40227|TCPZ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8741	55.757	3	2314.2104	2314.2104	K	V	59	80
PSM	DNGKHALIIYDDLSK	955	sp|P25705-2|ATPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6644	42.539	2	1700.8733	1700.8733	R	Q	252	267
PSM	DSNYHLLMSVQESLERK	956	sp|P00367-2|DHE3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9162	58.549	2	2047.9997	2047.9997	R	F	294	311
PSM	EDVFVHQTAIKK	957	sp|P16989-2|YBOX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=3179	21.476	2	1425.8019	1425.8019	K	N	114	126
PSM	EHTSYKQQLEAVNEAIK	958	sp|O95347-2|SMC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	6-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=5842	37.622	3	1999.0413	1999.0413	R	S	832	849
PSM	EVATRPLTQDLLSHEDCYILDQGGLK	959	sp|P09327|VILI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	17-UNIMOD:4	ms_run[2]:scan=9758	62.47	3	2970.4757	2970.4757	R	I	269	295
PSM	FGDRFPAMSDAYDR	960	sp|P00491|PNPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6728	43.067	3	1646.7147	1646.7147	R	T	155	169
PSM	FGDRFPAMSDAYDR	961	sp|P00491|PNPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	4-UNIMOD:267,14-UNIMOD:267	ms_run[2]:scan=6734	43.1	2	1666.7313	1666.7313	R	T	155	169
PSM	FHFIDIYLDELSK	962	sp|Q14684-2|RRP1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=11847	76.869	2	1638.8294	1638.8294	R	V	148	161
PSM	FRISLGLPVGAVINCADNTGAK	963	sp|P62829|RL23_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	15-UNIMOD:4	ms_run[2]:scan=10895	70.105	3	2272.1998	2272.1998	K	N	14	36
PSM	FRNPPGGDNLEER	964	sp|Q9NV96-3|CC50A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:267,13-UNIMOD:267	ms_run[2]:scan=3061	20.778	2	1519.7282	1519.7282	K	F	95	108
PSM	GCHLLVATPGR	965	sp|O00571-2|DDX3X_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:4	ms_run[2]:scan=3860	25.562	2	1179.6183	1179.6183	R	L	300	311
PSM	GFAFVTFDDHDSVDKIVIQK	966	sp|P09651-3|ROA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	15-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=9772	62.569	3	2292.1829	2292.1829	R	Y	147	167
PSM	GFAFVTFDDHDTVDKIVVQK	967	sp|P51991-2|ROA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	15-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=9620	61.557	3	2292.1829	2292.1829	R	Y	146	166
PSM	GFFNIYHPLDPVAYR	968	sp|Q9Y6Y8-2|S23IP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10686	68.678	2	1807.9046	1807.9046	K	L	816	831
PSM	GHAAFTSDPKPTIEVSGK	969	sp|P00390-5|GSHR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4157	27.358	3	1840.9319	1840.9319	R	K	172	190
PSM	GHGDSVDQLCWHPSNPDLFVTASGDK	970	sp|Q96J01-2|THOC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:4	ms_run[2]:scan=8556	54.569	2	2838.2668	2838.2668	R	T	97	123
PSM	GHLDALTADVKEK	971	sp|P57740-3|NU107_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=4037	26.62	2	1407.7761	1407.7761	K	M	565	578
PSM	GHVSSHDEQQVEAGAVQLR	972	sp|Q92667-2|AKAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4010	26.462	3	2045.9879	2045.9879	K	A	31	50
PSM	GHYTEGAELVDSVLDVVRK	973	sp|Q13509|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	18-UNIMOD:267,19-UNIMOD:188	ms_run[2]:scan=11124	71.674	2	2102.0979	2098.1097	K	E	104	123
PSM	GSNTTSHLHQAVAK	974	sp|P22695|QCR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=912	8.2534	2	1449.7324	1449.7324	R	A	302	316
PSM	GVQLQTHPNVDKK	975	sp|P48444|COPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=1681	12.626	2	1462.7892	1462.7892	K	L	324	337
PSM	GVSKAVEHINK	976	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=1118	9.4091	2	1180.6564	1180.6564	K	T	61	72
PSM	HAEKAPTNIVYK	977	sp|P15927|RFA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=2043	14.728	2	1369.7354	1369.7354	R	I	82	94
PSM	HASPILPITEFSDIPR	978	sp|P42167|LAP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	16-UNIMOD:267	ms_run[2]:scan=10051	64.406	3	1801.9602	1801.9602	K	R	304	320
PSM	HGFCGIPITDTGR	979	sp|P12268|IMDH2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	4-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=5940	38.211	2	1439.6855	1439.6855	R	M	137	150
PSM	HLIEQDFPGMR	980	sp|Q9H4M9|EHD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:267	ms_run[2]:scan=6302	40.43	2	1351.6582	1351.6582	R	I	77	88
PSM	HLLIGVSSDR	981	sp|P36542-2|ATPG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4481	29.337	2	1095.6037	1095.6037	K	G	91	101
PSM	HVGPGVLSMANAGPNTNGSQFFICTIK	982	sp|P30405|PPIF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	9-UNIMOD:35,24-UNIMOD:4	ms_run[2]:scan=9067	57.945	3	2832.3687	2832.3687	K	T	134	161
PSM	IGKVDCTQHYELCSGNQVR	983	sp|Q8NBS9-2|TXND5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	6-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=4091	26.953	3	2263.0474	2263.0474	K	G	134	153
PSM	IHEDTKEINEK	984	sp|Q9NTJ3-2|SMC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	6-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=914	8.2641	2	1366.7131	1366.7131	K	S	344	355
PSM	IHFPLATYAPVISAEK	985	sp|P68363-2|TBA1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9687	61.998	3	1755.956	1755.9560	R	A	149	165
PSM	IHNAENIQPGEQKYEYK	986	sp|Q04637-6|IF4G1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3236	21.82	3	2059.9963	2059.9963	K	S	385	402
PSM	IRNPWGEVEWTGR	987	sp|P17655-2|CAN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7957	50.696	2	1598.7954	1598.7954	R	W	206	219
PSM	KAALEAQNALHNMK	988	sp|Q92879-5|CELF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3409	22.839	3	1537.8035	1537.8035	R	V	53	67
PSM	KEGGLGPLNIPLLADVTR	989	sp|P32119|PRDX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=11998	78.035	3	1862.0625	1862.0625	R	R	92	110
PSM	KFMNPFNMPNLYQK	990	sp|P31948-2|STIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=9731	62.286	2	1782.8988	1782.8988	R	L	170	184
PSM	KGLPLGSAVSSPVLFSPVGR	991	sp|Q8WUM0|NU133_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:188,20-UNIMOD:267	ms_run[2]:scan=9537	61	2	1983.1488	1979.1607	R	R	35	55
PSM	KGLTPSQIGVILR	992	sp|P62277|RS13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7522	47.98	2	1380.8453	1380.8453	K	D	43	56
PSM	KLAEEEDLFDSAHPEEGDLDLASESTAHAQSSK	993	sp|Q14151|SAFB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7620	48.602	4	3555.6125	3555.6125	R	A	252	285
PSM	KVGYTPDWIFLLR	994	sp|Q00610-2|CLH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=12039	78.347	2	1606.8871	1606.8871	K	N	507	520
PSM	LENCNYAVELGKHPAK	995	sp|P13797-3|PLST_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	4-UNIMOD:4	ms_run[2]:scan=4062	26.773	2	1841.9094	1841.9094	K	F	415	431
PSM	LGEVVNTHGPVEPDKDNIR	996	sp|P30419-2|NMT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4496	29.427	3	2088.06	2088.0600	K	Q	48	67
PSM	LMNSKGEYQGVFHCAVETAK	997	sp|Q9UBX3|DIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	5-UNIMOD:188,14-UNIMOD:4,20-UNIMOD:188	ms_run[2]:scan=6086	39.104	3	2280.107	2280.1070	R	L	227	247
PSM	LSSVVTQHDSKK	998	sp|P54577|SYYC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=974	8.5905	2	1339.7498	1339.7498	R	A	136	148
PSM	LVQAEYWHDPIKEDVYR	999	sp|P50897|PPT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7247	46.259	3	2160.064	2160.0640	R	N	180	197
PSM	LYEEKTGNAWHSK	1000	sp|P09874|PARP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	5-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=2212	15.712	2	1573.7928	1573.7928	K	N	617	630
PSM	MGPGAASGGERPNLK	1001	sp|Q9H0U4|RAB1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:35	ms_run[2]:scan=1575	12.009	2	1456.7093	1456.7093	R	I	173	188
PSM	MLITILGTVKPNANR	1002	sp|P17931|LEG3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:35	ms_run[2]:scan=7512	47.922	2	1655.9393	1655.9393	R	I	130	145
PSM	MRYVASYLLAALGGNSSPSAK	1003	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:35,2-UNIMOD:267,21-UNIMOD:188	ms_run[2]:scan=10520	67.492	2	2187.1329	2183.1447	-	D	1	22
PSM	NFPNAIEHTLQWAR	1004	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9400	60.064	2	1695.8481	1695.8481	K	D	596	610
PSM	NRDVEETLFQVAHDPDCGDVVR	1005	sp|Q96BW9-2|TAM41_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	17-UNIMOD:4	ms_run[2]:scan=8510	54.279	3	2570.182	2570.1820	K	L	269	291
PSM	NTHATTHNAYDLEVIDIFK	1006	sp|P09874|PARP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10071	64.532	3	2201.0753	2201.0753	K	I	820	839
PSM	NVLSDSRPAMAPGSSHLGAPASTTTAADATPSGSLAR	1007	sp|Q9BR76|COR1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6290	40.358	4	3521.7169	3521.7169	R	A	410	447
PSM	NVNIFKFIIPNVVK	1008	sp|P00338-5|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	6-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=12302	80.451	2	1656.0166	1656.0166	R	Y	113	127
PSM	QLVARPDVVEMHDVTAQDPK	1009	sp|Q13435|SF3B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5795	37.337	3	2247.1318	2247.1318	K	L	467	487
PSM	QNDTPKGPQPPTVSPIR	1010	sp|P46087-2|NOP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4649	30.359	2	1830.9588	1830.9588	K	S	769	786
PSM	QQREDITQSAQHALR	1011	sp|Q12906-5|ILF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3486	23.297	3	1779.8976	1779.8976	R	L	309	324
PSM	QQREDITQSAQHALR	1012	sp|Q12906-5|ILF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3488	23.308	2	1779.8976	1779.8976	R	L	309	324
PSM	QQREDITQSAQHALR	1013	sp|Q12906-5|ILF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	3-UNIMOD:267,15-UNIMOD:267	ms_run[2]:scan=3493	23.342	2	1799.9141	1799.9141	R	L	309	324
PSM	RPQIDPAVEGFIR	1014	sp|Q8WU79-3|SMAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7289	46.523	2	1496.81	1496.8100	R	D	23	36
PSM	RVDIIPGFEFDR	1015	sp|Q9H4A4|AMPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9339	59.68	2	1462.7569	1462.7569	K	W	470	482
PSM	SAAHSPLDTSKQPLCQLWAEK	1016	sp|Q96BD0-2|SO4A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:188,15-UNIMOD:4,21-UNIMOD:188	ms_run[2]:scan=7785	49.631	3	2378.2091	2378.2091	R	H	46	67
PSM	SEHPGLSIGDTAKK	1017	sp|P26583|HMGB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=2401	16.848	2	1450.7819	1450.7819	K	L	115	129
PSM	SFEAPATINSASLHPEKEFLVAGGEDFK	1018	sp|Q9Y3F4|STRAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9366	59.852	2	2990.4662	2990.4662	K	L	219	247
PSM	SKCEELSGLHGQLQEAR	1019	sp|Q9P2E9-3|RRBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:188,3-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=4306	28.268	2	1956.9658	1952.9777	R	A	498	515
PSM	SKEIENGHIFTVNDQFTSK	1020	sp|Q13618-3|CUL3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=6055	38.919	3	2205.1105	2205.1105	K	L	584	603
PSM	SLDMDSIIAEVK	1021	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10482	67.233	2	1319.6643	1319.6643	R	A	253	265
PSM	SPLLAGGSPPQPVVPAHK	1022	sp|Q8NFH5-2|NUP35_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5697	36.735	3	1750.973	1750.9730	R	D	49	67
PSM	SPLLAGGSPPQPVVPAHK	1023	sp|Q8NFH5-2|NUP35_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	18-UNIMOD:188	ms_run[2]:scan=5698	36.741	2	1756.9931	1756.9931	R	D	49	67
PSM	SQGDSNPAAIPHAAEDIQGDDRWMSQHNR	1024	sp|P68402-3|PA1B2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:1	ms_run[2]:scan=7170	45.776	3	3244.434	3244.4340	M	F	2	31
PSM	STGELVVQWHLKPVEQK	1025	sp|Q8TCC3|RM30_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7117	45.444	2	1977.0684	1977.0684	K	A	141	158
PSM	TEELNREVAGHTEQLQMSR	1026	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	6-UNIMOD:267,19-UNIMOD:267	ms_run[2]:scan=4993	32.416	2	2247.0817	2247.0817	R	S	275	294
PSM	TSVIQGIHTDHNTLK	1027	sp|Q5U5X0|LYRM7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	15-UNIMOD:188	ms_run[2]:scan=3899	25.807	2	1668.8891	1668.8891	R	L	68	83
PSM	VAMKHPSAVTACNLDLENLVTDSNR	1028	sp|Q9Y678|COPG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:4	ms_run[2]:scan=8130	51.801	3	2754.3429	2754.3429	K	S	314	339
PSM	VAVNDAHLLQYNHR	1029	sp|P17931|LEG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	14-UNIMOD:267	ms_run[2]:scan=4704	30.684	2	1658.8517	1658.8517	K	V	211	225
PSM	VDIDAPDVEVHDPDWHLK	1030	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	18-UNIMOD:188	ms_run[2]:scan=7782	49.609	2	2105.0161	2105.0161	K	M	1694	1712
PSM	VGINTDRPDEALVVHGNVK	1031	sp|Q9Y2G1-2|MYRF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5364	34.666	2	2032.0702	2032.0702	R	V	551	570
PSM	VKVDPSHDASK	1032	sp|O75369-5|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=702	7.0839	2	1193.6443	1193.6443	R	V	837	848
PSM	VLDGPEKVPVVHVDEK	1033	sp|Q8TEM1|PO210_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5152	33.38	2	1758.9516	1758.9516	R	G	1322	1338
PSM	VLEENQEHYHIVQK	1034	sp|P57740-3|NU107_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	14-UNIMOD:188	ms_run[2]:scan=3072	20.844	2	1770.8996	1770.8996	R	F	353	367
PSM	VSFELFADKVPK	1035	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	9-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=8665	55.256	2	1390.7899	1390.7899	R	T	20	32
PSM	VSFELFADKVPK	1036	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8672	55.3	2	1378.7497	1378.7497	R	T	20	32
PSM	VSGHVITDIVEGKK	1037	sp|P54886-2|P5CS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=5377	34.748	2	1492.8652	1492.8652	K	V	333	347
PSM	VTIAQGGVLPNIQAVLLPK	1038	sp|Q6FI13|H2A2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=12188	79.546	2	1930.1615	1930.1615	K	K	101	120
PSM	VVVKAPDEETLIALLAHAK	1039	sp|Q9Y3E5|PTH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=11081	71.39	3	2016.1619	2016.1619	K	M	116	135
PSM	YASICQQNGIVPIVEPEILPDGDHDLKR	1040	sp|P04075-2|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	5-UNIMOD:4	ms_run[2]:scan=9575	61.256	2	3175.5972	3175.5972	R	C	228	256
PSM	YVRPGGGFEPNFMLFEK	1041	sp|P07203|GPX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10407	66.731	2	1986.9662	1986.9662	K	C	98	115
PSM	YYQTIGNHASYYKDALR	1042	sp|Q9UNM6|PSD13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:188,17-UNIMOD:267	ms_run[2]:scan=5404	34.915	2	2078.0192	2074.0311	K	F	162	179
PSM	NEKGQLGHGDTK	1043	sp|Q9P258|RCC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=523	6.088645	2	1282.622045	1282.626578	R	R	177	189
PSM	HTGPGILSMANAGPNTNGSQFFICTAK	1044	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	24-UNIMOD:4	ms_run[1]:scan=9858	63.14355333333333	2	2791.308829	2790.321769	K	T	92	119
PSM	YASICQQNGIVPIVEPEILPDGDHDLKR	1045	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	5-UNIMOD:4,27-UNIMOD:188,28-UNIMOD:267	ms_run[1]:scan=9730	62.27979166666666	2	3192.609869	3191.625597	R	C	174	202
PSM	TSSAQVEGGVHSLHSYEK	1046	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	18-UNIMOD:188	ms_run[1]:scan=3650	24.309695	2	1921.932441	1920.927298	R	R	494	512
PSM	LKVPPAINQFTQALDR	1047	sp|P62424|RL7A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	2-UNIMOD:188,16-UNIMOD:267	ms_run[1]:scan=10216	65.48748333333334	3	1826.041901	1826.038516	R	Q	74	90
PSM	LIRDVWGIEGPIDAAFTR	1048	sp|P04004|VTNC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=11515	74.42811	3	2028.074533	2028.079260	K	I	195	213
PSM	SKLDSLASDHQK	1049	sp|Q9UDT6|CLIP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1620	12.273819999999999	2	1328.678305	1327.673193	K	S	615	627
PSM	AVEQHNGKTIFAYFTGSK	1050	sp|Q9BRA2|TXD17_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=8188	52.183025	2	1997.982059	1997.000676	R	D	18	36
PSM	MAVQSKAFCAGGLAPGWK	1051	sp|A4D1Z8|GRIFN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:1,6-UNIMOD:188,9-UNIMOD:4	ms_run[1]:scan=4104	27.032153333333333	2	1927.995623	1925.958739	-	L	1	19
PSM	IGEHTPSALAIMENANVLAR	1052	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=10338	66.284345	2	2107.065973	2106.089173	K	Y	154	174
PSM	ADARQEEDSYEIFICHANVIR	1053	sp|Q96HS1-2|PGAM5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	15-UNIMOD:4	ms_run[2]:scan=8863	56.638	3	2535.1812	2535.1812	R	Y	215	236
PSM	AEIKEMGEMHR	1054	sp|P16422|EPCAM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=2603	18.058	2	1329.6169	1329.6169	K	E	300	311
PSM	AFGFSHLEALLDDSK	1055	sp|Q96FW1|OTUB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	15-UNIMOD:188	ms_run[2]:scan=11115	71.616	3	1654.8298	1654.8298	R	E	95	110
PSM	AITACAELHDLKEVVLENQK	1056	sp|Q9ULE6|PALD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	5-UNIMOD:4	ms_run[2]:scan=9202	58.797	3	2280.1784	2280.1784	R	K	378	398
PSM	ASIHEAWTDGKEAMLK	1057	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=6023	38.73	3	1797.9122	1797.9122	K	H	422	438
PSM	ASITPGTILIILTGR	1058	sp|Q02878|RL6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	15-UNIMOD:267	ms_run[2]:scan=13338	91.588	2	1534.9322	1534.9322	R	H	142	157
PSM	AVLSAEQLRDEEVHAGLGELLR	1059	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9871	63.231	3	2404.271	2404.2710	K	S	95	117
PSM	AVLSAEQLRDEEVHAGLGELLR	1060	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	9-UNIMOD:267,22-UNIMOD:267	ms_run[2]:scan=9933	63.64	3	2424.2876	2424.2876	K	S	95	117
PSM	DLVEAVAHILGIR	1061	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=13383	91.913	2	1404.8089	1404.8089	R	D	2126	2139
PSM	EVVHTVSLHEIDVINSR	1062	sp|Q9Y230-2|RUVB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	17-UNIMOD:267	ms_run[2]:scan=6989	44.661	3	1956.0304	1956.0304	K	T	192	209
PSM	FGDRFPAMSDAYDR	1063	sp|P00491|PNPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6731	43.082	2	1646.7147	1646.7147	R	T	155	169
PSM	FGPVVAPKPK	1064	sp|Q15942|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=3407	22.829	2	1038.6226	1038.6226	K	V	26	36
PSM	FIQENIFGICPHMTEDNKDLIQGK	1065	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:4	ms_run[2]:scan=9589	61.35	2	2846.3731	2846.3731	K	D	235	259
PSM	FITHAPPGEFNEVFNDVR	1066	sp|P52907|CAZA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8977	57.358	2	2088.0065	2088.0065	K	L	20	38
PSM	FRNPPGGDNLEER	1067	sp|Q9NV96-3|CC50A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=3040	20.652	3	1499.7117	1499.7117	K	F	95	108
PSM	FWEVISDEHGIDPTGTYHGDSDLQLDR	1068	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9471	60.524	3	3101.4003	3101.4003	K	I	20	47
PSM	GFAFVTFDDHDTVDKIVVQK	1069	sp|P51991-2|ROA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9619	61.552	3	2280.1426	2280.1426	R	Y	146	166
PSM	GHAGSVDSIAVDGSGTKFCSGSWDK	1070	sp|Q9GZL7|WDR12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	17-UNIMOD:188,19-UNIMOD:4,25-UNIMOD:188	ms_run[2]:scan=6340	40.669	2	2536.1691	2536.1691	R	M	187	212
PSM	GHASAPYFGKEEPSVAPSSTGK	1071	sp|Q8N183|NDUF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4325	28.386	3	2203.0546	2203.0546	K	T	131	153
PSM	GHDDLGDHYLDCGDLSNALK	1072	sp|Q13098-5|CSN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:4	ms_run[2]:scan=7517	47.949	3	2213.9648	2213.9648	R	C	160	180
PSM	GVVHDDMECSHYMK	1073	sp|P50579-3|MAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	9-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=3443	23.039	2	1712.7052	1712.7052	K	N	349	363
PSM	HAEKAPTNIVYK	1074	sp|P15927|RFA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	4-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=2042	14.722	2	1381.7757	1381.7757	R	I	82	94
PSM	HCQLEPDHEGVPEETDDFGEFR	1075	sp|Q9Y5L0-5|TNPO3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:4	ms_run[2]:scan=6810	43.567	3	2642.098	2642.0980	R	M	379	401
PSM	HITIFSPEGR	1076	sp|P60900|PSA6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5276	34.127	2	1155.6037	1155.6037	R	L	12	22
PSM	HIVAVLPEIDPVLFQGK	1077	sp|Q9UJ70|NAGK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	17-UNIMOD:188	ms_run[2]:scan=11368	73.38	3	1880.0867	1880.0867	R	I	245	262
PSM	HQGVMVGMGQK	1078	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:188	ms_run[2]:scan=2469	17.252	2	1176.5839	1176.5839	R	D	40	51
PSM	HTNPIVENGQTHPCQK	1079	sp|Q9Y5L0-5|TNPO3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	14-UNIMOD:4	ms_run[2]:scan=1253	10.18	2	1858.8744	1858.8744	R	V	557	573
PSM	HYGPGWVSMANAGK	1080	sp|P23284|PPIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	9-UNIMOD:35	ms_run[2]:scan=4131	27.201	2	1489.6772	1489.6772	K	D	132	146
PSM	ICNAVSPDKDVDGFHVINVGR	1081	sp|P13995-2|MTDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:4	ms_run[2]:scan=7071	45.172	3	2311.1379	2311.1379	R	M	42	63
PSM	IFRDGEEAGAYDGPR	1082	sp|P30101|PDIA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4208	27.67	2	1651.759	1651.7590	K	T	105	120
PSM	IHFPLATYAPVISAEK	1083	sp|P68363-2|TBA1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	16-UNIMOD:188	ms_run[2]:scan=9558	61.148	3	1761.9761	1761.9761	R	A	149	165
PSM	IIYIVHDEVKDK	1084	sp|P25788-2|PSA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4479	29.322	2	1470.8082	1470.8082	K	A	190	202
PSM	IKVDEFVTHNLSFDEINK	1085	sp|P11766|ADHX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8817	56.312	3	2147.0899	2147.0899	K	A	340	358
PSM	ISELGSQLSDEAVEDGLFHEFKR	1086	sp|Q96T37-4|RBM15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10483	67.239	2	2605.266	2605.2660	K	F	130	153
PSM	IVAERPGTNSTGPAPMAPPR	1087	sp|Q13263-2|TIF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	5-UNIMOD:267,20-UNIMOD:267	ms_run[2]:scan=4182	27.515	3	2038.0533	2038.0533	K	A	326	346
PSM	KAIIIFVPVPQLK	1088	sp|P62081|RS7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10325	66.195	2	1464.9432	1464.9432	R	S	58	71
PSM	KEDEVEEWQHR	1089	sp|P15311|EZRI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=2816	19.312	2	1483.6692	1483.6692	R	A	438	449
PSM	KETSGTQGIEGHLK	1090	sp|P56181-2|NDUV3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=1951	14.2	3	1483.7631	1483.7631	R	G	352	366
PSM	KIWCFGPDGTGPNILTDITK	1091	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	4-UNIMOD:4	ms_run[2]:scan=11276	72.715	2	2232.1249	2232.1249	R	G	648	668
PSM	KQELEEICHDLEAR	1092	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	8-UNIMOD:4	ms_run[2]:scan=6454	41.349	3	1768.8414	1768.8414	K	V	910	924
PSM	KQGTIFLAGPPLVK	1093	sp|Q9HCC0|MCCB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7804	49.748	2	1467.8813	1467.8813	R	A	235	249
PSM	LAKHESQQDYSK	1094	sp|Q14247|SRC8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=579	6.4021	2	1432.6947	1432.6947	K	G	293	305
PSM	LFLFHTSLPIAEAPGK	1095	sp|P53992|SC24C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	16-UNIMOD:188	ms_run[2]:scan=10403	66.708	3	1745.9812	1745.9812	K	L	639	655
PSM	LIAEQPPHLTPGIR	1096	sp|P78330|SERB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5987	38.508	2	1540.8726	1540.8726	R	E	79	93
PSM	LIDVNHYAKDEVAAR	1097	sp|Q13813-2|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5032	32.651	2	1712.8846	1712.8846	K	M	638	653
PSM	LKVNFLPEIITLSK	1098	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=11576	74.859	2	1626.0159	1626.0159	K	E	735	749
PSM	LKVNFLPEIITLSK	1099	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11570	74.817	2	1613.9756	1613.9756	K	E	735	749
PSM	LLEGEESRLESGMQNMSIHTK	1100	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:35	ms_run[2]:scan=5713	36.837	3	2404.1363	2404.1363	K	T	394	415
PSM	LLHEVQELTTEVEKIK	1101	sp|Q13561|DCTN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	14-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=9601	61.432	2	1920.0971	1920.0971	R	T	106	122
PSM	LQMEAPHIIVGTPGR	1102	sp|P60842-2|IF4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7100	45.343	3	1617.8661	1617.8661	K	V	147	162
PSM	LYGPTNFSPIINHVAR	1103	sp|O75131|CPNE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8527	54.386	2	1797.9526	1797.9526	K	F	391	407
PSM	LYKEELEQTYHAK	1104	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=3729	24.783	3	1650.8253	1650.8253	R	L	259	272
PSM	MVNHFIAEFK	1105	sp|P11142-2|HSP7C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:35	ms_run[2]:scan=5947	38.255	2	1250.6118	1250.6118	R	R	237	247
PSM	NHEEEVKGLQAQIASSGLTVEVDAPK	1106	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8151	51.942	4	2748.393	2748.3930	K	S	216	242
PSM	NLDLDSIIAEVK	1107	sp|P13647|K2C5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:188	ms_run[2]:scan=11651	75.383	2	1334.7389	1334.7389	R	A	332	344
PSM	NVHGINFVSPVR	1108	sp|P53634|CATC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6187	39.718	2	1337.7204	1337.7204	R	N	239	251
PSM	QADEIEKILCHK	1109	sp|P59998|ARPC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:4	ms_run[2]:scan=6473	41.459	2	1482.7501	1482.7501	K	F	78	90
PSM	QIATLHAQVADMKK	1110	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=3720	24.731	2	1564.8798	1564.8798	K	K	1358	1372
PSM	QIIEQDKHALLDVTPK	1111	sp|Q9UDY2-5|ZO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5806	37.404	2	1847.0153	1847.0153	R	A	781	797
PSM	QLLHNFPPDQLTSSGAPFWSGPK	1112	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10959	70.52	3	2523.2547	2523.2547	R	R	684	707
PSM	RAPFDLFENK	1113	sp|Q58FF7|H90B3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7835	49.937	2	1235.6299	1235.6299	R	K	280	290
PSM	RLLYMAIDGVAPR	1114	sp|Q9H0D6-2|XRN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:267,13-UNIMOD:267	ms_run[2]:scan=7872	50.152	2	1493.8291	1493.8291	R	A	20	33
PSM	RLTLEDLEDSWDR	1115	sp|Q6P2Q9|PRP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9868	63.209	2	1646.79	1646.7900	R	G	1402	1415
PSM	RQFASQANVVGPWIQTK	1116	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:267,17-UNIMOD:188	ms_run[2]:scan=7288	46.517	2	1945.0505	1941.0623	R	M	652	669
PSM	SEDCFILDHGKDGK	1117	sp|P06396-3|GELS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	4-UNIMOD:4	ms_run[2]:scan=4052	26.709	2	1619.725	1619.7250	K	I	288	302
PSM	SEDCFILDHGKDGK	1118	sp|P06396-3|GELS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	4-UNIMOD:4,11-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=4053	26.715	2	1631.7652	1631.7652	K	I	288	302
PSM	SEHPGLSIGDTAKK	1119	sp|P26583|HMGB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=2393	16.802	3	1438.7416	1438.7416	K	L	115	129
PSM	SGGIVISPFRLEELTNR	1120	sp|Q16204|CCDC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:267,17-UNIMOD:267	ms_run[2]:scan=10254	65.733	2	1907.0379	1907.0379	K	L	46	63
PSM	SGILPILVHCLER	1121	sp|O00629|IMA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:4	ms_run[2]:scan=11153	71.857	2	1505.8388	1505.8388	K	D	113	126
PSM	SGRGGNFGFGDSR	1122	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=3421	22.911	2	1312.5909	1312.5909	R	G	189	202
PSM	SGRGGNFGFGDSR	1123	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	3-UNIMOD:267,13-UNIMOD:267	ms_run[2]:scan=3429	22.959	2	1332.6074	1332.6074	R	G	189	202
PSM	SLHQFLLEPITCHAWNR	1124	sp|Q92747|ARC1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:1,12-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=11171	71.973	3	2173.0766	2173.0766	M	D	2	19
PSM	SLSEGHPTAQHEK	1125	sp|P49748-2|ACADV_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:188	ms_run[2]:scan=700	7.0744	2	1425.6944	1425.6944	R	M	566	579
PSM	SLVIPEKFQHILR	1126	sp|P62269|RS18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:1	ms_run[2]:scan=10260	65.772	2	1620.9352	1620.9352	M	V	2	15
PSM	SRLEQEIATYR	1127	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:267,11-UNIMOD:267	ms_run[2]:scan=5509	35.566	2	1384.7214	1384.7214	K	S	371	382
PSM	STDRLPSAHTCFNQLDLPAYESFEK	1128	sp|Q7Z6Z7-2|HUWE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	4-UNIMOD:267,11-UNIMOD:4,25-UNIMOD:188	ms_run[2]:scan=9007	57.542	2	2941.3887	2937.4006	R	L	4315	4340
PSM	SVAAIHPSLEIPMLIPK	1129	sp|O60256-4|KPRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	17-UNIMOD:188	ms_run[2]:scan=10924	70.284	2	1821.053	1821.0530	R	E	147	164
PSM	TEAEIAHIALETLEGHQR	1130	sp|O75955|FLOT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	18-UNIMOD:267	ms_run[2]:scan=10044	64.361	3	2027.0311	2027.0311	K	A	92	110
PSM	TKDGQILPVPNVVVR	1131	sp|Q9P258|RCC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7541	48.099	2	1633.9515	1633.9515	K	D	319	334
PSM	TLEEEAKTHEAQIQEMR	1132	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5951	38.279	2	2041.9739	2041.9739	K	Q	1175	1192
PSM	TTGIVMDSGDGVTHTVPIYEGYALPHAILR	1133	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10208	65.435	4	3182.607	3182.6070	R	L	148	178
PSM	TVFAEHISDECKR	1134	sp|P39023|RL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:4	ms_run[2]:scan=3400	22.791	2	1590.746	1590.7460	K	R	104	117
PSM	TVYGGGCSEMLMAHAVTQLANRTPGK	1135	sp|P78371-2|TCPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	7-UNIMOD:4	ms_run[2]:scan=9132	58.362	2	2748.3146	2748.3146	R	E	359	385
PSM	VKVEHVVSVLEK	1136	sp|Q9NYU2-2|UGGG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4707	30.704	2	1364.8028	1364.8028	K	K	560	572
PSM	VREFSITDVVPYPISLR	1137	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11547	74.662	2	1990.0888	1990.0888	K	W	389	406
PSM	VSGHVITDIVEGKK	1138	sp|P54886-2|P5CS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5375	34.738	3	1480.8249	1480.8249	K	V	333	347
PSM	VSGHVITDIVEGKK	1139	sp|P54886-2|P5CS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=5368	34.695	3	1492.8652	1492.8652	K	V	333	347
PSM	VVIFQQEQENKIQSHSR	1140	sp|P63151|2ABA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4364	28.627	3	2069.0654	2069.0654	R	G	52	69
PSM	WNTEDKVSHVSTGGGASLELLEGK	1141	sp|P00558-2|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7390	47.167	3	2513.2398	2513.2398	K	V	355	379
PSM	YASICQQNGIVPIVEPEILPDGDHDLKR	1142	sp|P04075-2|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	5-UNIMOD:4	ms_run[2]:scan=9426	60.222	2	3175.5972	3175.5972	R	C	228	256
PSM	YGGELVPHFPAR	1143	sp|O75369-5|FLNB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:267	ms_run[2]:scan=6720	43.017	2	1351.6912	1351.6912	K	V	1208	1220
PSM	YSTLHTQSAEPPPPPEPARI	1144	sp|Q8TCZ2-6|C99L2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	19-UNIMOD:267	ms_run[2]:scan=5633	36.339	3	2197.1043	2197.1043	K	-	170	190
PSM	LDKSQIHDIVLVGGSTR	1145	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=6274	40.25759333333333	2	1837.007168	1837.005761	K	I	326	343
PSM	KIPNPDFFEDLEPFR	1146	sp|P27824|CALX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:188,15-UNIMOD:267	ms_run[1]:scan=11879	77.11703666666666	3	1878.944796	1878.948698	R	M	401	416
PSM	DFTVSAMHGDMDQKER	1147	sp|P60842|IF4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	14-UNIMOD:188,16-UNIMOD:267	ms_run[1]:scan=5048	32.752555	2	1881.827603	1881.832030	R	D	296	312
PSM	LGETYKDHENIVIAK	1148	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	6-UNIMOD:188,15-UNIMOD:188	ms_run[1]:scan=4376	28.702384999999996	3	1741.949036	1740.944908	K	M	410	425
PSM	TLYDHVDEVTCLAFHPTEQILASGSR	1149	sp|Q05048|CSTF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	11-UNIMOD:4	ms_run[1]:scan=10745	69.08907833333333	3	2958.406696	2958.418172	R	D	168	194
PSM	CTKEEHLCTQR	1150	sp|P06753-2|TPM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=777	7.5027	2	1460.646905	1460.650033	K	M	226	237
PSM	SKLTFSCLGGSDNFK	1151	sp|Q15185|TEBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	7-UNIMOD:4	ms_run[1]:scan=6850	43.81508	3	1660.796386	1659.792657	K	H	34	49
PSM	CILPFDKETGFHR	1152	sp|Q9GZT3|SLIRP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=9322	59.57053833333333	3	1601.7660	1601.7655	R	G	48	61
PSM	VGAHAGEYGAEALER	1153	sp|P69905|HBA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=4328	28.403698333333335	2	1528.727538	1528.727020	K	M	18	33
PSM	NYTEEEDRFLICMLHK	1154	sp|P28370|SMCA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	8-UNIMOD:267,12-UNIMOD:4,16-UNIMOD:188	ms_run[1]:scan=9800	62.75075833333334	2	2113.998067	2112.994345	K	M	961	977
PSM	LTQLQELDLSNNHLETLPDNLGLSHLR	1155	sp|Q9UFC0|LRWD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	27-UNIMOD:267	ms_run[1]:scan=10688	68.69491666666666	4	3092.616165	3092.612996	R	V	46	73
PSM	SRLEQEIATYR	1156	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=5510	35.5708	2	1366.710981	1364.704828	K	S	371	382
PSM	AADFQLHTHVNDGTEFGGSIYQK	1157	sp|Q9Y277|VDAC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	23-UNIMOD:188	ms_run[2]:scan=6878	43.984	3	2540.2027	2540.2027	K	V	175	198
PSM	AEKVHELNEEIGK	1158	sp|Q9NQ29-2|LUC7L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2676	18.503	3	1494.7678	1494.7678	K	L	123	136
PSM	AGVENGKPTHFTVYTK	1159	sp|O75369-5|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=3439	23.018	2	1747.8893	1747.8893	K	G	858	874
PSM	AHLLAEVIENLECDPR	1160	sp|Q96C86|DCPS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	13-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=11203	72.193	3	1887.9388	1887.9388	R	H	295	311
PSM	AIMTYVSSFYHAFSGAQKAETAANR	1161	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	3-UNIMOD:35	ms_run[2]:scan=9892	63.367	3	2736.2966	2736.2966	K	I	256	281
PSM	ASHKPTYENLQK	1162	sp|Q9Y530|OARD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	4-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=1316	10.539	2	1426.7607	1426.7607	R	S	87	99
PSM	ATEKQHITLALEK	1163	sp|Q16891-3|MIC60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	4-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=3742	24.859	2	1492.8652	1492.8652	K	Q	392	405
PSM	CEAFGWHAIIVDGHSVEELCK	1164	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:4,20-UNIMOD:4,21-UNIMOD:188	ms_run[2]:scan=9029	57.687	4	2462.1454	2462.1454	R	A	206	227
PSM	DIFNKGFGFGLVK	1165	sp|P45880-2|VDAC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	5-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=10514	67.453	2	1452.8168	1452.8168	R	L	16	29
PSM	DLAAFDKSHDQAVR	1166	sp|P09960|LKHA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=3901	25.818	3	1571.7692	1571.7692	K	T	574	588
PSM	DLKLDNVLLDSEGHIK	1167	sp|P41743|KPCI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	3-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=8667	55.266	3	1820.0082	1820.0082	R	L	378	394
PSM	DNHLLGTFDLTGIPPAPR	1168	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10433	66.903	2	1933.0058	1933.0058	K	G	475	493
PSM	EESGKPGAHVTVK	1169	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	5-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=841	7.858	2	1349.7342	1349.7342	R	K	88	101
PSM	EGHEKADPSQFELLK	1170	sp|P51812|KS6A3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5796	37.342	2	1726.8526	1726.8526	K	V	58	73
PSM	EHALLAYTLGVK	1171	sp|Q5VTE0|EF1A3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:188	ms_run[2]:scan=7449	47.532	2	1319.7545	1319.7545	R	Q	135	147
PSM	ELFSPLHALNFGIGGDTTR	1172	sp|P68402-3|PA1B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11468	74.067	3	2044.0378	2044.0378	R	H	61	80
PSM	EMAGDNKLLGQFTLIGIPPAPR	1173	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11450	73.947	3	2337.2515	2337.2515	R	G	492	514
PSM	EMAGDNKLLGQFTLIGIPPAPR	1174	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11453	73.966	2	2337.2515	2337.2515	R	G	492	514
PSM	ESLHEVSKSDLGR	1175	sp|O43615|TIM44_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2719	18.749	2	1455.7318	1455.7318	K	K	131	144
PSM	FCFTPHTEEGCLSER	1176	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:4,11-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=6136	39.405	3	1878.7904	1878.7904	K	A	1117	1132
PSM	FDATSMHVKPQVAAQQK	1177	sp|P09327|VILI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=4229	27.799	3	1884.9516	1884.9516	K	M	375	392
PSM	FGPVVAPKPK	1178	sp|Q15942|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	8-UNIMOD:188,10-UNIMOD:188	ms_run[2]:scan=3404	22.814	2	1050.6629	1050.6629	K	V	26	36
PSM	FIQENIFGICPHMTEDNKDLIQGK	1179	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:4,13-UNIMOD:35	ms_run[2]:scan=8519	54.335	2	2862.368	2862.3681	K	D	235	259
PSM	FIQENIFGICPHMTEDNKDLIQGK	1180	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:4,18-UNIMOD:188,24-UNIMOD:188	ms_run[2]:scan=9450	60.374	3	2858.4134	2858.4134	K	D	235	259
PSM	FPNRLNLEAINYMAADGDFK	1181	sp|P09382|LEG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10780	69.321	3	2298.1103	2298.1103	K	I	109	129
PSM	FRNPPGGDNLEER	1182	sp|Q9NV96-3|CC50A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:267,13-UNIMOD:267	ms_run[2]:scan=3054	20.735	3	1519.7282	1519.7282	K	F	95	108
PSM	FVIHPESNNLIIIETDHNAYTEATK	1183	sp|Q15393|SF3B3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8669	55.277	3	2868.4294	2868.4294	K	A	788	813
PSM	GLDVDSLVIEHIQVNKAPK	1184	sp|P18621-2|RL17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8868	56.673	3	2074.1423	2074.1423	K	M	68	87
PSM	GLEYLYLNVHDEDRDDQTR	1185	sp|Q9Y6G9|DC1L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	14-UNIMOD:267,19-UNIMOD:267	ms_run[2]:scan=7340	46.84	3	2370.0991	2370.0991	R	C	98	117
PSM	GSHLDQGEAAVAFKPTSNR	1186	sp|Q12929-2|EPS8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=4281	28.12	3	1983.9763	1983.9763	R	H	241	260
PSM	GVNWAAFHPTMPLIVSGADDR	1187	sp|P53621|COPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	21-UNIMOD:267	ms_run[2]:scan=11097	71.497	3	2263.1083	2263.1083	R	Q	207	228
PSM	GVPIRLEVGPR	1188	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5883	37.863	2	1191.7088	1191.7088	K	D	1362	1373
PSM	HELSTEYIPDPERVFYTGQVVK	1189	sp|Q14690|RRP5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9255	59.134	3	2606.3017	2606.3017	K	V	572	594
PSM	HFSVEGQLEFR	1190	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:267	ms_run[2]:scan=6854	43.842	2	1357.6654	1357.6654	K	A	328	339
PSM	HGAGAEISTVHPEQYAK	1191	sp|Q8TBX8-2|PI42C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	17-UNIMOD:188	ms_run[2]:scan=3642	24.261	3	1799.8898	1799.8898	K	R	346	363
PSM	HGANTVPIKDYENK	1192	sp|P78504-2|JAG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2415	16.93	2	1584.7896	1584.7896	K	N	970	984
PSM	HGFELVELSPEELPEEDDDFPESTGVKR	1193	sp|Q6PD74-2|AAGAB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	27-UNIMOD:188,28-UNIMOD:267	ms_run[2]:scan=10164	65.156	3	3215.5117	3211.5236	K	I	25	53
PSM	HLSVNDLPVGR	1194	sp|P30048-2|PRDX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5342	34.531	2	1205.6517	1205.6517	K	S	179	190
PSM	HLSVNDLPVGR	1195	sp|P30048-2|PRDX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:267	ms_run[2]:scan=5346	34.555	2	1215.6599	1215.6599	K	S	179	190
PSM	HQFAWPFYQPVDAIK	1196	sp|Q15059-2|BRD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10615	68.208	2	1845.9202	1845.9202	K	L	53	68
PSM	HTGPGILSMANAGPNTNGSQFFICTAK	1197	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	24-UNIMOD:4	ms_run[2]:scan=9524	60.911	2	2790.3218	2790.3218	K	T	92	119
PSM	ILEREGEENEALHK	1198	sp|Q86UV5-5|UBP48_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2446	17.118	3	1665.8322	1665.8322	K	M	235	249
PSM	ILHLLGQEGPK	1199	sp|Q9Y678|COPG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5594	36.094	2	1203.6976	1203.6976	R	T	455	466
PSM	ILHLLGQEGPK	1200	sp|Q9Y678|COPG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:188	ms_run[2]:scan=5592	36.084	2	1209.7177	1209.7177	R	T	455	466
PSM	KEGGLGPLNIPLLADVTR	1201	sp|P32119|PRDX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:188,18-UNIMOD:267	ms_run[2]:scan=11922	77.419	2	1878.0909	1874.1028	R	R	92	110
PSM	KIPNPDFFEDLEPFR	1202	sp|P27824-3|CALX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11735	76.051	3	1862.9203	1862.9203	R	M	293	308
PSM	KIWCFGPDGTGPNILTDITK	1203	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	4-UNIMOD:4	ms_run[2]:scan=11255	72.561	3	2232.1249	2232.1249	R	G	648	668
PSM	KLTQIQESQVTSHNK	1204	sp|Q92541|RTF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2093	15.015	2	1739.9166	1739.9166	K	E	251	266
PSM	KNDPQSITADDLHQLLVVAR	1205	sp|Q9BTE3-3|MCMBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10003	64.097	3	2232.1862	2232.1862	R	C	407	427
PSM	KNIPEGSHQYELLK	1206	sp|Q9H8S9-2|MOB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=4116	27.106	2	1654.8679	1654.8679	K	H	17	31
PSM	KPTDGASSSNCVTDISHLVR	1207	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:188,11-UNIMOD:4,20-UNIMOD:267	ms_run[2]:scan=6121	39.316	2	2159.0612	2155.0730	R	K	698	718
PSM	KQELEEICHDLEAR	1208	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:188,8-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=6461	41.387	2	1784.8698	1780.8817	K	V	910	924
PSM	KQSLGELIGTLNAAK	1209	sp|P60174|TPIS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=8287	52.808	2	1553.918	1553.9180	R	V	56	71
PSM	KVESLWPIFR	1210	sp|P41223|BUD31_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10050	64.401	2	1273.7183	1273.7183	R	I	42	52
PSM	KVPWFDQQNGR	1211	sp|Q92522|H1X_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5449	35.198	2	1373.684	1373.6840	K	T	76	87
PSM	KVSQPIEGHAASFAQFK	1212	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5240	33.905	3	1843.9581	1843.9581	R	M	189	206
PSM	LISGEEHFSSKK	1213	sp|Q9BTE7|DCNL5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=1910	13.951	2	1360.6987	1360.6987	R	C	39	51
PSM	LKPGTMIEWGNNWAR	1214	sp|Q9BPW8|NIPS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8571	54.667	3	1771.8828	1771.8828	K	A	192	207
PSM	LQAEIEGLKGQR	1215	sp|P05787|K2C8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=4309	28.286	2	1340.7412	1340.7412	R	A	317	329
PSM	LQQLGEAHQAETEVLRR	1216	sp|Q14980-2|NUMA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5416	34.991	2	1977.0392	1977.0392	R	E	771	788
PSM	LREPLDGDGHESAEPYAK	1217	sp|O60930|RNH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=3869	25.617	2	1982.9334	1982.9334	R	H	99	117
PSM	LSSVVTQHDSKK	1218	sp|P54577|SYYC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=975	8.5957	2	1327.7096	1327.7096	R	A	136	148
PSM	LWGDRYFDPANGK	1219	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7359	46.961	2	1537.7314	1537.7314	K	F	260	273
PSM	LYKEELEQTYHAK	1220	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	3-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=3724	24.752	3	1662.8656	1662.8656	R	L	259	272
PSM	MCKQDPSVLHTEEMR	1221	sp|Q8NFI4|F10A5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:4	ms_run[2]:scan=3521	23.511	3	1859.8328	1859.8328	K	F	15	30
PSM	MHGGGPTVTAGLPLPK	1222	sp|P11586|C1TC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:35,16-UNIMOD:188	ms_run[2]:scan=6082	39.077	2	1553.8331	1553.8331	K	A	706	722
PSM	NFAADHFNQEILPVFLNANR	1223	sp|Q6PI48|SYDM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11406	73.649	3	2329.1604	2329.1604	R	N	389	409
PSM	PAGPVQAVPPPPPVPTEPK	1224	sp|Q15459-2|SF3A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	19-UNIMOD:188	ms_run[2]:scan=6368	40.843	2	1880.0503	1880.0503	M	Q	2	21
PSM	QLREYQELMNVK	1225	sp|P05787|K2C8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6478	41.492	2	1549.7923	1549.7923	R	L	370	382
PSM	RGAAGDWGER	1226	sp|Q14978|NOLC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=1637	12.372	2	1073.5003	1073.5003	K	A	648	658
PSM	RGAAGDWGER	1227	sp|Q14978|NOLC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:267,10-UNIMOD:267	ms_run[2]:scan=1652	12.462	2	1093.5168	1093.5168	K	A	648	658
PSM	RIILLAEGR	1228	sp|P23526-2|SAHH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:267,9-UNIMOD:267	ms_run[2]:scan=5184	33.573	2	1059.6668	1059.6668	R	L	307	316
PSM	RIILLAEGR	1229	sp|P23526-2|SAHH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5185	33.578	2	1039.6502	1039.6502	R	L	307	316
PSM	RIYIPLPEEAAR	1230	sp|Q9UN37|VPS4A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7319	46.708	2	1426.7932	1426.7932	K	A	288	300
PSM	RQDLLNVLAR	1231	sp|Q96A33-2|CCD47_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7216	46.062	2	1196.699	1196.6990	K	M	227	237
PSM	RQDLLNVLAR	1232	sp|Q96A33-2|CCD47_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:267,10-UNIMOD:267	ms_run[2]:scan=7221	46.095	2	1216.7155	1216.7155	K	M	227	237
PSM	RWLLLCNPGLADTIVEK	1233	sp|P11216|PYGB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	6-UNIMOD:4	ms_run[2]:scan=10666	68.547	3	1997.0768	1997.0768	R	I	491	508
PSM	SGQKPVLDVHAELDR	1234	sp|Q9Y6G9|DC1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	4-UNIMOD:188,15-UNIMOD:267	ms_run[2]:scan=4927	32.006	2	1678.8973	1674.9092	K	I	487	502
PSM	SHDFSNSENLEKLEK	1235	sp|Q9H0J9|PAR12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=4556	29.794	2	1775.8326	1775.8326	R	L	198	213
PSM	SHGKDEECVLEAENK	1236	sp|Q9UHQ4|BAP29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	8-UNIMOD:4	ms_run[2]:scan=2220	15.762	3	1743.7734	1743.7734	K	K	164	179
PSM	SHMAEESKNEYAAQLQR	1237	sp|Q15642-5|CIP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	8-UNIMOD:188,17-UNIMOD:267	ms_run[2]:scan=3214	21.685	2	2006.9451	2002.9569	R	F	180	197
PSM	SIFQHIQSAQSQR	1238	sp|Q9Y2W1|TR150_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	13-UNIMOD:267	ms_run[2]:scan=4848	31.542	3	1538.7829	1538.7829	R	S	609	622
PSM	SKEELHQDCLVLATAK	1239	sp|Q8TEQ6|GEMI5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:188,9-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=4629	30.238	3	1852.9756	1852.9756	R	H	859	875
PSM	SLCIPFKPLCELQPGAK	1240	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	3-UNIMOD:4,7-UNIMOD:188,10-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=9883	63.308	3	1969.0568	1969.0568	K	C	1478	1495
PSM	SLCIPFKPLCELQPGAK	1241	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	3-UNIMOD:4,7-UNIMOD:188,10-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=9887	63.333	2	1969.0568	1969.0568	K	C	1478	1495
PSM	SRQELEQHSVDTASTSDAVTFITYVQSLK	1242	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11679	75.584	4	3239.5946	3239.5946	K	R	1149	1178
PSM	SSRLPWAVAGR	1243	sp|Q8NBX0|SCPDL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5909	38.017	2	1198.6571	1198.6571	R	S	37	48
PSM	SSTATHPPGPAVQLNKTPSSSK	1244	sp|Q14684-2|RRP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2992	20.363	2	2191.1233	2191.1233	K	K	643	665
PSM	STEFNEHELKQWYK	1245	sp|P62760|VISL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6274	40.258	2	1837.8635	1837.8635	K	G	19	33
PSM	STLMDTLFNTKFESDPATHNEPGVR	1246	sp|Q9NVA2|SEP11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10233	65.599	4	2806.3232	2806.3232	K	L	55	80
PSM	SVHFPGQAVGTR	1247	sp|Q06210-2|GFPT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:267	ms_run[2]:scan=3962	26.18	2	1264.6552	1264.6552	K	R	191	203
PSM	TACRDNTSVYHISGK	1248	sp|Q9NTJ3-2|SMC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	3-UNIMOD:4	ms_run[2]:scan=2044	14.733	2	1707.7999	1707.7999	R	K	188	203
PSM	TGDLGDINAEQLPGREHLNEPGTR	1249	sp|Q9Y263|PLAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6284	40.317	3	2588.2579	2588.2579	K	E	326	350
PSM	TGSGKTIAFLLPMFR	1250	sp|Q7L014|DDX46_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11955	77.658	2	1637.8963	1637.8963	K	H	418	433
PSM	TLEPVRPPVVPNDYVPSPTR	1251	sp|Q9NYB9-3|ABI2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7575	48.321	3	2232.1903	2232.1903	R	N	149	169
PSM	TLEPVRPPVVPNDYVPSPTR	1252	sp|Q9NYB9-3|ABI2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7585	48.385	2	2232.1903	2232.1903	R	N	149	169
PSM	TLQALEFHTVPFQLLAR	1253	sp|Q08380|LG3BP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11760	76.225	2	1983.0942	1983.0942	K	Y	377	394
PSM	TTGIVMDSGDGVTHTVPIYEGYALPHAILR	1254	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	6-UNIMOD:35,30-UNIMOD:267	ms_run[2]:scan=9725	62.245	2	3208.6102	3208.6102	R	L	148	178
PSM	TVFAEHISDECKR	1255	sp|P39023|RL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:4	ms_run[2]:scan=3390	22.738	3	1590.746	1590.7460	K	R	104	117
PSM	TVLQRPLSLIQGPPGTGK	1256	sp|Q92900-2|RENT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7952	50.67	3	1861.0785	1861.0785	K	T	481	499
PSM	VHLMNPMVPGLTGSK	1257	sp|P54577|SYYC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7582	48.367	2	1579.8215	1579.8215	R	M	208	223
PSM	VKVEPSHDASK	1258	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=606	6.5512	2	1195.6197	1195.6197	R	V	864	875
PSM	VLEENQEHYHIVQK	1259	sp|P57740-3|NU107_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=3073	20.85	2	1764.8795	1764.8795	R	F	353	367
PSM	VLSKEFHLNESGDPSSK	1260	sp|Q01105-3|SET_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=4367	28.648	3	1872.9218	1872.9218	K	S	126	143
PSM	VRPDYTAQNLDHGK	1261	sp|P82930|RT34_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2451	17.146	2	1612.7958	1612.7958	R	A	100	114
PSM	VRPDYTAQNLDHGK	1262	sp|P82930|RT34_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2455	17.172	3	1612.7958	1612.7958	R	A	100	114
PSM	VYYVDHVEKR	1263	sp|Q96J02-3|ITCH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2372	16.676	2	1306.667	1306.6670	R	T	191	201
PSM	YTLHVVDSPTVKPSR	1264	sp|Q8N6R0-3|EFNMT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=4668	30.473	2	1697.9101	1697.9101	R	D	196	211
PSM	LKNGFPHPEPDCNPSEAASEESNSEIEQEIPVEQK	1265	sp|Q9NR30|DDX21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	12-UNIMOD:4	ms_run[1]:scan=7389	47.16088833333334	3	3935.760842	3934.780321	K	E	150	185
PSM	LDKSQIHDIVLVGGSTR	1266	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=6276	40.26968333333333	3	1837.009169	1837.005761	K	I	326	343
PSM	NTHATTHNAYDLEVIDIFK	1267	sp|P09874|PARP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=10115	64.83324166666667	3	2201.079107	2201.075297	K	I	820	839
PSM	KPTDGASSSNCVTDISHLVR	1268	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	11-UNIMOD:4	ms_run[1]:scan=6067	38.99272166666667	3	2143.034068	2143.032781	R	K	698	718
PSM	QSVENDIHGLRK	1269	sp|P05783|K1C18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0		ms_run[1]:scan=2699	18.638263333333335	2	1395.7122	1394.7262	R	V	176	188
PSM	GPHPSQGPIPFQQQK	1270	sp|Q9C0J8|WDR33_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=3994	26.365818333333333	2	1645.841987	1644.837239	R	T	892	907
PSM	KEGGLGPLNIPLLADVTR	1271	sp|P32119|PRDX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:188,18-UNIMOD:267	ms_run[1]:scan=11872	77.067595	3	1878.086914	1878.090946	R	R	92	110
PSM	CTKEEHLCTQR	1272	sp|P06753-2|TPM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:385,1-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=2097	15.041878333333333	2	1443.6261	1443.6230	K	M	226	237
PSM	LGSLALHNSESLDQEHAK	1273	sp|Q7L3B6|CD37L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=4434	29.049159999999997	3	1948.968600	1947.965019	K	A	78	96
PSM	STLMDTLFNTKFESDPATHNEPGVR	1274	sp|Q9NVA2|SEP11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=10236	65.61688666666667	2	2807.334063	2806.323209	K	L	55	80
PSM	LISGEEHFSSKK	1275	sp|Q9BTE7|DCNL5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	11-UNIMOD:188,12-UNIMOD:188	ms_run[1]:scan=1909	13.945703333333332	2	1373.750263	1372.738938	R	C	39	51
PSM	ANGTTVHVGIHPSK	1276	sp|Q9UNX3|RL26L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	14-UNIMOD:188	ms_run[1]:scan=2485	17.346186666666668	2	1423.754581	1422.767490	K	V	90	104
PSM	CILPFDKETGFHR	1277	sp|Q9GZT3|SLIRP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=9323	59.575871666666664	2	1601.7667	1601.7655	R	G	48	61
PSM	MTSYMAIDGSALAEK	1278	sp|G9CGD6-3|CNIPF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:35,5-UNIMOD:35	ms_run[1]:scan=6106	39.23084	2	1619.7562	1618.7212	K	A	463	478
PSM	ACQSIYPLHDVFVR	1279	sp|P61247|RS3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=8279	52.754	2	1713.8536	1713.8536	K	K	200	214
PSM	AFAHITGGGLLENIPR	1280	sp|P22102|PUR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=8729	55.672	3	1664.8998	1664.8998	K	V	677	693
PSM	AFGSGIDIKPGTPPIAGR	1281	sp|Q9Y520-2|PRC2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7027	44.897	3	1752.9523	1752.9523	K	S	2419	2437
PSM	AGPARDPGPDPGPGPDPAAR	1282	sp|Q6PJ69|TRI65_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2743	18.89	3	1866.8973	1866.8973	R	C	75	95
PSM	AGVENGKPTHFTVYTK	1283	sp|O75369-5|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	7-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=3430	22.963	3	1759.9296	1759.9296	K	G	858	874
PSM	AHCVTLVQLSISCDHLIDKDIGSK	1284	sp|Q99829|CPNE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:1,3-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=9963	63.834	4	2750.3731	2750.3731	M	S	2	26
PSM	AHLLAEVIENLECDPR	1285	sp|Q96C86|DCPS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	13-UNIMOD:4	ms_run[2]:scan=11199	72.163	3	1877.9305	1877.9305	R	H	295	311
PSM	AIMTYVSSFYHAFSGAQKAETAANR	1286	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	18-UNIMOD:188,25-UNIMOD:267	ms_run[2]:scan=11418	73.733	3	2736.3301	2732.3419	K	I	256	281
PSM	ALPGQLKPFETLLSQNQGGK	1287	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	7-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=10059	64.458	3	2137.1934	2137.1934	K	T	122	142
PSM	ANKLDHVVTIIK	1288	sp|Q99873-5|ANM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=4915	31.936	2	1361.8433	1361.8433	K	G	114	126
PSM	ARFEELNADLFR	1289	sp|P11142-2|HSP7C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:267,12-UNIMOD:267	ms_run[2]:scan=8293	52.847	2	1499.7636	1499.7636	R	G	300	312
PSM	ASIHEAWTDGKEAMLK	1290	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6025	38.739	3	1785.872	1785.8720	K	H	422	438
PSM	ASVHTLSGHTNAVATVR	1291	sp|O43660-2|PLRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2800	19.22	3	1719.9016	1719.9016	K	C	312	329
PSM	CPSIAAAIAAVNALHGR	1292	sp|Q14498-3|RBM39_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=10614	68.202	3	1700.902	1700.9020	K	W	456	473
PSM	DFTVSALHGDMDQKER	1293	sp|Q14240|IF4A2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5806	37.404	2	1847.8472	1847.8472	R	D	297	313
PSM	DIFNKGFGFGLVK	1294	sp|P45880-2|VDAC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10513	67.447	2	1440.7765	1440.7765	R	L	16	29
PSM	DIHTLAQLISAYSLVDPEKAK	1295	sp|O76094-2|SRP72_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	19-UNIMOD:188,21-UNIMOD:188	ms_run[2]:scan=12698	83.837	3	2323.2826	2323.2826	K	A	419	440
PSM	DLGHNDKSSTPGLK	1296	sp|Q04726-2|TLE3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=1514	11.656	2	1467.7318	1467.7318	K	S	303	317
PSM	DLKLDNVLLDSEGHIK	1297	sp|P41743|KPCI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=8693	55.435	3	1807.968	1807.9680	R	L	378	394
PSM	DNGKHALIIYDDLSK	1298	sp|P25705-2|ATPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6640	42.516	3	1700.8733	1700.8733	R	Q	252	267
PSM	EDDRVAIHEAMEQQTISIAK	1299	sp|P33992|MCM5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6711	42.962	3	2283.1165	2283.1165	R	A	452	472
PSM	ELEAENYHDIKR	1300	sp|Q01082-3|SPTB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2934	19.998	2	1515.7318	1515.7318	R	I	474	486
PSM	ELFSPLHALNFGIGGDTTR	1301	sp|P68402-3|PA1B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	19-UNIMOD:267	ms_run[2]:scan=11467	74.062	3	2054.0461	2054.0461	R	H	61	80
PSM	ELKGELYCLPCHDK	1302	sp|P48059|LIMS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:188,8-UNIMOD:4,11-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=5068	32.874	2	1772.8628	1772.8628	R	M	174	188
PSM	FFEHFIEGGR	1303	sp|Q96FW1|OTUB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:267	ms_run[2]:scan=7147	45.63	2	1247.5963	1247.5963	K	T	189	199
PSM	FFEHFIEGGR	1304	sp|Q96FW1|OTUB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7156	45.686	2	1237.588	1237.5880	K	T	189	199
PSM	FIQENIFGICPHMTEDNKDLIQGK	1305	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:4	ms_run[2]:scan=9585	61.326	3	2846.3731	2846.3731	K	D	235	259
PSM	FPNRLNLEAINYMAADGDFK	1306	sp|P09382|LEG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	4-UNIMOD:267,20-UNIMOD:188	ms_run[2]:scan=10772	69.267	3	2314.1387	2310.1506	K	I	109	129
PSM	FRNPPGGDNLEER	1307	sp|Q9NV96-3|CC50A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=3031	20.602	2	1499.7117	1499.7117	K	F	95	108
PSM	GHYTEGAELVDSVLDVVRK	1308	sp|Q13509|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	18-UNIMOD:267,19-UNIMOD:188	ms_run[2]:scan=11285	72.785	2	2102.0979	2098.1097	K	E	104	123
PSM	GIEKPPFELPDFIK	1309	sp|Q13435|SF3B2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	4-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=10805	69.487	2	1640.9217	1640.9217	R	R	516	530
PSM	GIPILSLDWLHQSR	1310	sp|Q14676-4|MDC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	14-UNIMOD:267	ms_run[2]:scan=12041	78.359	2	1643.9023	1643.9023	R	K	921	935
PSM	GKSEVPEDLAGFIELFQTPSHTK	1311	sp|P46013-2|KI67_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:188,23-UNIMOD:188	ms_run[2]:scan=12561	82.612	3	2541.3154	2541.3154	K	E	1342	1365
PSM	GLGTDEDSLIEIICSR	1312	sp|P07355-2|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	14-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=11662	75.465	3	1786.8646	1786.8646	K	T	138	154
PSM	GLGTDEDSLIEIICSR	1313	sp|P07355-2|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	14-UNIMOD:4	ms_run[2]:scan=11670	75.519	2	1776.8564	1776.8564	K	T	138	154
PSM	GVSKAVEHINK	1314	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	4-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=1117	9.4037	2	1192.6967	1192.6967	K	T	61	72
PSM	HAAENPGKYNILGTNTIMDK	1315	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	8-UNIMOD:188,18-UNIMOD:35,20-UNIMOD:188	ms_run[2]:scan=5386	34.802	2	2214.1142	2214.1142	K	M	498	518
PSM	HDAATCFVDAGNAFKK	1316	sp|P54920|SNAA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	6-UNIMOD:4	ms_run[2]:scan=5745	37.034	3	1750.8097	1750.8097	K	A	79	95
PSM	HFADLLPGFLQAVNDSCYQNDDSVLK	1317	sp|O00410-2|IPO5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	17-UNIMOD:4,26-UNIMOD:188	ms_run[2]:scan=12639	83.258	3	2971.4118	2971.4118	K	S	153	179
PSM	HFADLLPGFLQAVNDSCYQNDDSVLK	1318	sp|O00410-2|IPO5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	17-UNIMOD:4	ms_run[2]:scan=12647	83.318	3	2965.3916	2965.3916	K	S	153	179
PSM	HLLIGVSSDR	1319	sp|P36542-2|ATPG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:267	ms_run[2]:scan=4491	29.398	2	1105.6119	1105.6119	K	G	91	101
PSM	HPHDIIDDINSGAVECPAS	1320	sp|P30050-2|RL12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	16-UNIMOD:4	ms_run[2]:scan=7169	45.771	3	2045.9113	2045.9113	R	-	114	133
PSM	HTENEEDKVSSSSFR	1321	sp|Q13057|COASY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2170	15.452	3	1750.7758	1750.7758	R	Q	323	338
PSM	IAILTCPFEPPKPK	1322	sp|P48643-2|TCPE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	6-UNIMOD:4	ms_run[2]:scan=7870	50.141	2	1609.8902	1609.8902	K	T	155	169
PSM	IAILTCPFEPPKPK	1323	sp|P48643-2|TCPE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	6-UNIMOD:4,12-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=7879	50.196	2	1621.9304	1621.9304	K	T	155	169
PSM	IECEIKINHEGEVNR	1324	sp|Q16576|RBBP7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:4,6-UNIMOD:188,15-UNIMOD:267	ms_run[2]:scan=3624	24.152	2	1854.9229	1850.9348	K	A	114	129
PSM	IHFPLATYAPVISAEK	1325	sp|P68363-2|TBA1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	16-UNIMOD:188	ms_run[2]:scan=9714	62.171	3	1761.9761	1761.9761	R	A	149	165
PSM	IQEIIEQLDVTTSEYEKEK	1326	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9324	59.582	3	2294.1529	2294.1529	R	L	371	390
PSM	ISELGSQLSDEAVEDGLFHEFKR	1327	sp|Q96T37-4|RBM15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10481	67.227	4	2605.266	2605.2660	K	F	130	153
PSM	KCFSIDNPGYEPEVVAVHPGGDTVAIGGVDGNVR	1328	sp|O75083-3|WDR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:188,2-UNIMOD:4,34-UNIMOD:267	ms_run[2]:scan=8562	54.608	3	3540.7278	3536.7397	R	L	297	331
PSM	KLNIGGGGLGYR	1329	sp|Q86XP3-2|DDX42_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4923	31.985	2	1203.6724	1203.6724	K	E	531	543
PSM	KPIDYTILDDIGHGVK	1330	sp|Q9NYB9-3|ABI2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=8696	55.452	3	1782.9516	1782.9516	R	V	94	110
PSM	KSDIYVCMISFAHNVAAQGK	1331	sp|P50395-2|GDIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:188,7-UNIMOD:4,20-UNIMOD:188	ms_run[2]:scan=10464	67.115	4	2250.1328	2250.1328	R	Y	284	304
PSM	KYSCVILDEAHER	1332	sp|Q9H6R0-2|DHX33_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	4-UNIMOD:4	ms_run[2]:scan=4524	29.598	3	1618.7773	1618.7773	R	T	14	27
PSM	LCSAHGVLVPGGFGVR	1333	sp|P17812-2|PYRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:4	ms_run[2]:scan=7137	45.568	3	1624.8508	1624.8508	K	G	130	146
PSM	LDKSQIHDIVLVGGSTR	1334	sp|P11142-2|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6282	40.308	3	1837.0058	1837.0058	K	I	326	343
PSM	LSFSGLRAPVPASELLASGVLSR	1335	sp|Q15149|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	7-UNIMOD:267,23-UNIMOD:267	ms_run[2]:scan=11680	75.59	2	2346.3174	2346.3174	R	A	3440	3463
PSM	NVIIWGNHSSTQYPDVNHAK	1336	sp|P40925-2|MDHC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	20-UNIMOD:188	ms_run[2]:scan=5917	38.067	4	2285.1285	2285.1285	K	V	91	111
PSM	QAFPNTNRWFLTCINQPQFR	1337	sp|P26641|EF1G_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	13-UNIMOD:4	ms_run[2]:scan=10535	67.596	2	2537.2386	2537.2386	R	A	182	202
PSM	QFPCEPFKFLEPTLR	1338	sp|P14868-2|SYDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	4-UNIMOD:4	ms_run[2]:scan=11122	71.657	3	1907.9604	1907.9604	K	L	231	246
PSM	QFQDAGHFDAENIKK	1339	sp|Q13813-2|SPTN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4301	28.236	2	1746.8325	1746.8325	R	K	743	758
PSM	RGALIVLEGVDR	1340	sp|P23919-2|KTHY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:267,12-UNIMOD:267	ms_run[2]:scan=6922	44.255	2	1316.7679	1316.7679	R	A	5	17
PSM	RIPLAEWESR	1341	sp|P31930|QCR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:267,10-UNIMOD:267	ms_run[2]:scan=6213	39.874	2	1275.6839	1275.6839	R	I	423	433
PSM	RIPLAEWESR	1342	sp|P31930|QCR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6223	39.935	2	1255.6673	1255.6673	R	I	423	433
PSM	RLTLEDLEDSWDR	1343	sp|Q6P2Q9|PRP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:267,13-UNIMOD:267	ms_run[2]:scan=9886	63.327	3	1666.8066	1666.8066	R	G	1402	1415
PSM	SDHPGISITDLSKK	1344	sp|Q08945|SSRP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4855	31.585	2	1496.7835	1496.7835	K	A	567	581
PSM	SGGIVISPFRLEELTNR	1345	sp|Q16204|CCDC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10251	65.716	2	1887.0214	1887.0214	K	L	46	63
PSM	SHGKDEECVLEAENK	1346	sp|Q9UHQ4|BAP29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	4-UNIMOD:188,8-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=2225	15.794	3	1755.8136	1755.8136	K	K	164	179
PSM	SHTEEDCTEELFDFLHAR	1347	sp|P07919|QCR6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	7-UNIMOD:4	ms_run[2]:scan=10500	67.354	4	2234.9539	2234.9539	R	D	61	79
PSM	SIFKPFIFVDDVK	1348	sp|Q12765-3|SCRN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	4-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=10913	70.217	3	1565.8896	1565.8896	R	L	235	248
PSM	SLDMDSIIAEVK	1349	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:188	ms_run[2]:scan=10474	67.181	2	1325.6844	1325.6844	R	A	253	265
PSM	SLGPPGPPFNITPR	1350	sp|Q9NZM1-2|MYOF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=8345	53.18	2	1448.7776	1448.7776	K	K	1728	1742
PSM	SLKAYGELPEHAK	1351	sp|P47813|IF1AX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=3414	22.869	2	1441.7565	1441.7565	R	I	102	115
PSM	SLSEGHPTAQHEK	1352	sp|P49748-2|ACADV_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=698	7.0603	2	1419.6743	1419.6743	R	M	566	579
PSM	SNYNFEKPFLWLAR	1353	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11160	71.903	3	1783.9046	1783.9046	K	K	153	167
PSM	TDRYTIHSQLEHLQSK	1354	sp|Q9BWJ5|SF3B5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:1	ms_run[2]:scan=5722	36.893	3	1996.9967	1996.9967	M	Y	2	18
PSM	TDRYTIHSQLEHLQSK	1355	sp|Q9BWJ5|SF3B5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:1	ms_run[2]:scan=5728	36.928	4	1996.9967	1996.9967	M	Y	2	18
PSM	TKGVDEVTIVNILTNR	1356	sp|P07355-2|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10271	65.841	3	1770.984	1770.9840	K	S	66	82
PSM	TQAIVCQQLDLTHLKER	1357	sp|P61221|ABCE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	6-UNIMOD:4	ms_run[2]:scan=6704	42.918	3	2052.0786	2052.0786	K	N	196	213
PSM	TSVIQGIHTDHNTLK	1358	sp|Q5U5X0|LYRM7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=3903	25.828	2	1662.8689	1662.8689	R	L	68	83
PSM	TTHFVEGGDAGNREDQINR	1359	sp|P18124|RL7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	13-UNIMOD:267,19-UNIMOD:267	ms_run[2]:scan=2807	19.26	4	2134.9895	2134.9895	K	L	224	243
PSM	VHLMNPMVPGLTGSK	1360	sp|P54577|SYYC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	15-UNIMOD:188	ms_run[2]:scan=7583	48.373	2	1585.8416	1585.8416	R	M	208	223
PSM	VINDKHDDVMAK	1361	sp|Q99460-2|PSMD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	5-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=1313	10.524	3	1395.7219	1395.7219	K	F	716	728
PSM	VKVDPSHDASK	1362	sp|O75369-5|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=703	7.0886	2	1181.6041	1181.6041	R	V	837	848
PSM	VLDGPEKVPVVHVDEK	1363	sp|Q8TEM1|PO210_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5140	33.309	3	1758.9516	1758.9516	R	G	1322	1338
PSM	VLDSGAPIKIPVGPETLGR	1364	sp|P06576|ATPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=8548	54.515	2	1918.0888	1918.0888	K	I	125	144
PSM	VLRPPGGGSNFSLGFDEPTEQPVR	1365	sp|Q9UK76|JUPI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=8437	53.808	3	2555.2769	2555.2769	R	K	20	44
PSM	YTNKISSEAHR	1366	sp|P12955-3|PEPD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=997	8.717	2	1304.6473	1304.6473	R	E	133	144
PSM	YVRPGGGFEPNFMLFEK	1367	sp|P07203|GPX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10391	66.626	2	1986.9662	1986.9662	K	C	98	115
PSM	VKEDPDGEHAR	1368	sp|P52272|HNRPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	2-UNIMOD:188,11-UNIMOD:267	ms_run[1]:scan=516	6.048971666666667	2	1267.609275	1267.612776	K	R	144	155
PSM	LLQDFFNGKELNK	1369	sp|P54652|HSP72_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=8325	53.05420166666667	2	1565.825564	1564.824943	K	S	352	365
PSM	QIGNVAALPGIVHR	1370	sp|Q9Y3I0|RTCB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:28,14-UNIMOD:267	ms_run[1]:scan=9180	58.65734333333334	2	1436.8155	1436.8122	K	S	68	82
PSM	QIGNVAALPGIVHR	1371	sp|Q9Y3I0|RTCB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:28	ms_run[1]:scan=9184	58.684005000000006	2	1426.8068	1426.8040	K	S	68	82
PSM	HIGVCISVANNR	1372	sp|O60506|HNRPQ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	5-UNIMOD:4,12-UNIMOD:267	ms_run[1]:scan=4643	30.32531666666667	2	1348.691455	1348.690922	K	L	233	245
PSM	QLLHNFPPDQLTSSGAPFWSGPK	1373	sp|P22314|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=10800	69.45625333333334	3	2524.249444	2523.254659	R	R	724	747
PSM	YDVGGGERFDSLTDLVEHYK	1374	sp|Q06124|PTN11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=10149	65.05767333333333	3	2299.077748	2299.075691	K	K	179	199
PSM	VAEEHAPSIVFIDEIDAIGTKR	1375	sp|P62191|PRS4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	21-UNIMOD:188,22-UNIMOD:267	ms_run[1]:scan=10766	69.22633	4	2425.277490	2425.282388	R	Y	273	295
PSM	CTKEEHLCTQR	1376	sp|P06753-2|TPM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:385,1-UNIMOD:4,3-UNIMOD:188,8-UNIMOD:4,11-UNIMOD:267	ms_run[1]:scan=2096	15.037118333333332	2	1459.6546	1459.6514	K	M	226	237
PSM	VRPDYTAQNLDHGK	1377	sp|P82930|RT34_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	2-UNIMOD:267,14-UNIMOD:188	ms_run[1]:scan=2452	17.151770000000003	3	1629.820312	1628.824166	R	A	100	114
PSM	ANGTTVHVGIHPSK	1378	sp|Q9UNX3|RL26L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=2488	17.362356666666667	2	1417.734242	1416.747361	K	V	90	104
PSM	CILPFDKETGFHR	1379	sp|Q9GZT3|SLIRP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:385,1-UNIMOD:4,7-UNIMOD:188,13-UNIMOD:267	ms_run[1]:scan=9330	59.62106	2	1617.7970	1617.7939	R	G	48	61
PSM	KDEQEHEFYK	1380	sp|P43686|PRS6B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:188,10-UNIMOD:188	ms_run[1]:scan=1477	11.4465	2	1363.647138	1363.644703	K	-	409	419
PSM	ALQLLHCFPLDIR	1381	sp|A0AVT1|UBA6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	7-UNIMOD:4,13-UNIMOD:267	ms_run[1]:scan=11033	71.05148333333334	2	1604.867796	1604.873637	K	L	715	728
PSM	KVPQVSTPTLVEVSR	1382	sp|P02768|ALBU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=6215	39.88496166666666	2	1638.930047	1638.930471	K	N	438	453
PSM	SSSGSSVATSGQQSGGTIQDVKR	1383	sp|O14990|IPP2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	22-UNIMOD:188	ms_run[1]:scan=5672	36.58173	2	2229.084465	2229.092860	K	K	19	42
PSM	SREDMTEAEQIIFDHFSDPK	1384	sp|Q14997|PSME4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=10731	68.99305333333334	3	2394.071376	2394.079790	R	F	1298	1318
PSM	LQMFFANNHDQEFDPPK	1385	sp|Q9Y6K1|DNM3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	17-UNIMOD:188	ms_run[1]:scan=3357	22.55001	2	2085.960739	2082.956490	R	V	605	622
PSM	DTRSLGEEPVGGLGSLLDPAK	1386	sp|Q9BYB0|SHAN3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:267,21-UNIMOD:188	ms_run[1]:scan=7260	46.34070166666667	2	2127.085633	2126.119011	K	K	1507	1528
PSM	SLNLFRTQMMDLELAMLR	1387	sp|P28290|ITPI2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	10-UNIMOD:35	ms_run[1]:scan=6228	39.966055	2	2197.062055	2197.105752	R	Q	967	985
PSM	EGKVASLIGVEGGHSIDSSLGVLR	1388	sp|P16444|DPEP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	24-UNIMOD:267	ms_run[1]:scan=10301	66.03810833333334	2	2389.323686	2389.284057	R	A	131	155