MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000208 -- new
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220618\20220618002634800212^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\111222_HL15.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220618\20220618002634800212^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\111222_HL15.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Acetyl (Protein N-term),Label:13C(6) (K),Label:13C(6)15N(4) (R),Oxidation (M)
MTD	software[1]-setting	maxMissedCleavages=1
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=40
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Label:13C(6) (K),Label:13C(6)15N(4) (R),Acetyl (Protein N-term)
MTD	software[2]-setting	TOL(-)=20
MTD	software[2]-setting	TOL(+)=20
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=1000
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=1
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Acetyl (Protein N-term),Label:13C(6) (K),Label:13C(6)15N(4) (R),Oxidation (M)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=1
MTD	software[3]-setting	peptide_mass_tolerance=20
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:1, Acetyl,]
MTD	variable_mod[1]-site	N-term
MTD	variable_mod[1]-position	Protein N-term
MTD	variable_mod[2]	[UNIMOD, UNIMOD:188, Label:13C(6),]
MTD	variable_mod[2]-site	K
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:267, Label:13C(6)15N(4),]
MTD	variable_mod[3]-site	R
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[4]-site	M
MTD	variable_mod[4]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P35658-2|NU214_HUMAN	Isoform 2 of Nuclear pore complex protein Nup214 OS=Homo sapiens OX=9606 GN=NUP214	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	null	1048-UNIMOD:188	0.01	51.0	3	1	0
PRT	sp|Q96DI7|SNR40_HUMAN	U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens OX=9606 GN=SNRNP40 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	null		0.09	50.0	2	1	0
PRT	sp|Q16658|FSCN1_HUMAN	Fascin OS=Homo sapiens OX=9606 GN=FSCN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	null		0.05	49.0	1	1	1
PRT	sp|Q8NBU5|ATAD1_HUMAN	ATPase family AAA domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ATAD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null	303-UNIMOD:4,300-UNIMOD:188,304-UNIMOD:267	0.07	48.0	3	1	0
PRT	sp|Q8WUM4|PDC6I_HUMAN	Programmed cell death 6-interacting protein OS=Homo sapiens OX=9606 GN=PDCD6IP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	250-UNIMOD:4,265-UNIMOD:188	0.02	46.0	3	1	0
PRT	sp|Q9NZ45|CISD1_HUMAN	CDGSH iron-sulfur domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CISD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	72-UNIMOD:4	0.30	46.0	3	2	1
PRT	sp|Q12904|AIMP1_HUMAN	Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 OS=Homo sapiens OX=9606 GN=AIMP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	167-UNIMOD:188,187-UNIMOD:267	0.07	46.0	3	1	0
PRT	sp|O43684-2|BUB3_HUMAN	Isoform 2 of Mitotic checkpoint protein BUB3 OS=Homo sapiens OX=9606 GN=BUB3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	100-UNIMOD:267,81-UNIMOD:35	0.06	46.0	6	1	0
PRT	sp|P42167|LAP2B_HUMAN	Lamina-associated polypeptide 2, isoforms beta/gamma OS=Homo sapiens OX=9606 GN=TMPO PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	216-UNIMOD:267,239-UNIMOD:188	0.06	46.0	4	1	0
PRT	sp|P18031|PTN1_HUMAN	Tyrosine-protein phosphatase non-receptor type 1 OS=Homo sapiens OX=9606 GN=PTPN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	215-UNIMOD:4,221-UNIMOD:267	0.05	45.0	4	1	0
PRT	sp|P55084-2|ECHB_HUMAN	Isoform 2 of Trifunctional enzyme subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=HADHB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	413-UNIMOD:4,414-UNIMOD:267	0.05	45.0	3	1	0
PRT	sp|Q09666|AHNK_HUMAN	Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	5528-UNIMOD:188,5544-UNIMOD:188,748-UNIMOD:188,4779-UNIMOD:188,2047-UNIMOD:188,3601-UNIMOD:188,1381-UNIMOD:188,1509-UNIMOD:188,4926-UNIMOD:188,4929-UNIMOD:188	0.04	45.0	11	8	5
PRT	sp|P0DPI2-2|GAL3A_HUMAN	Isoform 2 of Glutamine amidotransferase-like class 1 domain-containing protein 3A, mitochondrial OS=Homo sapiens OX=9606 GN=GATD3A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	116-UNIMOD:188,141-UNIMOD:188,94-UNIMOD:188	0.22	45.0	5	2	1
PRT	sp|P15924|DESP_HUMAN	Desmoplakin OS=Homo sapiens OX=9606 GN=DSP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	705-UNIMOD:188	0.01	45.0	3	2	1
PRT	sp|P68402-3|PA1B2_HUMAN	Isoform 3 of Platelet-activating factor acetylhydrolase IB subunit beta OS=Homo sapiens OX=9606 GN=PAFAH1B2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	79-UNIMOD:267	0.15	44.0	3	1	0
PRT	sp|Q05519-2|SRS11_HUMAN	Isoform 2 of Serine/arginine-rich splicing factor 11 OS=Homo sapiens OX=9606 GN=SRSF11	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	103-UNIMOD:267	0.05	44.0	4	1	0
PRT	sp|P07437|TBB5_HUMAN	Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	121-UNIMOD:267,122-UNIMOD:188	0.05	44.0	5	2	0
PRT	sp|Q04828|AK1C1_HUMAN	Aldo-keto reductase family 1 member C1 OS=Homo sapiens OX=9606 GN=AKR1C1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	188-UNIMOD:4,193-UNIMOD:4	0.12	44.0	3	2	1
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	44.0	null	513-UNIMOD:188,521-UNIMOD:35,529-UNIMOD:4,534-UNIMOD:188,191-UNIMOD:188,201-UNIMOD:267	0.08	44.0	18	3	0
PRT	sp|P35579|MYH9_HUMAN	Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	1209-UNIMOD:188,1210-UNIMOD:267,186-UNIMOD:188,199-UNIMOD:188,1923-UNIMOD:267,1932-UNIMOD:267,917-UNIMOD:4	0.04	44.0	12	6	2
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	1104-UNIMOD:267,1739-UNIMOD:188,1063-UNIMOD:267	0.02	44.0	7	4	1
PRT	sp|P02545|LMNA_HUMAN	Prelamin-A/C OS=Homo sapiens OX=9606 GN=LMNA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	null		0.03	44.0	2	1	0
PRT	sp|P62888|RL30_HUMAN	60S ribosomal protein L30 OS=Homo sapiens OX=9606 GN=RPL30 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	44.0	null	85-UNIMOD:4,87-UNIMOD:188	0.17	44.0	11	1	0
PRT	sp|P22102|PUR2_HUMAN	Trifunctional purine biosynthetic protein adenosine-3 OS=Homo sapiens OX=9606 GN=GART PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	757-UNIMOD:188,769-UNIMOD:267,911-UNIMOD:35,923-UNIMOD:188	0.03	43.0	6	2	0
PRT	sp|Q00839-2|HNRPU_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	505-UNIMOD:188,517-UNIMOD:188	0.04	43.0	5	2	1
PRT	sp|P51570|GALK1_HUMAN	Galactokinase OS=Homo sapiens OX=9606 GN=GALK1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.06	43.0	1	1	1
PRT	sp|P50395-2|GDIB_HUMAN	Isoform 2 of Rab GDP dissociation inhibitor beta OS=Homo sapiens OX=9606 GN=GDI2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	290-UNIMOD:4,284-UNIMOD:188,303-UNIMOD:188,257-UNIMOD:4,272-UNIMOD:4	0.16	43.0	6	3	2
PRT	sp|Q9BWF3-3|RBM4_HUMAN	Isoform 3 of RNA-binding protein 4 OS=Homo sapiens OX=9606 GN=RBM4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	45-UNIMOD:188,53-UNIMOD:267	0.13	43.0	3	1	0
PRT	sp|P62942|FKB1A_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Homo sapiens OX=9606 GN=FKBP1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	23-UNIMOD:4,19-UNIMOD:267,35-UNIMOD:188	0.17	43.0	3	1	0
PRT	sp|P36871-3|PGM1_HUMAN	Isoform 3 of Phosphoglucomutase-1 OS=Homo sapiens OX=9606 GN=PGM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	98-UNIMOD:35,96-UNIMOD:267,102-UNIMOD:188	0.06	43.0	5	1	0
PRT	sp|O00154-2|BACH_HUMAN	Isoform 2 of Cytosolic acyl coenzyme A thioester hydrolase OS=Homo sapiens OX=9606 GN=ACOT7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.16	43.0	3	2	1
PRT	sp|P04080|CYTB_HUMAN	Cystatin-B OS=Homo sapiens OX=9606 GN=CSTB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	78-UNIMOD:188,89-UNIMOD:188	0.22	43.0	3	1	0
PRT	sp|P22695|QCR2_HUMAN	Cytochrome b-c1 complex subunit 2, mitochondrial OS=Homo sapiens OX=9606 GN=UQCRC2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	43.0	null	217-UNIMOD:267,183-UNIMOD:267	0.09	43.0	7	2	0
PRT	sp|P68366|TBA4A_HUMAN	Tubulin alpha-4A chain OS=Homo sapiens OX=9606 GN=TUBA4A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0	null	85-UNIMOD:28,96-UNIMOD:188,105-UNIMOD:267	0.05	43.0	5	1	0
PRT	sp|Q6ZMZ3|SYNE3_HUMAN	Nesprin-3 OS=Homo sapiens OX=9606 GN=SYNE3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	null	890-UNIMOD:188,909-UNIMOD:188	0.02	43.0	1	1	1
PRT	sp|Q6IBS0|TWF2_HUMAN	Twinfilin-2 OS=Homo sapiens OX=9606 GN=TWF2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	2-UNIMOD:1,14-UNIMOD:188,19-UNIMOD:188	0.05	42.0	5	1	0
PRT	sp|P18669|PGAM1_HUMAN	Phosphoglycerate mutase 1 OS=Homo sapiens OX=9606 GN=PGAM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	42.0	null	100-UNIMOD:188,106-UNIMOD:188	0.15	42.0	7	2	0
PRT	sp|P35580|MYH10_HUMAN	Myosin-10 OS=Homo sapiens OX=9606 GN=MYH10 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	1216-UNIMOD:188,1217-UNIMOD:267	0.03	42.0	7	3	0
PRT	sp|Q14980-4|NUMA1_HUMAN	Isoform 4 of Nuclear mitotic apparatus protein 1 OS=Homo sapiens OX=9606 GN=NUMA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	1367-UNIMOD:4,80-UNIMOD:4,1379-UNIMOD:188,1380-UNIMOD:267	0.03	42.0	5	3	2
PRT	sp|A0FGR8-4|ESYT2_HUMAN	Isoform 4 of Extended synaptotagmin-2 OS=Homo sapiens OX=9606 GN=ESYT2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	196-UNIMOD:188,201-UNIMOD:188	0.03	42.0	3	1	0
PRT	sp|Q9NRX4|PHP14_HUMAN	14 kDa phosphohistidine phosphatase OS=Homo sapiens OX=9606 GN=PHPT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	95-UNIMOD:35,108-UNIMOD:188	0.18	42.0	3	1	0
PRT	sp|P39023|RL3_HUMAN	60S ribosomal protein L3 OS=Homo sapiens OX=9606 GN=RPL3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	177-UNIMOD:188,193-UNIMOD:188,114-UNIMOD:4	0.10	42.0	3	3	3
PRT	sp|Q08945|SSRP1_HUMAN	FACT complex subunit SSRP1 OS=Homo sapiens OX=9606 GN=SSRP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	325-UNIMOD:188,340-UNIMOD:4,343-UNIMOD:4,346-UNIMOD:188,566-UNIMOD:188,579-UNIMOD:188	0.06	42.0	6	2	0
PRT	sp|P27695|APEX1_HUMAN	DNA-(apurinic or apyrimidinic site) lyase OS=Homo sapiens OX=9606 GN=APEX1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	208-UNIMOD:4,203-UNIMOD:188,221-UNIMOD:267	0.06	42.0	3	1	0
PRT	sp|Q9UMS4|PRP19_HUMAN	Pre-mRNA-processing factor 19 OS=Homo sapiens OX=9606 GN=PRPF19 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	114-UNIMOD:4,266-UNIMOD:188,289-UNIMOD:267,115-UNIMOD:267	0.08	42.0	5	2	0
PRT	sp|P07858|CATB_HUMAN	Cathepsin B OS=Homo sapiens OX=9606 GN=CTSB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	281-UNIMOD:267	0.06	42.0	3	1	0
PRT	sp|Q9H269|VPS16_HUMAN	Vacuolar protein sorting-associated protein 16 homolog OS=Homo sapiens OX=9606 GN=VPS16 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	339-UNIMOD:188	0.02	42.0	3	1	0
PRT	sp|O75955|FLOT1_HUMAN	Flotillin-1 OS=Homo sapiens OX=9606 GN=FLOT1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	109-UNIMOD:267	0.04	42.0	3	1	0
PRT	sp|Q13162|PRDX4_HUMAN	Peroxiredoxin-4 OS=Homo sapiens OX=9606 GN=PRDX4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	51-UNIMOD:4,47-UNIMOD:267,66-UNIMOD:267	0.08	42.0	4	1	0
PRT	sp|P06576|ATPB_HUMAN	ATP synthase subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	241-UNIMOD:267,259-UNIMOD:188	0.08	42.0	5	2	1
PRT	sp|P04844-2|RPN2_HUMAN	Isoform 2 of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Homo sapiens OX=9606 GN=RPN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	257-UNIMOD:267	0.04	42.0	3	1	0
PRT	sp|P22314|UBA1_HUMAN	Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	null	724-UNIMOD:28,746-UNIMOD:188,747-UNIMOD:267	0.02	42.0	6	1	0
PRT	sp|P42166|LAP2A_HUMAN	Lamina-associated polypeptide 2, isoform alpha OS=Homo sapiens OX=9606 GN=TMPO PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	null	479-UNIMOD:28,484-UNIMOD:188,500-UNIMOD:188	0.03	42.0	5	1	0
PRT	sp|P42704|LPPRC_HUMAN	Leucine-rich PPR motif-containing protein, mitochondrial OS=Homo sapiens OX=9606 GN=LRPPRC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	42.0	null	226-UNIMOD:188,244-UNIMOD:267	0.02	42.0	3	1	0
PRT	sp|Q8TED0-3|UTP15_HUMAN	Isoform 3 of U3 small nucleolar RNA-associated protein 15 homolog OS=Homo sapiens OX=9606 GN=UTP15	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.05	41.0	2	1	0
PRT	sp|Q92945|FUBP2_HUMAN	Far upstream element-binding protein 2 OS=Homo sapiens OX=9606 GN=KHSRP PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.05	41.0	1	1	1
PRT	sp|O00291-3|HIP1_HUMAN	Isoform 3 of Huntingtin-interacting protein 1 OS=Homo sapiens OX=9606 GN=HIP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	423-UNIMOD:267	0.02	41.0	2	1	0
PRT	sp|P34897-3|GLYM_HUMAN	Isoform 3 of Serine hydroxymethyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=SHMT2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.05	41.0	1	1	1
PRT	sp|P12081-4|HARS1_HUMAN	Isoform 4 of Histidine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=HARS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	100-UNIMOD:188,106-UNIMOD:188	0.04	41.0	2	1	0
PRT	sp|P62258-2|1433E_HUMAN	Isoform SV of 14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	96-UNIMOD:188,101-UNIMOD:188,75-UNIMOD:4,76-UNIMOD:4	0.13	41.0	4	2	1
PRT	sp|Q9Y487|VPP2_HUMAN	V-type proton ATPase 116 kDa subunit a isoform 2 OS=Homo sapiens OX=9606 GN=ATP6V0A2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	526-UNIMOD:267	0.02	41.0	4	1	0
PRT	sp|P05198|IF2A_HUMAN	Eukaryotic translation initiation factor 2 subunit 1 OS=Homo sapiens OX=9606 GN=EIF2S1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	123-UNIMOD:188,133-UNIMOD:267	0.07	41.0	4	1	0
PRT	sp|Q00610-2|CLH1_HUMAN	Isoform 2 of Clathrin heavy chain 1 OS=Homo sapiens OX=9606 GN=CLTC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	189-UNIMOD:188,205-UNIMOD:188,245-UNIMOD:188	0.03	41.0	7	3	1
PRT	sp|Q9NZ01|TECR_HUMAN	Very-long-chain enoyl-CoA reductase OS=Homo sapiens OX=9606 GN=TECR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	18-UNIMOD:4,22-UNIMOD:188,33-UNIMOD:188,2-UNIMOD:188,12-UNIMOD:188,1-UNIMOD:35	0.10	41.0	8	2	0
PRT	sp|Q14204|DYHC1_HUMAN	Cytoplasmic dynein 1 heavy chain 1 OS=Homo sapiens OX=9606 GN=DYNC1H1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	3147-UNIMOD:4,3160-UNIMOD:267	0.01	41.0	4	3	2
PRT	sp|Q9UK59|DBR1_HUMAN	Lariat debranching enzyme OS=Homo sapiens OX=9606 GN=DBR1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	26-UNIMOD:267,36-UNIMOD:4,37-UNIMOD:4,44-UNIMOD:267	0.04	41.0	4	1	0
PRT	sp|P07737|PROF1_HUMAN	Profilin-1 OS=Homo sapiens OX=9606 GN=PFN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.14	41.0	1	1	1
PRT	sp|Q53HC9|EIPR1_HUMAN	EARP and GARP complex-interacting protein 1 OS=Homo sapiens OX=9606 GN=EIPR1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	296-UNIMOD:267	0.05	41.0	2	1	0
PRT	sp|P04406|G3P_HUMAN	Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	41.0	null	175-UNIMOD:35,186-UNIMOD:188,133-UNIMOD:35,139-UNIMOD:188,145-UNIMOD:188	0.16	41.0	8	2	0
PRT	sp|Q14697|GANAB_HUMAN	Neutral alpha-glucosidase AB OS=Homo sapiens OX=9606 GN=GANAB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	588-UNIMOD:267	0.02	40.0	3	1	0
PRT	sp|Q9Y230-2|RUVB2_HUMAN	Isoform 2 of RuvB-like 2 OS=Homo sapiens OX=9606 GN=RUVBL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	208-UNIMOD:267	0.04	40.0	2	1	0
PRT	sp|O75367-2|H2AY_HUMAN	Isoform 1 of Core histone macro-H2A.1 OS=Homo sapiens OX=9606 GN=MACROH2A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	273-UNIMOD:4,282-UNIMOD:188,283-UNIMOD:4,289-UNIMOD:188	0.06	40.0	5	1	0
PRT	sp|O60506-5|HNRPQ_HUMAN	Isoform 5 of Heterogeneous nuclear ribonucleoprotein Q OS=Homo sapiens OX=9606 GN=SYNCRIP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	137-UNIMOD:4,145-UNIMOD:188,151-UNIMOD:267	0.08	40.0	4	2	1
PRT	sp|Q7Z6Z7-2|HUWE1_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens OX=9606 GN=HUWE1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	2538-UNIMOD:267,1099-UNIMOD:267	0.01	40.0	3	2	1
PRT	sp|O43159|RRP8_HUMAN	Ribosomal RNA-processing protein 8 OS=Homo sapiens OX=9606 GN=RRP8 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	157-UNIMOD:188	0.04	40.0	4	1	0
PRT	sp|O94906-2|PRP6_HUMAN	Isoform 2 of Pre-mRNA-processing factor 6 OS=Homo sapiens OX=9606 GN=PRPF6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	550-UNIMOD:4,558-UNIMOD:4,560-UNIMOD:267	0.02	40.0	3	1	0
PRT	sp|O15020-2|SPTN2_HUMAN	Isoform 2 of Spectrin beta chain, non-erythrocytic 2 OS=Homo sapiens OX=9606 GN=SPTBN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.01	40.0	2	2	2
PRT	sp|Q96AE4-2|FUBP1_HUMAN	Isoform 2 of Far upstream element-binding protein 1 OS=Homo sapiens OX=9606 GN=FUBP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null		0.03	40.0	2	1	0
PRT	sp|P0DMV8-2|HS71A_HUMAN	Isoform 2 of Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	273-UNIMOD:188,287-UNIMOD:267	0.03	40.0	2	1	0
PRT	sp|P11142-2|HSP7C_HUMAN	Isoform 2 of Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	328-UNIMOD:188,342-UNIMOD:267,301-UNIMOD:267,311-UNIMOD:267	0.06	40.0	4	2	1
PRT	sp|P21333-2|FLNA_HUMAN	Isoform 2 of Filamin-A OS=Homo sapiens OX=9606 GN=FLNA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	2532-UNIMOD:188,1745-UNIMOD:267,771-UNIMOD:188,773-UNIMOD:188	0.03	40.0	7	4	2
PRT	sp|Q9BZE1|RM37_HUMAN	39S ribosomal protein L37, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL37 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null	153-UNIMOD:4,162-UNIMOD:267	0.04	40.0	3	1	0
PRT	sp|Q9Y678|COPG1_HUMAN	Coatomer subunit gamma-1 OS=Homo sapiens OX=9606 GN=COPG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	262-UNIMOD:188,280-UNIMOD:4,283-UNIMOD:188	0.03	40.0	2	1	0
PRT	sp|P36578|RL4_HUMAN	60S ribosomal protein L4 OS=Homo sapiens OX=9606 GN=RPL4 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	49-UNIMOD:267,71-UNIMOD:267	0.06	40.0	5	1	0
PRT	sp|Q9UDY2-5|ZO2_HUMAN	Isoform A3 of Tight junction protein ZO-2 OS=Homo sapiens OX=9606 GN=TJP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	615-UNIMOD:4,617-UNIMOD:188,627-UNIMOD:267	0.02	40.0	3	1	0
PRT	sp|Q01082-3|SPTB2_HUMAN	Isoform 2 of Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	236-UNIMOD:188,1640-UNIMOD:188	0.03	40.0	4	3	2
PRT	sp|P68104|EF1A1_HUMAN	Elongation factor 1-alpha 1 OS=Homo sapiens OX=9606 GN=EEF1A1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null	313-UNIMOD:188,20-UNIMOD:188,294-UNIMOD:35,134-UNIMOD:267,146-UNIMOD:188	0.13	40.0	21	4	1
PRT	sp|O95163|ELP1_HUMAN	Elongator complex protein 1 OS=Homo sapiens OX=9606 GN=ELP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null	689-UNIMOD:267	0.03	40.0	4	2	1
PRT	sp|Q5VYK3|ECM29_HUMAN	Proteasome adapter and scaffold protein ECM29 OS=Homo sapiens OX=9606 GN=ECPAS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	1039-UNIMOD:188,1056-UNIMOD:188	0.01	40.0	2	1	0
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	40.0	null	530-UNIMOD:267,154-UNIMOD:35	0.05	40.0	7	2	0
PRT	sp|Q92804-2|RBP56_HUMAN	Isoform Short of TATA-binding protein-associated factor 2N OS=Homo sapiens OX=9606 GN=TAF15	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	303-UNIMOD:188,311-UNIMOD:188	0.03	39.0	2	1	0
PRT	sp|Q02543|RL18A_HUMAN	60S ribosomal protein L18a OS=Homo sapiens OX=9606 GN=RPL18A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	128-UNIMOD:188,136-UNIMOD:188,127-UNIMOD:35	0.10	39.0	5	1	0
PRT	sp|O75521-2|ECI2_HUMAN	Isoform 2 of Enoyl-CoA delta isomerase 2, mitochondrial OS=Homo sapiens OX=9606 GN=ECI2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	333-UNIMOD:4	0.05	39.0	2	1	0
PRT	sp|Q9Y2L1-2|RRP44_HUMAN	Isoform 2 of Exosome complex exonuclease RRP44 OS=Homo sapiens OX=9606 GN=DIS3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	624-UNIMOD:188	0.02	39.0	4	1	0
PRT	sp|Q99549|MPP8_HUMAN	M-phase phosphoprotein 8 OS=Homo sapiens OX=9606 GN=MPHOSPH8 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.03	39.0	1	1	1
PRT	sp|Q00796-2|DHSO_HUMAN	Isoform 2 of Sorbitol dehydrogenase OS=Homo sapiens OX=9606 GN=SORD	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	64-UNIMOD:188,78-UNIMOD:188	0.16	39.0	2	1	0
PRT	sp|Q15061|WDR43_HUMAN	WD repeat-containing protein 43 OS=Homo sapiens OX=9606 GN=WDR43 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	39.0	null	62-UNIMOD:4,64-UNIMOD:4,71-UNIMOD:267,307-UNIMOD:4,308-UNIMOD:188,451-UNIMOD:188,452-UNIMOD:188	0.08	39.0	8	3	0
PRT	sp|Q8NFI4|F10A5_HUMAN	Putative protein FAM10A5 OS=Homo sapiens OX=9606 GN=ST13P5 PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	15-UNIMOD:35,16-UNIMOD:4,32-UNIMOD:267,41-UNIMOD:188	0.08	39.0	2	2	2
PRT	sp|Q96BS2-3|CHP3_HUMAN	Isoform 3 of Calcineurin B homologous protein 3 OS=Homo sapiens OX=9606 GN=TESC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.11	39.0	1	1	1
PRT	sp|Q92522|H1X_HUMAN	Histone H1x OS=Homo sapiens OX=9606 GN=H1FX PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.08	39.0	1	1	1
PRT	sp|O95816-2|BAG2_HUMAN	Isoform 2 of BAG family molecular chaperone regulator 2 OS=Homo sapiens OX=9606 GN=BAG2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	109-UNIMOD:4,121-UNIMOD:188	0.13	39.0	3	1	0
PRT	sp|P07919|QCR6_HUMAN	Cytochrome b-c1 complex subunit 6, mitochondrial OS=Homo sapiens OX=9606 GN=UQCRH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	39.0	null	67-UNIMOD:4,78-UNIMOD:267	0.21	39.0	4	1	0
PRT	sp|P04843|RPN1_HUMAN	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Homo sapiens OX=9606 GN=RPN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	432-UNIMOD:188,524-UNIMOD:188,536-UNIMOD:267,116-UNIMOD:188,126-UNIMOD:188	0.09	39.0	7	3	0
PRT	sp|Q9Y285-2|SYFA_HUMAN	Isoform 2 of Phenylalanine--tRNA ligase alpha subunit OS=Homo sapiens OX=9606 GN=FARSA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	59-UNIMOD:188,72-UNIMOD:267	0.07	39.0	5	2	0
PRT	sp|P52597|HNRPF_HUMAN	Heterogeneous nuclear ribonucleoprotein F OS=Homo sapiens OX=9606 GN=HNRNPF PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	290-UNIMOD:4,294-UNIMOD:267,293-UNIMOD:35	0.05	39.0	5	1	0
PRT	sp|P42765|THIM_HUMAN	3-ketoacyl-CoA thiolase, mitochondrial OS=Homo sapiens OX=9606 GN=ACAA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	39.0	null		0.07	39.0	2	1	0
PRT	sp|Q00688|FKBP3_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP3 OS=Homo sapiens OX=9606 GN=FKBP3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.07	38.0	2	1	0
PRT	sp|Q02790|FKBP4_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Homo sapiens OX=9606 GN=FKBP4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	222-UNIMOD:188,232-UNIMOD:188	0.04	38.0	3	1	0
PRT	sp|P22626-2|ROA2_HUMAN	Isoform A2 of Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	156-UNIMOD:188,161-UNIMOD:188	0.06	38.0	7	1	0
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	50-UNIMOD:188,61-UNIMOD:188,153-UNIMOD:35,177-UNIMOD:267	0.18	38.0	9	3	0
PRT	sp|P33993-2|MCM7_HUMAN	Isoform 2 of DNA replication licensing factor MCM7 OS=Homo sapiens OX=9606 GN=MCM7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	282-UNIMOD:267	0.05	38.0	2	1	0
PRT	sp|P43487-2|RANG_HUMAN	Isoform 2 of Ran-specific GTPase-activating protein OS=Homo sapiens OX=9606 GN=RANBP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	99-UNIMOD:4	0.11	38.0	2	1	0
PRT	sp|P34932|HSP74_HUMAN	Heat shock 70 kDa protein 4 OS=Homo sapiens OX=9606 GN=HSPA4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	235-UNIMOD:188,245-UNIMOD:4,250-UNIMOD:188	0.02	38.0	2	1	0
PRT	sp|P05783|K1C18_HUMAN	Keratin, type I cytoskeletal 18 OS=Homo sapiens OX=9606 GN=KRT18 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	38.0	null	176-UNIMOD:28,186-UNIMOD:267,187-UNIMOD:188	0.09	38.0	6	2	1
PRT	sp|P11387|TOP1_HUMAN	DNA topoisomerase 1 OS=Homo sapiens OX=9606 GN=TOP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.02	38.0	1	1	1
PRT	sp|P04350|TBB4A_HUMAN	Tubulin beta-4A chain OS=Homo sapiens OX=9606 GN=TUBB4A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	86-UNIMOD:267,103-UNIMOD:188	0.09	38.0	5	2	1
PRT	sp|Q14694|UBP10_HUMAN	Ubiquitin carboxyl-terminal hydrolase 10 OS=Homo sapiens OX=9606 GN=USP10 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	350-UNIMOD:188,363-UNIMOD:188	0.03	38.0	3	1	0
PRT	sp|P17480-2|UBF1_HUMAN	Isoform UBF2 of Nucleolar transcription factor 1 OS=Homo sapiens OX=9606 GN=UBTF	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	97-UNIMOD:188,101-UNIMOD:188	0.03	38.0	2	1	0
PRT	sp|P43243|MATR3_HUMAN	Matrin-3 OS=Homo sapiens OX=9606 GN=MATR3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	38.0	null	515-UNIMOD:188,230-UNIMOD:385,230-UNIMOD:4,231-UNIMOD:267,245-UNIMOD:188,293-UNIMOD:4,296-UNIMOD:4,253-UNIMOD:35,255-UNIMOD:267,263-UNIMOD:267	0.08	38.0	7	4	2
PRT	sp|P55795|HNRH2_HUMAN	Heterogeneous nuclear ribonucleoprotein H2 OS=Homo sapiens OX=9606 GN=HNRNPH2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	290-UNIMOD:4,294-UNIMOD:267	0.04	38.0	2	1	0
PRT	sp|Q96ME7-2|ZN512_HUMAN	Isoform 2 of Zinc finger protein 512 OS=Homo sapiens OX=9606 GN=ZNF512	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.04	38.0	1	1	1
PRT	sp|P62937|PPIA_HUMAN	Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	38.0	null	115-UNIMOD:4,118-UNIMOD:188,82-UNIMOD:188,91-UNIMOD:188,125-UNIMOD:188,131-UNIMOD:188,28-UNIMOD:188,31-UNIMOD:188	0.42	38.0	11	4	1
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	38.0	null	492-UNIMOD:267	0.06	38.0	4	2	1
PRT	sp|P35221-3|CTNA1_HUMAN	Isoform 3 of Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	59-UNIMOD:188,68-UNIMOD:4,78-UNIMOD:188	0.05	37.0	2	1	0
PRT	sp|Q15717|ELAV1_HUMAN	ELAV-like protein 1 OS=Homo sapiens OX=9606 GN=ELAVL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.07	37.0	2	1	0
PRT	sp|P47755|CAZA2_HUMAN	F-actin-capping protein subunit alpha-2 OS=Homo sapiens OX=9606 GN=CAPZA2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	157-UNIMOD:4,37-UNIMOD:267	0.14	37.0	5	2	0
PRT	sp|P19367-4|HXK1_HUMAN	Isoform 4 of Hexokinase-1 OS=Homo sapiens OX=9606 GN=HK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	616-UNIMOD:4	0.02	37.0	2	1	0
PRT	sp|Q14247|SRC8_HUMAN	Src substrate cortactin OS=Homo sapiens OX=9606 GN=CTTN PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.03	37.0	1	1	1
PRT	sp|P50990|TCPQ_HUMAN	T-complex protein 1 subunit theta OS=Homo sapiens OX=9606 GN=CCT8 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.06	37.0	3	2	1
PRT	sp|Q15020|SART3_HUMAN	Squamous cell carcinoma antigen recognized by T-cells 3 OS=Homo sapiens OX=9606 GN=SART3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	405-UNIMOD:188	0.02	37.0	2	1	0
PRT	sp|Q15185-3|TEBP_HUMAN	Isoform 3 of Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	58-UNIMOD:4,65-UNIMOD:188	0.14	37.0	2	1	0
PRT	sp|P41227-2|NAA10_HUMAN	Isoform 2 of N-alpha-acetyltransferase 10 OS=Homo sapiens OX=9606 GN=NAA10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	164-UNIMOD:188,168-UNIMOD:188	0.07	37.0	4	1	0
PRT	sp|Q16576|RBBP7_HUMAN	Histone-binding protein RBBP7 OS=Homo sapiens OX=9606 GN=RBBP7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	375-UNIMOD:188	0.07	37.0	3	1	0
PRT	sp|P26583|HMGB2_HUMAN	High mobility group protein B2 OS=Homo sapiens OX=9606 GN=HMGB2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	114-UNIMOD:188,127-UNIMOD:188,30-UNIMOD:188,43-UNIMOD:188	0.15	37.0	7	3	1
PRT	sp|Q6UB35|C1TM_HUMAN	Monofunctional C1-tetrahydrofolate synthase, mitochondrial OS=Homo sapiens OX=9606 GN=MTHFD1L PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.02	37.0	2	1	0
PRT	sp|Q92616|GCN1_HUMAN	eIF-2-alpha kinase activator GCN1 OS=Homo sapiens OX=9606 GN=GCN1 PE=1 SV=6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	2222-UNIMOD:188,2237-UNIMOD:188,965-UNIMOD:188,986-UNIMOD:188	0.02	37.0	4	2	0
PRT	sp|P40429|RL13A_HUMAN	60S ribosomal protein L13a OS=Homo sapiens OX=9606 GN=RPL13A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	148-UNIMOD:188,159-UNIMOD:188	0.10	37.0	1	1	1
PRT	sp|O60306|AQR_HUMAN	RNA helicase aquarius OS=Homo sapiens OX=9606 GN=AQR PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.01	37.0	1	1	1
PRT	sp|P33991|MCM4_HUMAN	DNA replication licensing factor MCM4 OS=Homo sapiens OX=9606 GN=MCM4 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	439-UNIMOD:188,444-UNIMOD:188	0.02	37.0	3	1	0
PRT	sp|Q9UPN3-4|MACF1_HUMAN	Isoform 5 of Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	1640-UNIMOD:188,1651-UNIMOD:267	0.00	37.0	2	1	0
PRT	sp|Q9UQE7|SMC3_HUMAN	Structural maintenance of chromosomes protein 3 OS=Homo sapiens OX=9606 GN=SMC3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	207-UNIMOD:188,215-UNIMOD:188	0.01	37.0	3	1	0
PRT	sp|Q9BXY0|MAK16_HUMAN	Protein MAK16 homolog OS=Homo sapiens OX=9606 GN=MAK16 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.07	37.0	2	1	0
PRT	sp|Q9HB07|MYG1_HUMAN	UPF0160 protein MYG1, mitochondrial OS=Homo sapiens OX=9606 GN=C12orf10 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null	56-UNIMOD:4,62-UNIMOD:4,66-UNIMOD:267	0.11	37.0	3	2	1
PRT	sp|P21796|VDAC1_HUMAN	Voltage-dependent anion-selective channel protein 1 OS=Homo sapiens OX=9606 GN=VDAC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.07	37.0	1	1	1
PRT	sp|P40926-2|MDHM_HUMAN	Isoform 2 of Malate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=MDH2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	74-UNIMOD:188	0.08	37.0	4	1	0
PRT	sp|Q86UE4|LYRIC_HUMAN	Protein LYRIC OS=Homo sapiens OX=9606 GN=MTDH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	248-UNIMOD:188,261-UNIMOD:188	0.03	37.0	2	1	0
PRT	sp|Q8N163-2|CCAR2_HUMAN	Isoform 2 of Cell cycle and apoptosis regulator protein 2 OS=Homo sapiens OX=9606 GN=CCAR2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	138-UNIMOD:188	0.02	37.0	4	1	0
PRT	sp|P35606-2|COPB2_HUMAN	Isoform 2 of Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	139-UNIMOD:188,157-UNIMOD:188	0.03	37.0	4	1	0
PRT	sp|P27824-3|CALX_HUMAN	Isoform 3 of Calnexin OS=Homo sapiens OX=9606 GN=CANX	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	74-UNIMOD:188,85-UNIMOD:188,80-UNIMOD:35	0.08	37.0	11	2	1
PRT	sp|Q5T8P6-5|RBM26_HUMAN	Isoform 5 of RNA-binding protein 26 OS=Homo sapiens OX=9606 GN=RBM26	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	462-UNIMOD:267,474-UNIMOD:267	0.03	37.0	2	1	0
PRT	sp|Q15125|EBP_HUMAN	3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase OS=Homo sapiens OX=9606 GN=EBP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	2-UNIMOD:1,17-UNIMOD:267	0.07	37.0	2	1	0
PRT	sp|Q9Y383-3|LC7L2_HUMAN	Isoform 3 of Putative RNA-binding protein Luc7-like 2 OS=Homo sapiens OX=9606 GN=LUC7L2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	132-UNIMOD:188,136-UNIMOD:188,187-UNIMOD:4,190-UNIMOD:4,201-UNIMOD:267,202-UNIMOD:267	0.09	37.0	8	3	0
PRT	sp|Q01518-2|CAP1_HUMAN	Isoform 2 of Adenylyl cyclase-associated protein 1 OS=Homo sapiens OX=9606 GN=CAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	415-UNIMOD:4,411-UNIMOD:188,421-UNIMOD:188	0.04	37.0	2	1	0
PRT	sp|Q13435|SF3B2_HUMAN	Splicing factor 3B subunit 2 OS=Homo sapiens OX=9606 GN=SF3B2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	37.0	null	166-UNIMOD:28	0.04	37.0	3	2	1
PRT	sp|P08243|ASNS_HUMAN	Asparagine synthetase [glutamine-hydrolyzing] OS=Homo sapiens OX=9606 GN=ASNS PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	191-UNIMOD:188,195-UNIMOD:188	0.04	37.0	1	1	1
PRT	sp|Q9Y6H1|CHCH2_HUMAN	Coiled-coil-helix-coiled-coil-helix domain-containing protein 2 OS=Homo sapiens OX=9606 GN=CHCHD2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	27-UNIMOD:267,51-UNIMOD:267	0.19	36.0	3	1	0
PRT	sp|Q70UQ0-4|IKIP_HUMAN	Isoform 4 of Inhibitor of nuclear factor kappa-B kinase-interacting protein OS=Homo sapiens OX=9606 GN=IKBIP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.04	36.0	2	1	0
PRT	sp|P26447|S10A4_HUMAN	Protein S100-A4 OS=Homo sapiens OX=9606 GN=S100A4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	18-UNIMOD:188,22-UNIMOD:188	0.16	36.0	2	1	0
PRT	sp|P09211|GSTP1_HUMAN	Glutathione S-transferase P OS=Homo sapiens OX=9606 GN=GSTP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	128-UNIMOD:188,141-UNIMOD:188	0.10	36.0	2	1	0
PRT	sp|P20936-2|RASA1_HUMAN	Isoform 2 of Ras GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RASA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	825-UNIMOD:4	0.02	36.0	1	1	1
PRT	sp|O00170|AIP_HUMAN	AH receptor-interacting protein OS=Homo sapiens OX=9606 GN=AIP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	273-UNIMOD:188,290-UNIMOD:188	0.06	36.0	3	1	0
PRT	sp|P12268|IMDH2_HUMAN	Inosine-5'-monophosphate dehydrogenase 2 OS=Homo sapiens OX=9606 GN=IMPDH2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	422-UNIMOD:188,429-UNIMOD:267	0.04	36.0	2	1	0
PRT	sp|O94832|MYO1D_HUMAN	Unconventional myosin-Id OS=Homo sapiens OX=9606 GN=MYO1D PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	450-UNIMOD:188,771-UNIMOD:267,782-UNIMOD:267	0.03	36.0	3	2	1
PRT	sp|P31153-2|METK2_HUMAN	Isoform 2 of S-adenosylmethionine synthase isoform type-2 OS=Homo sapiens OX=9606 GN=MAT2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	34-UNIMOD:188,39-UNIMOD:188	0.05	36.0	2	1	0
PRT	sp|Q9BSJ8|ESYT1_HUMAN	Extended synaptotagmin-1 OS=Homo sapiens OX=9606 GN=ESYT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	833-UNIMOD:188	0.02	36.0	2	1	0
PRT	sp|P12004|PCNA_HUMAN	Proliferating cell nuclear antigen OS=Homo sapiens OX=9606 GN=PCNA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	148-UNIMOD:4,162-UNIMOD:4	0.07	36.0	1	1	1
PRT	sp|P47756-2|CAPZB_HUMAN	Isoform 2 of F-actin-capping protein subunit beta OS=Homo sapiens OX=9606 GN=CAPZB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	145-UNIMOD:188,147-UNIMOD:4,159-UNIMOD:188	0.06	36.0	3	1	0
PRT	sp|P55263-3|ADK_HUMAN	Isoform 3 of Adenosine kinase OS=Homo sapiens OX=9606 GN=ADK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	140-UNIMOD:4,143-UNIMOD:4	0.10	36.0	1	1	1
PRT	sp|P09651-3|ROA1_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	43-UNIMOD:4,175-UNIMOD:4,178-UNIMOD:267,47-UNIMOD:267,52-UNIMOD:188	0.27	36.0	9	4	1
PRT	sp|Q9NQC3-2|RTN4_HUMAN	Isoform B of Reticulon-4 OS=Homo sapiens OX=9606 GN=RTN4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.09	36.0	1	1	0
PRT	sp|P51659-3|DHB4_HUMAN	Isoform 3 of Peroxisomal multifunctional enzyme type 2 OS=Homo sapiens OX=9606 GN=HSD17B4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	171-UNIMOD:4	0.02	36.0	1	1	1
PRT	sp|O75323|NIPS2_HUMAN	Protein NipSnap homolog 2 OS=Homo sapiens OX=9606 GN=NIPSNAP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	85-UNIMOD:4,82-UNIMOD:188,91-UNIMOD:188	0.10	36.0	5	2	1
PRT	sp|P09234|RU1C_HUMAN	U1 small nuclear ribonucleoprotein C OS=Homo sapiens OX=9606 GN=SNRPC PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	6-UNIMOD:4,9-UNIMOD:4	0.13	36.0	2	1	0
PRT	sp|O94826|TOM70_HUMAN	Mitochondrial import receptor subunit TOM70 OS=Homo sapiens OX=9606 GN=TOMM70 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	588-UNIMOD:4	0.04	36.0	2	1	0
PRT	sp|P50995-2|ANX11_HUMAN	Isoform 2 of Annexin A11 OS=Homo sapiens OX=9606 GN=ANXA11	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.04	36.0	1	1	1
PRT	sp|Q9BWJ5|SF3B5_HUMAN	Splicing factor 3B subunit 5 OS=Homo sapiens OX=9606 GN=SF3B5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	2-UNIMOD:1	0.20	36.0	4	2	1
PRT	sp|P52789|HXK2_HUMAN	Hexokinase-2 OS=Homo sapiens OX=9606 GN=HK2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	488-UNIMOD:188	0.03	36.0	3	2	1
PRT	sp|O60832-2|DKC1_HUMAN	Isoform 3 of H/ACA ribonucleoprotein complex subunit DKC1 OS=Homo sapiens OX=9606 GN=DKC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	74-UNIMOD:4	0.04	36.0	2	1	0
PRT	sp|Q3LXA3-2|TKFC_HUMAN	Isoform 2 of Triokinase/FMN cyclase OS=Homo sapiens OX=9606 GN=TKFC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.04	36.0	1	1	1
PRT	sp|Q8N684-2|CPSF7_HUMAN	Isoform 2 of Cleavage and polyadenylation specificity factor subunit 7 OS=Homo sapiens OX=9606 GN=CPSF7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	388-UNIMOD:188,390-UNIMOD:4,397-UNIMOD:188	0.04	36.0	2	1	0
PRT	sp|Q9BVC5-2|ASHWN_HUMAN	Isoform 2 of Ashwin OS=Homo sapiens OX=9606 GN=C2orf49	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.09	36.0	2	1	0
PRT	sp|P31943|HNRH1_HUMAN	Heterogeneous nuclear ribonucleoprotein H OS=Homo sapiens OX=9606 GN=HNRNPH1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	290-UNIMOD:4,294-UNIMOD:267	0.04	36.0	5	1	0
PRT	sp|Q9NR12-2|PDLI7_HUMAN	Isoform 2 of PDZ and LIM domain protein 7 OS=Homo sapiens OX=9606 GN=PDLIM7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	274-UNIMOD:4,277-UNIMOD:4,279-UNIMOD:188	0.05	36.0	2	1	0
PRT	sp|Q9UGI8|TES_HUMAN	Testin OS=Homo sapiens OX=9606 GN=TES PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	null	153-UNIMOD:28,163-UNIMOD:188,164-UNIMOD:4,170-UNIMOD:267	0.05	36.0	2	1	0
PRT	sp|P62805|H4_HUMAN	Histone H4 OS=Homo sapiens OX=9606 GN=H4C1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	36.0	null	68-UNIMOD:267,78-UNIMOD:188	0.35	36.0	7	3	1
PRT	sp|Q15021|CND1_HUMAN	Condensin complex subunit 1 OS=Homo sapiens OX=9606 GN=NCAPD2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	381-UNIMOD:267	0.01	36.0	1	1	1
PRT	sp|Q7Z2K6|ERMP1_HUMAN	Endoplasmic reticulum metallopeptidase 1 OS=Homo sapiens OX=9606 GN=ERMP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	1	1	1
PRT	sp|Q9Y5B9|SP16H_HUMAN	FACT complex subunit SPT16 OS=Homo sapiens OX=9606 GN=SUPT16H PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	479-UNIMOD:188,490-UNIMOD:188	0.02	35.0	3	1	0
PRT	sp|P62136-3|PP1A_HUMAN	Isoform 3 of Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Homo sapiens OX=9606 GN=PPP1CA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	216-UNIMOD:188,217-UNIMOD:267	0.06	35.0	3	1	0
PRT	sp|Q96G23|CERS2_HUMAN	Ceramide synthase 2 OS=Homo sapiens OX=9606 GN=CERS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.05	35.0	1	1	1
PRT	sp|P12814-2|ACTN1_HUMAN	Isoform 2 of Alpha-actinin-1 OS=Homo sapiens OX=9606 GN=ACTN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	614-UNIMOD:267,624-UNIMOD:267,162-UNIMOD:188,174-UNIMOD:188,413-UNIMOD:188,418-UNIMOD:267	0.08	35.0	8	4	2
PRT	sp|P05067-10|A4_HUMAN	Isoform APP639 of Amyloid-beta precursor protein OS=Homo sapiens OX=9606 GN=APP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.03	35.0	2	1	0
PRT	sp|P16144-4|ITB4_HUMAN	Isoform Beta-4D of Integrin beta-4 OS=Homo sapiens OX=9606 GN=ITGB4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	1483-UNIMOD:4	0.02	35.0	2	2	2
PRT	sp|P32969|RL9_HUMAN	60S ribosomal protein L9 OS=Homo sapiens OX=9606 GN=RPL9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	50-UNIMOD:188,51-UNIMOD:188	0.08	35.0	3	1	0
PRT	sp|Q16762|THTR_HUMAN	Thiosulfate sulfurtransferase OS=Homo sapiens OX=9606 GN=TST PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.06	35.0	1	1	1
PRT	sp|Q15149-3|PLEC_HUMAN	Isoform 3 of Plectin OS=Homo sapiens OX=9606 GN=PLEC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	984-UNIMOD:4,1630-UNIMOD:267,1635-UNIMOD:267,1004-UNIMOD:267,3849-UNIMOD:267	0.01	35.0	9	3	1
PRT	sp|P33992|MCM5_HUMAN	DNA replication licensing factor MCM5 OS=Homo sapiens OX=9606 GN=MCM5 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	696-UNIMOD:188,700-UNIMOD:188	0.03	35.0	2	1	0
PRT	sp|Q13151|ROA0_HUMAN	Heterogeneous nuclear ribonucleoprotein A0 OS=Homo sapiens OX=9606 GN=HNRNPA0 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	154-UNIMOD:188,159-UNIMOD:188	0.07	35.0	1	1	1
PRT	sp|P68366-2|TBA4A_HUMAN	Isoform 2 of Tubulin alpha-4A chain OS=Homo sapiens OX=9606 GN=TUBA4A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	265-UNIMOD:188,332-UNIMOD:4	0.16	35.0	10	4	1
PRT	sp|Q86UA1-2|PRP39_HUMAN	Isoform 2 of Pre-mRNA-processing factor 39 OS=Homo sapiens OX=9606 GN=PRPF39	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	87-UNIMOD:188	0.06	35.0	1	1	1
PRT	sp|Q9Y2Q9|RT28_HUMAN	28S ribosomal protein S28, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS28 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	65-UNIMOD:188,71-UNIMOD:188	0.07	35.0	2	1	0
PRT	sp|P47897-2|SYQ_HUMAN	Isoform 2 of Glutamine--tRNA ligase OS=Homo sapiens OX=9606 GN=QARS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	641-UNIMOD:188	0.02	35.0	3	1	0
PRT	sp|Q8IU81|I2BP1_HUMAN	Interferon regulatory factor 2-binding protein 1 OS=Homo sapiens OX=9606 GN=IRF2BP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.04	35.0	1	1	1
PRT	sp|P27361-2|MK03_HUMAN	Isoform 2 of Mitogen-activated protein kinase 3 OS=Homo sapiens OX=9606 GN=MAPK3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	208-UNIMOD:267	0.06	35.0	2	1	0
PRT	sp|P26639|SYTC_HUMAN	Threonine--tRNA ligase 1, cytoplasmic OS=Homo sapiens OX=9606 GN=TARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	65-UNIMOD:188,75-UNIMOD:188	0.03	35.0	3	1	0
PRT	sp|O43719|HTSF1_HUMAN	HIV Tat-specific factor 1 OS=Homo sapiens OX=9606 GN=HTATSF1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	367-UNIMOD:267,380-UNIMOD:267	0.02	35.0	3	1	0
PRT	sp|Q9UIG0-2|BAZ1B_HUMAN	Isoform 2 of Tyrosine-protein kinase BAZ1B OS=Homo sapiens OX=9606 GN=BAZ1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	101-UNIMOD:188	0.01	35.0	2	1	0
PRT	sp|P28331-3|NDUS1_HUMAN	Isoform 3 of NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	166-UNIMOD:35	0.03	35.0	1	1	1
PRT	sp|P06744|G6PI_HUMAN	Glucose-6-phosphate isomerase OS=Homo sapiens OX=9606 GN=GPI PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	401-UNIMOD:35,404-UNIMOD:4,417-UNIMOD:267	0.03	35.0	3	1	0
PRT	sp|Q69YN2-3|C19L1_HUMAN	Isoform 3 of CWF19-like protein 1 OS=Homo sapiens OX=9606 GN=CWF19L1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.04	35.0	1	1	1
PRT	sp|P61353|RL27_HUMAN	60S ribosomal protein L27 OS=Homo sapiens OX=9606 GN=RPL27 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	36-UNIMOD:267,48-UNIMOD:267	0.16	35.0	5	1	0
PRT	sp|P61204-2|ARF3_HUMAN	Isoform 2 of ADP-ribosylation factor 3 OS=Homo sapiens OX=9606 GN=ARF3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.16	35.0	2	1	0
PRT	sp|P56192-2|SYMC_HUMAN	Isoform 2 of Methionine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=MARS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	441-UNIMOD:4,456-UNIMOD:188,459-UNIMOD:188	0.04	35.0	2	1	0
PRT	sp|P62277|RS13_HUMAN	40S ribosomal protein S13 OS=Homo sapiens OX=9606 GN=RPS13 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	78-UNIMOD:188,93-UNIMOD:188	0.12	35.0	4	1	0
PRT	sp|O94916-2|NFAT5_HUMAN	Isoform A of Nuclear factor of activated T-cells 5 OS=Homo sapiens OX=9606 GN=NFAT5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	379-UNIMOD:4,382-UNIMOD:188,392-UNIMOD:188	0.01	35.0	2	1	0
PRT	sp|Q9H2P0|ADNP_HUMAN	Activity-dependent neuroprotector homeobox protein OS=Homo sapiens OX=9606 GN=ADNP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	246-UNIMOD:267	0.01	35.0	4	1	0
PRT	sp|P16435|NCPR_HUMAN	NADPH--cytochrome P450 reductase OS=Homo sapiens OX=9606 GN=POR PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	472-UNIMOD:4	0.03	35.0	1	1	1
PRT	sp|Q13813-2|SPTN1_HUMAN	Isoform 2 of Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	547-UNIMOD:267,548-UNIMOD:267,1067-UNIMOD:188,1082-UNIMOD:188,1066-UNIMOD:35,1718-UNIMOD:267	0.04	35.0	12	5	1
PRT	sp|Q8TEQ6|GEMI5_HUMAN	Gem-associated protein 5 OS=Homo sapiens OX=9606 GN=GEMIN5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	82-UNIMOD:4,92-UNIMOD:188	0.02	35.0	2	1	0
PRT	sp|P49589-3|SYCC_HUMAN	Isoform 3 of Cysteine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=CARS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	137-UNIMOD:4,138-UNIMOD:4,152-UNIMOD:267	0.04	35.0	2	2	1
PRT	sp|P42330|AK1C3_HUMAN	Aldo-keto reductase family 1 member C3 OS=Homo sapiens OX=9606 GN=AKR1C3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	188-UNIMOD:4,193-UNIMOD:4,16-UNIMOD:35	0.12	35.0	5	2	0
PRT	sp|Q15046|SYK_HUMAN	Lysine--tRNA ligase OS=Homo sapiens OX=9606 GN=KARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	127-UNIMOD:188	0.03	35.0	4	1	0
PRT	sp|P61247|RS3A_HUMAN	40S ribosomal protein S3a OS=Homo sapiens OX=9606 GN=RPS3A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	201-UNIMOD:4	0.06	34.0	1	1	1
PRT	sp|P60842-2|IF4A1_HUMAN	Isoform 2 of Eukaryotic initiation factor 4A-I OS=Homo sapiens OX=9606 GN=EIF4A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	146-UNIMOD:188,161-UNIMOD:267	0.06	34.0	3	1	0
PRT	sp|Q99584|S10AD_HUMAN	Protein S100-A13 OS=Homo sapiens OX=9606 GN=S100A13 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	51-UNIMOD:188,59-UNIMOD:188	0.21	34.0	2	1	0
PRT	sp|P04066|FUCO_HUMAN	Tissue alpha-L-fucosidase OS=Homo sapiens OX=9606 GN=FUCA1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	130-UNIMOD:188	0.04	34.0	2	1	0
PRT	sp|Q96I99|SUCB2_HUMAN	Succinate--CoA ligase [GDP-forming] subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=SUCLG2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	108-UNIMOD:188,118-UNIMOD:188	0.04	34.0	2	1	0
PRT	sp|Q14258|TRI25_HUMAN	E3 ubiquitin/ISG15 ligase TRIM25 OS=Homo sapiens OX=9606 GN=TRIM25 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	345-UNIMOD:188,349-UNIMOD:188	0.02	34.0	3	1	0
PRT	sp|Q15738|NSDHL_HUMAN	Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating OS=Homo sapiens OX=9606 GN=NSDHL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	104-UNIMOD:4	0.06	34.0	1	1	1
PRT	sp|Q6P2Q9|PRP8_HUMAN	Pre-mRNA-processing-splicing factor 8 OS=Homo sapiens OX=9606 GN=PRPF8 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	2293-UNIMOD:188,2302-UNIMOD:188	0.01	34.0	2	1	0
PRT	sp|P52948-6|NUP98_HUMAN	Isoform 6 of Nuclear pore complex protein Nup98-Nup96 OS=Homo sapiens OX=9606 GN=NUP98	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	1608-UNIMOD:4,188-UNIMOD:4,193-UNIMOD:188,198-UNIMOD:188	0.02	34.0	3	2	1
PRT	sp|Q9Y5A9-2|YTHD2_HUMAN	Isoform 2 of YTH domain-containing family protein 2 OS=Homo sapiens OX=9606 GN=YTHDF2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	512-UNIMOD:188	0.03	34.0	2	1	0
PRT	sp|P33176|KINH_HUMAN	Kinesin-1 heavy chain OS=Homo sapiens OX=9606 GN=KIF5B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.01	34.0	1	1	1
PRT	sp|O43681|ASNA_HUMAN	ATPase ASNA1 OS=Homo sapiens OX=9606 GN=ASNA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	287-UNIMOD:188,289-UNIMOD:4,290-UNIMOD:188	0.06	34.0	3	1	0
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	713-UNIMOD:267,923-UNIMOD:188,932-UNIMOD:188,635-UNIMOD:4,644-UNIMOD:188,646-UNIMOD:188	0.04	34.0	7	3	1
PRT	sp|Q96A65|EXOC4_HUMAN	Exocyst complex component 4 OS=Homo sapiens OX=9606 GN=EXOC4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	1	1	1
PRT	sp|P09429|HMGB1_HUMAN	High mobility group protein B1 OS=Homo sapiens OX=9606 GN=HMGB1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	106-UNIMOD:4,30-UNIMOD:188,43-UNIMOD:188,127-UNIMOD:188,128-UNIMOD:188,44-UNIMOD:188	0.22	34.0	9	4	0
PRT	sp|O75607|NPM3_HUMAN	Nucleoplasmin-3 OS=Homo sapiens OX=9606 GN=NPM3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	102-UNIMOD:188	0.09	34.0	2	1	0
PRT	sp|Q15287-3|RNPS1_HUMAN	Isoform 3 of RNA-binding protein with serine-rich domain 1 OS=Homo sapiens OX=9606 GN=RNPS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	137-UNIMOD:188,149-UNIMOD:188,141-UNIMOD:35	0.06	34.0	5	1	0
PRT	sp|Q92747|ARC1A_HUMAN	Actin-related protein 2/3 complex subunit 1A OS=Homo sapiens OX=9606 GN=ARPC1A PE=2 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	2-UNIMOD:1,13-UNIMOD:4,18-UNIMOD:267	0.05	34.0	4	1	0
PRT	sp|Q96RN5-3|MED15_HUMAN	Isoform 3 of Mediator of RNA polymerase II transcription subunit 15 OS=Homo sapiens OX=9606 GN=MED15	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	549-UNIMOD:4,551-UNIMOD:267	0.03	34.0	2	1	0
PRT	sp|P02545-5|LMNA_HUMAN	Isoform 5 of Prelamin-A/C OS=Homo sapiens OX=9606 GN=LMNA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	1	1	1
PRT	sp|P41250|GARS_HUMAN	Glycine--tRNA ligase OS=Homo sapiens OX=9606 GN=GARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	197-UNIMOD:188,204-UNIMOD:188	0.02	34.0	4	1	0
PRT	sp|P48651-3|PTSS1_HUMAN	Isoform 3 of Phosphatidylserine synthase 1 OS=Homo sapiens OX=9606 GN=PTDSS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	216-UNIMOD:4,230-UNIMOD:267	0.07	34.0	2	1	0
PRT	sp|O43684|BUB3_HUMAN	Mitotic checkpoint protein BUB3 OS=Homo sapiens OX=9606 GN=BUB3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null		0.06	34.0	1	1	0
PRT	sp|Q9P016|THYN1_HUMAN	Thymocyte nuclear protein 1 OS=Homo sapiens OX=9606 GN=THYN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	118-UNIMOD:4,119-UNIMOD:188,128-UNIMOD:188	0.10	34.0	2	1	0
PRT	sp|P18206|VINC_HUMAN	Vinculin OS=Homo sapiens OX=9606 GN=VCL PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null	496-UNIMOD:188,502-UNIMOD:267	0.01	33.0	3	1	0
PRT	sp|P06733|ENOA_HUMAN	Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.04	33.0	1	1	1
PRT	sp|P20700|LMNB1_HUMAN	Lamin-B1 OS=Homo sapiens OX=9606 GN=LMNB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	33.0	null	110-UNIMOD:4,111-UNIMOD:188,123-UNIMOD:188,110-UNIMOD:385	0.03	33.0	3	1	0
PRT	sp|Q9HCU5|PREB_HUMAN	Prolactin regulatory element-binding protein OS=Homo sapiens OX=9606 GN=PREB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null	104-UNIMOD:188,107-UNIMOD:188,70-UNIMOD:267	0.07	33.0	5	2	0
PRT	sp|P40121-2|CAPG_HUMAN	Isoform 2 of Macrophage-capping protein OS=Homo sapiens OX=9606 GN=CAPG	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	115-UNIMOD:188,127-UNIMOD:188	0.05	33.0	1	1	1
PRT	sp|Q8TCD5|NT5C_HUMAN	5'(3')-deoxyribonucleotidase, cytosolic type OS=Homo sapiens OX=9606 GN=NT5C PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	165-UNIMOD:4,166-UNIMOD:4,169-UNIMOD:267	0.10	33.0	2	1	0
PRT	sp|Q9NW13-2|RBM28_HUMAN	Isoform 2 of RNA-binding protein 28 OS=Homo sapiens OX=9606 GN=RBM28	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	414-UNIMOD:188,235-UNIMOD:188	0.05	33.0	3	2	1
PRT	sp|P48681|NEST_HUMAN	Nestin OS=Homo sapiens OX=9606 GN=NES PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.01	33.0	1	1	1
PRT	sp|P25325|THTM_HUMAN	3-mercaptopyruvate sulfurtransferase OS=Homo sapiens OX=9606 GN=MPST PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	65-UNIMOD:4,68-UNIMOD:267	0.06	33.0	4	1	0
PRT	sp|Q9BYJ9|YTHD1_HUMAN	YTH domain-containing family protein 1 OS=Homo sapiens OX=9606 GN=YTHDF1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	541-UNIMOD:188	0.03	33.0	2	1	0
PRT	sp|Q99623-2|PHB2_HUMAN	Isoform 2 of Prohibitin-2 OS=Homo sapiens OX=9606 GN=PHB2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	71-UNIMOD:267	0.07	33.0	2	1	0
PRT	sp|P62081|RS7_HUMAN	40S ribosomal protein S7 OS=Homo sapiens OX=9606 GN=RPS7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.07	33.0	1	1	1
PRT	sp|P31040-3|SDHA_HUMAN	Isoform 3 of Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Homo sapiens OX=9606 GN=SDHA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	479-UNIMOD:188,491-UNIMOD:188,293-UNIMOD:4,298-UNIMOD:4,306-UNIMOD:267	0.08	33.0	2	2	2
PRT	sp|Q13283-2|G3BP1_HUMAN	Isoform 2 of Ras GTPase-activating protein-binding protein 1 OS=Homo sapiens OX=9606 GN=G3BP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	64-UNIMOD:188,73-UNIMOD:4,76-UNIMOD:188	0.11	33.0	3	1	0
PRT	sp|Q9P258|RCC2_HUMAN	Protein RCC2 OS=Homo sapiens OX=9606 GN=RCC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	2	1	0
PRT	sp|Q5T9A4-3|ATD3B_HUMAN	Isoform 3 of ATPase family AAA domain-containing protein 3B OS=Homo sapiens OX=9606 GN=ATAD3B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	446-UNIMOD:4	0.03	33.0	1	1	1
PRT	sp|P15170|ERF3A_HUMAN	Eukaryotic peptide chain release factor GTP-binding subunit ERF3A OS=Homo sapiens OX=9606 GN=GSPT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	381-UNIMOD:4,387-UNIMOD:4	0.05	33.0	1	1	1
PRT	sp|P30085-2|KCY_HUMAN	Isoform 2 of UMP-CMP kinase OS=Homo sapiens OX=9606 GN=CMPK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	2-UNIMOD:188,16-UNIMOD:188	0.12	33.0	2	1	0
PRT	sp|Q9NZW5|MPP6_HUMAN	MAGUK p55 subfamily member 6 OS=Homo sapiens OX=9606 GN=MPP6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	1	1	1
PRT	sp|Q8IX12-2|CCAR1_HUMAN	Isoform 2 of Cell division cycle and apoptosis regulator protein 1 OS=Homo sapiens OX=9606 GN=CCAR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.01	33.0	1	1	1
PRT	sp|P07814|SYEP_HUMAN	Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens OX=9606 GN=EPRS1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	660-UNIMOD:4,650-UNIMOD:188,662-UNIMOD:188,665-UNIMOD:188	0.01	33.0	3	2	1
PRT	sp|Q9NX63|MIC19_HUMAN	MICOS complex subunit MIC19 OS=Homo sapiens OX=9606 GN=CHCHD3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	183-UNIMOD:4	0.07	33.0	2	1	0
PRT	sp|Q8WVB6|CTF18_HUMAN	Chromosome transmission fidelity protein 18 homolog OS=Homo sapiens OX=9606 GN=CHTF18 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	1	1	1
PRT	sp|P07305-2|H10_HUMAN	Isoform 2 of Histone H1.0 OS=Homo sapiens OX=9606 GN=H1-0	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	42-UNIMOD:188,52-UNIMOD:188	0.08	33.0	3	1	0
PRT	sp|O75643|U520_HUMAN	U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens OX=9606 GN=SNRNP200 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.01	33.0	2	1	0
PRT	sp|Q5BJD5-3|TM41B_HUMAN	Isoform 3 of Transmembrane protein 41B OS=Homo sapiens OX=9606 GN=TMEM41B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	28-UNIMOD:267	0.16	33.0	4	1	0
PRT	sp|P51858-2|HDGF_HUMAN	Isoform 2 of Hepatoma-derived growth factor OS=Homo sapiens OX=9606 GN=HDGF	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	37-UNIMOD:188,54-UNIMOD:188	0.10	33.0	3	1	0
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null	494-UNIMOD:35,495-UNIMOD:267,22-UNIMOD:35,32-UNIMOD:188	0.03	33.0	8	2	0
PRT	sp|Q92900-2|RENT1_HUMAN	Isoform 2 of Regulator of nonsense transcripts 1 OS=Homo sapiens OX=9606 GN=UPF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	1	1	1
PRT	sp|P21281|VATB2_HUMAN	V-type proton ATPase subunit B, brain isoform OS=Homo sapiens OX=9606 GN=ATP6V1B2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	81-UNIMOD:188,82-UNIMOD:267	0.03	33.0	2	1	0
PRT	sp|Q9BQ52-2|RNZ2_HUMAN	Isoform 2 of Zinc phosphodiesterase ELAC protein 2 OS=Homo sapiens OX=9606 GN=ELAC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.05	33.0	1	1	1
PRT	sp|Q96A08|H2B1A_HUMAN	Histone H2B type 1-A OS=Homo sapiens OX=9606 GN=H2BC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	48-UNIMOD:188,59-UNIMOD:188	0.12	33.0	2	1	0
PRT	sp|Q15067|ACOX1_HUMAN	Peroxisomal acyl-coenzyme A oxidase 1 OS=Homo sapiens OX=9606 GN=ACOX1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null		0.03	33.0	1	1	1
PRT	sp|Q15555|MARE2_HUMAN	Microtubule-associated protein RP/EB family member 2 OS=Homo sapiens OX=9606 GN=MAPRE2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	279-UNIMOD:4	0.07	33.0	1	1	1
PRT	sp|Q9NSE4|SYIM_HUMAN	Isoleucine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=IARS2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null		0.02	33.0	1	1	1
PRT	sp|P12236|ADT3_HUMAN	ADP/ATP translocase 3 OS=Homo sapiens OX=9606 GN=SLC25A6 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	null	97-UNIMOD:28,105-UNIMOD:188,111-UNIMOD:267	0.05	33.0	2	1	0
PRT	sp|P48444|COPD_HUMAN	Coatomer subunit delta OS=Homo sapiens OX=9606 GN=ARCN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	142-UNIMOD:188,145-UNIMOD:267	0.03	33.0	3	1	0
PRT	sp|Q9H0C8|ILKAP_HUMAN	Integrin-linked kinase-associated serine/threonine phosphatase 2C OS=Homo sapiens OX=9606 GN=ILKAP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	190-UNIMOD:4	0.04	32.0	1	1	1
PRT	sp|P04181-2|OAT_HUMAN	Isoform 2 of Ornithine aminotransferase, mitochondrial OS=Homo sapiens OX=9606 GN=OAT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.05	32.0	1	1	1
PRT	sp|P55072|TERA_HUMAN	Transitional endoplasmic reticulum ATPase OS=Homo sapiens OX=9606 GN=VCP PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	377-UNIMOD:267,386-UNIMOD:188	0.03	32.0	2	1	0
PRT	sp|P30086|PEBP1_HUMAN	Phosphatidylethanolamine-binding protein 1 OS=Homo sapiens OX=9606 GN=PEBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.14	32.0	1	1	1
PRT	sp|Q9H6F5|CCD86_HUMAN	Coiled-coil domain-containing protein 86 OS=Homo sapiens OX=9606 GN=CCDC86 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.06	32.0	1	1	1
PRT	sp|P48643-2|TCPE_HUMAN	Isoform 2 of T-complex protein 1 subunit epsilon OS=Homo sapiens OX=9606 GN=CCT5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	139-UNIMOD:188,148-UNIMOD:188,146-UNIMOD:35,172-UNIMOD:188,182-UNIMOD:188	0.09	32.0	6	3	0
PRT	sp|P53992|SC24C_HUMAN	Protein transport protein Sec24C OS=Homo sapiens OX=9606 GN=SEC24C PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	809-UNIMOD:4,816-UNIMOD:4	0.02	32.0	1	1	1
PRT	sp|Q96EL3|RM53_HUMAN	39S ribosomal protein L53, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL53 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	63-UNIMOD:4,73-UNIMOD:267	0.16	32.0	3	1	0
PRT	sp|O76003|GLRX3_HUMAN	Glutaredoxin-3 OS=Homo sapiens OX=9606 GN=GLRX3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.07	32.0	1	1	1
PRT	sp|Q9HA64|KT3K_HUMAN	Ketosamine-3-kinase OS=Homo sapiens OX=9606 GN=FN3KRP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.05	32.0	2	1	0
PRT	sp|P37198|NUP62_HUMAN	Nuclear pore glycoprotein p62 OS=Homo sapiens OX=9606 GN=NUP62 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	447-UNIMOD:35,475-UNIMOD:4	0.06	32.0	1	1	1
PRT	sp|P52272-2|HNRPM_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein M OS=Homo sapiens OX=9606 GN=HNRNPM	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	418-UNIMOD:35,380-UNIMOD:35,390-UNIMOD:267	0.04	32.0	2	2	2
PRT	sp|P47813|IF1AX_HUMAN	Eukaryotic translation initiation factor 1A, X-chromosomal OS=Homo sapiens OX=9606 GN=EIF1AX PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	104-UNIMOD:188,114-UNIMOD:188	0.10	32.0	1	1	1
PRT	sp|P31483-3|TIA1_HUMAN	Isoform 3 of Nucleolysin TIA-1 isoform p40 OS=Homo sapiens OX=9606 GN=TIA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	123-UNIMOD:188	0.11	32.0	2	1	0
PRT	sp|Q9GZV4|IF5A2_HUMAN	Eukaryotic translation initiation factor 5A-2 OS=Homo sapiens OX=9606 GN=EIF5A2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	67-UNIMOD:188,73-UNIMOD:4	0.20	32.0	3	2	1
PRT	sp|Q15942|ZYX_HUMAN	Zyxin OS=Homo sapiens OX=9606 GN=ZYX PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|Q8IUH4|ZDH13_HUMAN	Palmitoyltransferase ZDHHC13 OS=Homo sapiens OX=9606 GN=ZDHHC13 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	28-UNIMOD:4	0.03	32.0	1	1	1
PRT	sp|P20042|IF2B_HUMAN	Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	281-UNIMOD:4,284-UNIMOD:4	0.04	32.0	2	1	0
PRT	sp|Q96PZ0|PUS7_HUMAN	Pseudouridylate synthase 7 homolog OS=Homo sapiens OX=9606 GN=PUS7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	144-UNIMOD:188,147-UNIMOD:267	0.02	32.0	2	1	0
PRT	sp|Q15149|PLEC_HUMAN	Plectin OS=Homo sapiens OX=9606 GN=PLEC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	32.0	null	954-UNIMOD:28,961-UNIMOD:188,965-UNIMOD:4,977-UNIMOD:188,2767-UNIMOD:267,2787-UNIMOD:267,1405-UNIMOD:4,1401-UNIMOD:188,1407-UNIMOD:267	0.01	32.0	6	3	1
PRT	sp|Q15233|NONO_HUMAN	Non-POU domain-containing octamer-binding protein OS=Homo sapiens OX=9606 GN=NONO PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	325-UNIMOD:267,336-UNIMOD:188	0.03	32.0	2	1	0
PRT	sp|Q9BXP5|SRRT_HUMAN	Serrate RNA effector molecule homolog OS=Homo sapiens OX=9606 GN=SRRT PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	664-UNIMOD:188,669-UNIMOD:188	0.02	32.0	1	1	1
PRT	sp|Q15369|ELOC_HUMAN	Elongin-C OS=Homo sapiens OX=9606 GN=ELOC PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null		0.13	32.0	1	1	1
PRT	sp|Q96EY7|PTCD3_HUMAN	Pentatricopeptide repeat domain-containing protein 3, mitochondrial OS=Homo sapiens OX=9606 GN=PTCD3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	551-UNIMOD:4	0.03	32.0	1	1	1
PRT	sp|P47756|CAPZB_HUMAN	F-actin-capping protein subunit beta OS=Homo sapiens OX=9606 GN=CAPZB PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	145-UNIMOD:188,147-UNIMOD:4,159-UNIMOD:188	0.06	32.0	1	1	0
PRT	sp|A1A5B4-3|ANO9_HUMAN	Isoform 3 of Anoctamin-9 OS=Homo sapiens OX=9606 GN=ANO9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	180-UNIMOD:267	0.11	32.0	1	1	1
PRT	sp|P17987|TCPA_HUMAN	T-complex protein 1 subunit alpha OS=Homo sapiens OX=9606 GN=TCP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	1	1	1
PRT	sp|Q9Y490|TLN1_HUMAN	Talin-1 OS=Homo sapiens OX=9606 GN=TLN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null	2161-UNIMOD:4,2154-UNIMOD:267,2168-UNIMOD:188,1171-UNIMOD:188,1184-UNIMOD:267	0.02	31.0	4	2	1
PRT	sp|Q9P2R3|ANFY1_HUMAN	Rabankyrin-5 OS=Homo sapiens OX=9606 GN=ANKFY1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|Q9BV19|CA050_HUMAN	Uncharacterized protein C1orf50 OS=Homo sapiens OX=9606 GN=C1orf50 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.12	31.0	1	1	1
PRT	sp|Q8NBF2-2|NHLC2_HUMAN	Isoform 2 of NHL repeat-containing protein 2 OS=Homo sapiens OX=9606 GN=NHLRC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.05	31.0	1	1	1
PRT	sp|Q9UHD1-2|CHRD1_HUMAN	Isoform 2 of Cysteine and histidine-rich domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CHORDC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	24-UNIMOD:4,38-UNIMOD:188	0.08	31.0	3	1	0
PRT	sp|Q13310-2|PABP4_HUMAN	Isoform 2 of Polyadenylate-binding protein 4 OS=Homo sapiens OX=9606 GN=PABPC4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	1	1	1
PRT	sp|P52701-4|MSH6_HUMAN	Isoform 4 of DNA mismatch repair protein Msh6 OS=Homo sapiens OX=9606 GN=MSH6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|Q99986|VRK1_HUMAN	Serine/threonine-protein kinase VRK1 OS=Homo sapiens OX=9606 GN=VRK1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.05	31.0	1	1	1
PRT	sp|Q9Y446|PKP3_HUMAN	Plakophilin-3 OS=Homo sapiens OX=9606 GN=PKP3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	703-UNIMOD:188,711-UNIMOD:188,640-UNIMOD:267,641-UNIMOD:267	0.05	31.0	3	2	1
PRT	sp|O15371-2|EIF3D_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit D OS=Homo sapiens OX=9606 GN=EIF3D	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	2	1	0
PRT	sp|P14618-3|KPYM_HUMAN	Isoform 3 of Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	1	1	0
PRT	sp|Q96D46|NMD3_HUMAN	60S ribosomal export protein NMD3 OS=Homo sapiens OX=9606 GN=NMD3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	189-UNIMOD:188,202-UNIMOD:188	0.03	31.0	2	1	0
PRT	sp|P37837|TALDO_HUMAN	Transaldolase OS=Homo sapiens OX=9606 GN=TALDO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	203-UNIMOD:188,204-UNIMOD:188	0.04	31.0	3	1	0
PRT	sp|Q9BPW8|NIPS1_HUMAN	Protein NipSnap homolog 1 OS=Homo sapiens OX=9606 GN=NIPSNAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.09	31.0	1	1	1
PRT	sp|P63151|2ABA_HUMAN	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform OS=Homo sapiens OX=9606 GN=PPP2R2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.05	31.0	1	1	1
PRT	sp|P32119|PRDX2_HUMAN	Peroxiredoxin-2 OS=Homo sapiens OX=9606 GN=PRDX2 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.10	31.0	2	1	0
PRT	sp|P29401|TKT_HUMAN	Transketolase OS=Homo sapiens OX=9606 GN=TKT PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	102-UNIMOD:188,114-UNIMOD:188	0.02	31.0	4	1	0
PRT	sp|Q6P1J9|CDC73_HUMAN	Parafibromin OS=Homo sapiens OX=9606 GN=CDC73 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	2	1	0
PRT	sp|O60271-5|JIP4_HUMAN	Isoform 5 of C-Jun-amino-terminal kinase-interacting protein 4 OS=Homo sapiens OX=9606 GN=SPAG9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	195-UNIMOD:267	0.02	31.0	1	1	1
PRT	sp|P05787|K2C8_HUMAN	Keratin, type II cytoskeletal 8 OS=Homo sapiens OX=9606 GN=KRT8 PE=1 SV=7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	264-UNIMOD:188	0.07	31.0	3	2	1
PRT	sp|Q14203-5|DCTN1_HUMAN	Isoform 5 of Dynactin subunit 1 OS=Homo sapiens OX=9606 GN=DCTN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.01	31.0	1	1	1
PRT	sp|Q14683|SMC1A_HUMAN	Structural maintenance of chromosomes protein 1A OS=Homo sapiens OX=9606 GN=SMC1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.01	31.0	1	1	1
PRT	sp|P46940|IQGA1_HUMAN	Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens OX=9606 GN=IQGAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	924-UNIMOD:188,935-UNIMOD:188	0.01	31.0	3	1	0
PRT	sp|P23246-2|SFPQ_HUMAN	Isoform Short of Splicing factor, proline- and glutamine-rich OS=Homo sapiens OX=9606 GN=SFPQ	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	549-UNIMOD:35	0.02	31.0	2	1	0
PRT	sp|Q8NFH5-2|NUP35_HUMAN	Isoform 2 of Nucleoporin NUP35 OS=Homo sapiens OX=9606 GN=NUP35	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	66-UNIMOD:188	0.06	31.0	1	1	1
PRT	sp|Q13085-3|ACACA_HUMAN	Isoform 3 of Acetyl-CoA carboxylase 1 OS=Homo sapiens OX=9606 GN=ACACA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.01	31.0	1	1	1
PRT	sp|P63244|RACK1_HUMAN	Receptor of activated protein C kinase 1 OS=Homo sapiens OX=9606 GN=RACK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	207-UNIMOD:4,212-UNIMOD:188	0.09	31.0	1	1	1
PRT	sp|Q52LJ0-1|FA98B_HUMAN	Isoform 1 of Protein FAM98B OS=Homo sapiens OX=9606 GN=FAM98B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.05	31.0	1	1	1
PRT	sp|Q9P2T1-3|GMPR2_HUMAN	Isoform 3 of GMP reductase 2 OS=Homo sapiens OX=9606 GN=GMPR2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.05	31.0	2	1	0
PRT	sp|Q3ZCQ8-3|TIM50_HUMAN	Isoform 3 of Mitochondrial import inner membrane translocase subunit TIM50 OS=Homo sapiens OX=9606 GN=TIMM50	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	199-UNIMOD:188,201-UNIMOD:267	0.08	31.0	2	1	0
PRT	sp|Q99880|H2B1L_HUMAN	Histone H2B type 1-L OS=Homo sapiens OX=9606 GN=H2BC13 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.12	31.0	2	1	0
PRT	sp|Q12800-4|TFCP2_HUMAN	Isoform 4 of Alpha-globin transcription factor CP2 OS=Homo sapiens OX=9606 GN=TFCP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	233-UNIMOD:4	0.05	31.0	1	1	1
PRT	sp|O75083-3|WDR1_HUMAN	Isoform 2 of WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=WDR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.05	31.0	1	1	1
PRT	sp|P45974-2|UBP5_HUMAN	Isoform Short of Ubiquitin carboxyl-terminal hydrolase 5 OS=Homo sapiens OX=9606 GN=USP5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	238-UNIMOD:267	0.02	31.0	2	1	0
PRT	sp|O43707|ACTN4_HUMAN	Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	31.0	null	522-UNIMOD:28,535-UNIMOD:188,536-UNIMOD:267	0.03	31.0	2	2	2
PRT	sp|P84077|ARF1_HUMAN	ADP-ribosylation factor 1 OS=Homo sapiens OX=9606 GN=ARF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	null	128-UNIMOD:28,142-UNIMOD:188,149-UNIMOD:267	0.13	31.0	2	1	0
PRT	sp|P40938|RFC3_HUMAN	Replication factor C subunit 3 OS=Homo sapiens OX=9606 GN=RFC3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	193-UNIMOD:4,200-UNIMOD:4	0.06	31.0	2	1	0
PRT	sp|Q6WCQ1|MPRIP_HUMAN	Myosin phosphatase Rho-interacting protein OS=Homo sapiens OX=9606 GN=MPRIP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.02	31.0	1	1	0
PRT	sp|O75884|RBBP9_HUMAN	Serine hydrolase RBBP9 OS=Homo sapiens OX=9606 GN=RBBP9 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	163-UNIMOD:4	0.11	31.0	2	1	0
PRT	sp|P38606-2|VATA_HUMAN	Isoform 2 of V-type proton ATPase catalytic subunit A OS=Homo sapiens OX=9606 GN=ATP6V1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	1	1	1
PRT	sp|P08237-2|PFKAM_HUMAN	Isoform 2 of ATP-dependent 6-phosphofructokinase, muscle type OS=Homo sapiens OX=9606 GN=PFKM	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	1	1	1
PRT	sp|Q9UNX3|RL26L_HUMAN	60S ribosomal protein L26-like 1 OS=Homo sapiens OX=9606 GN=RPL26L1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	103-UNIMOD:188	0.10	30.0	2	1	0
PRT	sp|Q68CZ2-4|TENS3_HUMAN	Isoform 4 of Tensin-3 OS=Homo sapiens OX=9606 GN=TNS3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	107-UNIMOD:4	0.08	30.0	1	1	1
PRT	sp|Q9NVA2|SEP11_HUMAN	Septin-11 OS=Homo sapiens OX=9606 GN=SEPTIN11 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	268-UNIMOD:4,286-UNIMOD:267,292-UNIMOD:267	0.08	30.0	2	2	2
PRT	sp|Q02878|RL6_HUMAN	60S ribosomal protein L6 OS=Homo sapiens OX=9606 GN=RPL6 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	192-UNIMOD:188,200-UNIMOD:188,156-UNIMOD:267	0.10	30.0	4	2	0
PRT	sp|O60763|USO1_HUMAN	General vesicular transport factor p115 OS=Homo sapiens OX=9606 GN=USO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	596-UNIMOD:188,615-UNIMOD:188	0.02	30.0	3	1	0
PRT	sp|P62906|RL10A_HUMAN	60S ribosomal protein L10a OS=Homo sapiens OX=9606 GN=RPL10A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	91-UNIMOD:188,92-UNIMOD:188	0.07	30.0	2	1	0
PRT	sp|Q9Y2W2|WBP11_HUMAN	WW domain-binding protein 11 OS=Homo sapiens OX=9606 GN=WBP11 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	192-UNIMOD:267	0.02	30.0	1	1	1
PRT	sp|O15269-2|SPTC1_HUMAN	Isoform 2 of Serine palmitoyltransferase 1 OS=Homo sapiens OX=9606 GN=SPTLC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	92-UNIMOD:188	0.13	30.0	3	1	0
PRT	sp|Q99729-3|ROAA_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein A/B OS=Homo sapiens OX=9606 GN=HNRNPAB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	224-UNIMOD:4	0.05	30.0	1	1	1
PRT	sp|Q08211|DHX9_HUMAN	ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	516-UNIMOD:267	0.01	30.0	4	1	0
PRT	sp|P07203|GPX1_HUMAN	Glutathione peroxidase 1 OS=Homo sapiens OX=9606 GN=GPX1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	78-UNIMOD:4,88-UNIMOD:188,97-UNIMOD:188	0.14	30.0	1	1	1
PRT	sp|Q9NYF8-3|BCLF1_HUMAN	Isoform 3 of Bcl-2-associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	686-UNIMOD:4,692-UNIMOD:267,697-UNIMOD:267	0.03	30.0	2	2	2
PRT	sp|Q15181|IPYR_HUMAN	Inorganic pyrophosphatase OS=Homo sapiens OX=9606 GN=PPA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	113-UNIMOD:4,114-UNIMOD:4,123-UNIMOD:4	0.14	30.0	3	1	0
PRT	sp|P00367-2|DHE3_HUMAN	Isoform 2 of Glutamate dehydrogenase 1, mitochondrial OS=Homo sapiens OX=9606 GN=GLUD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.04	30.0	1	1	1
PRT	sp|Q9Y4B6-3|DCAF1_HUMAN	Isoform 3 of DDB1- and CUL4-associated factor 1 OS=Homo sapiens OX=9606 GN=DCAF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	737-UNIMOD:188	0.01	30.0	2	1	0
PRT	sp|P17655-2|CAN2_HUMAN	Isoform 2 of Calpain-2 catalytic subunit OS=Homo sapiens OX=9606 GN=CAPN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	562-UNIMOD:4	0.06	30.0	2	2	2
PRT	sp|Q9NR30-2|DDX21_HUMAN	Isoform 2 of Nucleolar RNA helicase 2 OS=Homo sapiens OX=9606 GN=DDX21	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	295-UNIMOD:188,310-UNIMOD:4,319-UNIMOD:188	0.04	30.0	2	1	0
PRT	sp|Q99714-2|HCD2_HUMAN	Isoform 2 of 3-hydroxyacyl-CoA dehydrogenase type-2 OS=Homo sapiens OX=9606 GN=HSD17B10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.05	30.0	1	1	1
PRT	sp|Q9BZF1-3|OSBL8_HUMAN	Isoform 3 of Oxysterol-binding protein-related protein 8 OS=Homo sapiens OX=9606 GN=OSBPL8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	182-UNIMOD:188	0.02	30.0	2	1	0
PRT	sp|Q9P016-2|THYN1_HUMAN	Isoform 2 of Thymocyte nuclear protein 1 OS=Homo sapiens OX=9606 GN=THYN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	118-UNIMOD:4,119-UNIMOD:188,128-UNIMOD:188	0.14	30.0	1	1	0
PRT	sp|Q14974-2|IMB1_HUMAN	Isoform 2 of Importin subunit beta-1 OS=Homo sapiens OX=9606 GN=KPNB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	371-UNIMOD:267,380-UNIMOD:267	0.02	30.0	4	1	0
PRT	sp|P05387|RLA2_HUMAN	60S acidic ribosomal protein P2 OS=Homo sapiens OX=9606 GN=RPLP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	1-UNIMOD:35	0.19	30.0	1	1	1
PRT	sp|P43403|ZAP70_HUMAN	Tyrosine-protein kinase ZAP-70 OS=Homo sapiens OX=9606 GN=ZAP70 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	17-UNIMOD:267	0.03	30.0	1	1	1
PRT	sp|Q2VIR3-2|IF2GL_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 2 subunit 3B OS=Homo sapiens OX=9606 GN=EIF2S3B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	54-UNIMOD:188	0.04	30.0	2	1	0
PRT	sp|Q15029-2|U5S1_HUMAN	Isoform 2 of 116 kDa U5 small nuclear ribonucleoprotein component OS=Homo sapiens OX=9606 GN=EFTUD2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	109-UNIMOD:4,113-UNIMOD:4	0.02	30.0	1	1	1
PRT	sp|P11586|C1TC_HUMAN	C-1-tetrahydrofolate synthase, cytoplasmic OS=Homo sapiens OX=9606 GN=MTHFD1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	878-UNIMOD:188	0.01	30.0	2	1	0
PRT	sp|P40938-2|RFC3_HUMAN	Isoform 2 of Replication factor C subunit 3 OS=Homo sapiens OX=9606 GN=RFC3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	193-UNIMOD:4,200-UNIMOD:4,201-UNIMOD:188,202-UNIMOD:188	0.07	30.0	1	1	0
PRT	sp|Q13200-2|PSMD2_HUMAN	Isoform 2 of 26S proteasome non-ATPase regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PSMD2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	457-UNIMOD:4,464-UNIMOD:188	0.02	30.0	2	1	0
PRT	sp|P04075-2|ALDOA_HUMAN	Isoform 2 of Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	232-UNIMOD:4	0.07	30.0	2	1	0
PRT	sp|P16989|YBOX3_HUMAN	Y-box-binding protein 3 OS=Homo sapiens OX=9606 GN=YBX3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	268-UNIMOD:188,283-UNIMOD:267	0.07	30.0	1	1	1
PRT	sp|Q96T17|MA7D2_HUMAN	MAP7 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=MAP7D2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	700-UNIMOD:188,701-UNIMOD:267	0.02	30.0	1	1	1
PRT	sp|P49773|HINT1_HUMAN	Histidine triad nucleotide-binding protein 1 OS=Homo sapiens OX=9606 GN=HINT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	null	38-UNIMOD:385,38-UNIMOD:4,57-UNIMOD:188	0.17	30.0	2	1	0
PRT	sp|O43242-2|PSMD3_HUMAN	Isoform 2 of 26S proteasome non-ATPase regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PSMD3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.04	29.0	1	1	0
PRT	sp|P40227|TCPZ_HUMAN	T-complex protein 1 subunit zeta OS=Homo sapiens OX=9606 GN=CCT6A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null	79-UNIMOD:188	0.06	29.0	3	2	1
PRT	sp|P18583-2|SON_HUMAN	Isoform A of Protein SON OS=Homo sapiens OX=9606 GN=SON	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	2061-UNIMOD:4	0.01	29.0	1	1	1
PRT	sp|Q96FQ6|S10AG_HUMAN	Protein S100-A16 OS=Homo sapiens OX=9606 GN=S100A16 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.14	29.0	1	1	1
PRT	sp|P13667|PDIA4_HUMAN	Protein disulfide-isomerase A4 OS=Homo sapiens OX=9606 GN=PDIA4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|P55209-3|NP1L1_HUMAN	Isoform 3 of Nucleosome assembly protein 1-like 1 OS=Homo sapiens OX=9606 GN=NAP1L1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.04	29.0	1	1	1
PRT	sp|Q9UNZ2-6|NSF1C_HUMAN	Isoform 4 of NSFL1 cofactor p47 OS=Homo sapiens OX=9606 GN=NSFL1C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.05	29.0	1	1	1
PRT	sp|P46777|RL5_HUMAN	60S ribosomal protein L5 OS=Homo sapiens OX=9606 GN=RPL5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.10	29.0	2	2	2
PRT	sp|Q6P996-3|PDXD1_HUMAN	Isoform 3 of Pyridoxal-dependent decarboxylase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PDXDC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	697-UNIMOD:267	0.03	29.0	2	1	0
PRT	sp|Q14103-3|HNRPD_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein D0 OS=Homo sapiens OX=9606 GN=HNRNPD	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	251-UNIMOD:188,252-UNIMOD:4,255-UNIMOD:188	0.09	29.0	2	2	2
PRT	sp|Q86UP2-2|KTN1_HUMAN	Isoform 2 of Kinectin OS=Homo sapiens OX=9606 GN=KTN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	385-UNIMOD:188,393-UNIMOD:188	0.01	29.0	2	1	0
PRT	sp|P62750|RL23A_HUMAN	60S ribosomal protein L23a OS=Homo sapiens OX=9606 GN=RPL23A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	78-UNIMOD:188,88-UNIMOD:188	0.12	29.0	2	1	0
PRT	sp|Q16891-3|MIC60_HUMAN	Isoform 3 of MICOS complex subunit MIC60 OS=Homo sapiens OX=9606 GN=IMMT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	311-UNIMOD:188,312-UNIMOD:188	0.02	29.0	4	1	0
PRT	sp|O43432-4|IF4G3_HUMAN	Isoform 4 of Eukaryotic translation initiation factor 4 gamma 3 OS=Homo sapiens OX=9606 GN=EIF4G3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	648-UNIMOD:4,650-UNIMOD:4	0.01	29.0	2	1	0
PRT	sp|Q96L92-2|SNX27_HUMAN	Isoform 3 of Sorting nexin-27 OS=Homo sapiens OX=9606 GN=SNX27	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.04	29.0	1	1	0
PRT	sp|P50747|BPL1_HUMAN	Biotin--protein ligase OS=Homo sapiens OX=9606 GN=HLCS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|Q12768|WASC5_HUMAN	WASH complex subunit 5 OS=Homo sapiens OX=9606 GN=WASHC5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	230-UNIMOD:267,247-UNIMOD:267	0.02	29.0	1	1	1
PRT	sp|Q03252|LMNB2_HUMAN	Lamin-B2 OS=Homo sapiens OX=9606 GN=LMNB2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	1	1	1
PRT	sp|Q99497|PARK7_HUMAN	Protein/nucleic acid deglycase DJ-1 OS=Homo sapiens OX=9606 GN=PARK7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	133-UNIMOD:35	0.09	29.0	1	1	1
PRT	sp|P61313|RL15_HUMAN	60S ribosomal protein L15 OS=Homo sapiens OX=9606 GN=RPL15 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	153-UNIMOD:188,157-UNIMOD:188	0.07	29.0	2	1	0
PRT	sp|P42677|RS27_HUMAN	40S ribosomal protein S27 OS=Homo sapiens OX=9606 GN=RPS27 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.20	29.0	2	2	2
PRT	sp|Q15645-2|PCH2_HUMAN	Isoform 2 of Pachytene checkpoint protein 2 homolog OS=Homo sapiens OX=9606 GN=TRIP13	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	14-UNIMOD:4,28-UNIMOD:267	0.10	29.0	1	1	1
PRT	sp|O75534-2|CSDE1_HUMAN	Isoform 2 of Cold shock domain-containing protein E1 OS=Homo sapiens OX=9606 GN=CSDE1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|Q9NP92|RT30_HUMAN	39S ribosomal protein S30, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS30 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	292-UNIMOD:4,293-UNIMOD:4	0.04	29.0	1	1	1
PRT	sp|O00410-2|IPO5_HUMAN	Isoform 2 of Importin-5 OS=Homo sapiens OX=9606 GN=IPO5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	794-UNIMOD:188,796-UNIMOD:188	0.03	29.0	3	2	0
PRT	sp|P51991-2|ROA3_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens OX=9606 GN=HNRNPA3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	174-UNIMOD:4,177-UNIMOD:188	0.04	29.0	2	1	0
PRT	sp|P61764|STXB1_HUMAN	Syntaxin-binding protein 1 OS=Homo sapiens OX=9606 GN=STXBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	354-UNIMOD:4,356-UNIMOD:188	0.02	29.0	1	1	1
PRT	sp|P60709|ACTB_HUMAN	Actin, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=ACTB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	null	360-UNIMOD:28,372-UNIMOD:267,373-UNIMOD:188	0.04	29.0	1	1	0
PRT	sp|P22626|ROA2_HUMAN	Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	29.0	null	185-UNIMOD:267	0.07	29.0	3	2	1
PRT	sp|O00410|IPO5_HUMAN	Importin-5 OS=Homo sapiens OX=9606 GN=IPO5 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null		0.01	29.0	1	1	0
PRT	sp|Q9NTJ3|SMC4_HUMAN	Structural maintenance of chromosomes protein 4 OS=Homo sapiens OX=9606 GN=SMC4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null		0.01	29.0	1	1	0
PRT	sp|P51812|KS6A3_HUMAN	Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens OX=9606 GN=RPS6KA3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	29.0	null	538-UNIMOD:267	0.02	29.0	2	1	0
PRT	sp|O75533|SF3B1_HUMAN	Splicing factor 3B subunit 1 OS=Homo sapiens OX=9606 GN=SF3B1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	1030-UNIMOD:188,1035-UNIMOD:4,1041-UNIMOD:267	0.01	29.0	1	1	1
PRT	sp|Q15435|PP1R7_HUMAN	Protein phosphatase 1 regulatory subunit 7 OS=Homo sapiens OX=9606 GN=PPP1R7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null		0.06	29.0	1	1	1
PRT	sp|Q9UQ88|CD11A_HUMAN	Cyclin-dependent kinase 11A OS=Homo sapiens OX=9606 GN=CDK11A PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	707-UNIMOD:188,712-UNIMOD:267	0.02	29.0	2	1	0
PRT	sp|Q9BT78|CSN4_HUMAN	COP9 signalosome complex subunit 4 OS=Homo sapiens OX=9606 GN=COPS4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null		0.03	29.0	1	1	1
PRT	sp|Q16842|SIA4B_HUMAN	CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 OS=Homo sapiens OX=9606 GN=ST3GAL2 PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null		0.05	29.0	1	1	1
PRT	sp|O60506-2|HNRPQ_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein Q OS=Homo sapiens OX=9606 GN=SYNCRIP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	289-UNIMOD:4	0.03	29.0	1	1	1
PRT	sp|P00558-2|PGK1_HUMAN	Isoform 2 of Phosphoglycerate kinase 1 OS=Homo sapiens OX=9606 GN=PGK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	103-UNIMOD:188,105-UNIMOD:188	0.07	28.0	4	2	1
PRT	sp|P49411|EFTU_HUMAN	Elongation factor Tu, mitochondrial OS=Homo sapiens OX=9606 GN=TUFM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	104-UNIMOD:267,120-UNIMOD:267	0.04	28.0	1	1	1
PRT	sp|Q8TAT6|NPL4_HUMAN	Nuclear protein localization protein 4 homolog OS=Homo sapiens OX=9606 GN=NPLOC4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	28.0	null	138-UNIMOD:4,141-UNIMOD:4,138-UNIMOD:385	0.04	28.0	2	1	0
PRT	sp|Q13153|PAK1_HUMAN	Serine/threonine-protein kinase PAK 1 OS=Homo sapiens OX=9606 GN=PAK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	373-UNIMOD:4	0.03	28.0	1	1	1
PRT	sp|P43686|PRS6B_HUMAN	26S proteasome regulatory subunit 6B OS=Homo sapiens OX=9606 GN=PSMC4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|Q9NX58|LYAR_HUMAN	Cell growth-regulating nucleolar protein OS=Homo sapiens OX=9606 GN=LYAR PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|O95639-3|CPSF4_HUMAN	Isoform 3 of Cleavage and polyadenylation specificity factor subunit 4 OS=Homo sapiens OX=9606 GN=CPSF4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	105-UNIMOD:4,108-UNIMOD:188,110-UNIMOD:4,120-UNIMOD:188	0.08	28.0	2	1	0
PRT	sp|P18124|RL7_HUMAN	60S ribosomal protein L7 OS=Homo sapiens OX=9606 GN=RPL7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	202-UNIMOD:188,212-UNIMOD:188	0.05	28.0	2	1	0
PRT	sp|O95865|DDAH2_HUMAN	N(G),N(G)-dimethylarginine dimethylaminohydrolase 2 OS=Homo sapiens OX=9606 GN=DDAH2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.09	28.0	1	1	1
PRT	sp|P07355-2|ANXA2_HUMAN	Isoform 2 of Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	151-UNIMOD:4,153-UNIMOD:267,67-UNIMOD:188,81-UNIMOD:267	0.10	28.0	4	3	2
PRT	sp|P18887|XRCC1_HUMAN	DNA repair protein XRCC1 OS=Homo sapiens OX=9606 GN=XRCC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	559-UNIMOD:267	0.02	28.0	1	1	1
PRT	sp|Q9NVM4-4|ANM7_HUMAN	Isoform 4 of Protein arginine N-methyltransferase 7 OS=Homo sapiens OX=9606 GN=PRMT7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	171-UNIMOD:4	0.02	28.0	1	1	1
PRT	sp|Q09028-4|RBBP4_HUMAN	Isoform 4 of Histone-binding protein RBBP4 OS=Homo sapiens OX=9606 GN=RBBP4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	341-UNIMOD:188	0.07	28.0	4	1	0
PRT	sp|Q16555-2|DPYL2_HUMAN	Isoform 2 of Dihydropyrimidinase-related protein 2 OS=Homo sapiens OX=9606 GN=DPYSL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.05	28.0	2	1	0
PRT	sp|Q15257-4|PTPA_HUMAN	Isoform 4 of Serine/threonine-protein phosphatase 2A activator OS=Homo sapiens OX=9606 GN=PTPA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	28-UNIMOD:188,38-UNIMOD:188	0.04	28.0	2	1	0
PRT	sp|Q86TB9-2|PATL1_HUMAN	Isoform 2 of Protein PAT1 homolog 1 OS=Homo sapiens OX=9606 GN=PATL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	331-UNIMOD:188,341-UNIMOD:188	0.03	28.0	2	1	0
PRT	sp|Q9NTJ3-2|SMC4_HUMAN	Isoform 2 of Structural maintenance of chromosomes protein 4 OS=Homo sapiens OX=9606 GN=SMC4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	898-UNIMOD:188	0.01	28.0	1	1	0
PRT	sp|P62424|RL7A_HUMAN	60S ribosomal protein L7a OS=Homo sapiens OX=9606 GN=RPL7A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.06	28.0	2	1	0
PRT	sp|Q86TI2-4|DPP9_HUMAN	Isoform 3 of Dipeptidyl peptidase 9 OS=Homo sapiens OX=9606 GN=DPP9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|P23528|COF1_HUMAN	Cofilin-1 OS=Homo sapiens OX=9606 GN=CFL1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	139-UNIMOD:4,132-UNIMOD:188,144-UNIMOD:188	0.11	28.0	2	1	0
PRT	sp|Q01085|TIAR_HUMAN	Nucleolysin TIAR OS=Homo sapiens OX=9606 GN=TIAL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	40-UNIMOD:35,51-UNIMOD:4,59-UNIMOD:267	0.06	28.0	2	1	0
PRT	sp|O95793-2|STAU1_HUMAN	Isoform Short of Double-stranded RNA-binding protein Staufen homolog 1 OS=Homo sapiens OX=9606 GN=STAU1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	433-UNIMOD:188,442-UNIMOD:4,455-UNIMOD:188	0.05	28.0	1	1	1
PRT	sp|Q8N5K1|CISD2_HUMAN	CDGSH iron-sulfur domain-containing protein 2 OS=Homo sapiens OX=9606 GN=CISD2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	20-UNIMOD:267,32-UNIMOD:267	0.10	28.0	1	1	1
PRT	sp|Q8IWW6-3|RHG12_HUMAN	Isoform 3 of Rho GTPase-activating protein 12 OS=Homo sapiens OX=9606 GN=ARHGAP12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	190-UNIMOD:188	0.02	28.0	2	1	0
PRT	sp|Q96JH7|VCIP1_HUMAN	Deubiquitinating protein VCIP135 OS=Homo sapiens OX=9606 GN=VCPIP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|O43172-2|PRP4_HUMAN	Isoform 2 of U4/U6 small nuclear ribonucleoprotein Prp4 OS=Homo sapiens OX=9606 GN=PRPF4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	224-UNIMOD:4,236-UNIMOD:4	0.05	28.0	1	1	1
PRT	sp|P99999|CYC_HUMAN	Cytochrome c OS=Homo sapiens OX=9606 GN=CYCS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	39-UNIMOD:267	0.11	28.0	2	1	0
PRT	sp|Q16890-4|TPD53_HUMAN	Isoform 4 of Tumor protein D53 OS=Homo sapiens OX=9606 GN=TPD52L1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	80-UNIMOD:188	0.12	28.0	1	1	1
PRT	sp|P04632|CPNS1_HUMAN	Calpain small subunit 1 OS=Homo sapiens OX=9606 GN=CAPNS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.07	28.0	1	1	1
PRT	sp|O96008-2|TOM40_HUMAN	Isoform 2 of Mitochondrial import receptor subunit TOM40 homolog OS=Homo sapiens OX=9606 GN=TOMM40	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	74-UNIMOD:4,76-UNIMOD:4,86-UNIMOD:4	0.10	28.0	1	1	1
PRT	sp|Q13126-7|MTAP_HUMAN	Isoform 7 of S-methyl-5'-thioadenosine phosphorylase OS=Homo sapiens OX=9606 GN=MTAP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	131-UNIMOD:4	0.08	28.0	2	1	0
PRT	sp|Q9UBF2-2|COPG2_HUMAN	Isoform 2 of Coatomer subunit gamma-2 OS=Homo sapiens OX=9606 GN=COPG2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	325-UNIMOD:4	0.04	28.0	1	1	1
PRT	sp|P17931|LEG3_HUMAN	Galectin-3 OS=Homo sapiens OX=9606 GN=LGALS3 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	224-UNIMOD:267,130-UNIMOD:35	0.12	28.0	5	2	1
PRT	sp|Q5JTH9-2|RRP12_HUMAN	Isoform 2 of RRP12-like protein OS=Homo sapiens OX=9606 GN=RRP12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	699-UNIMOD:4,718-UNIMOD:188,719-UNIMOD:188	0.02	28.0	2	1	0
PRT	sp|P22234|PUR6_HUMAN	Multifunctional protein ADE2 OS=Homo sapiens OX=9606 GN=PAICS PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|Q6UX04-2|CWC27_HUMAN	Isoform 2 of Spliceosome-associated protein CWC27 homolog OS=Homo sapiens OX=9606 GN=CWC27	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.13	28.0	2	2	2
PRT	sp|O14979-3|HNRDL_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein D-like OS=Homo sapiens OX=9606 GN=HNRNPDL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	184-UNIMOD:4,183-UNIMOD:188,187-UNIMOD:188	0.05	28.0	3	1	0
PRT	sp|Q9NQT5-2|EXOS3_HUMAN	Isoform 2 of Exosome complex component RRP40 OS=Homo sapiens OX=9606 GN=EXOSC3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.10	28.0	1	1	1
PRT	sp|Q13813|SPTN1_HUMAN	Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	1066-UNIMOD:35	0.01	28.0	1	1	0
PRT	sp|P48643|TCPE_HUMAN	T-complex protein 1 subunit epsilon OS=Homo sapiens OX=9606 GN=CCT5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	28.0	null	503-UNIMOD:28,513-UNIMOD:188,514-UNIMOD:188,265-UNIMOD:188,275-UNIMOD:188	0.05	28.0	3	2	0
PRT	sp|P08727|K1C19_HUMAN	Keratin, type I cytoskeletal 19 OS=Homo sapiens OX=9606 GN=KRT19 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	216-UNIMOD:188,226-UNIMOD:267	0.11	28.0	5	3	1
PRT	sp|P35221|CTNA1_HUMAN	Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	438-UNIMOD:4	0.03	28.0	1	1	0
PRT	sp|Q9H4L5|OSBL3_HUMAN	Oxysterol-binding protein-related protein 3 OS=Homo sapiens OX=9606 GN=OSBPL3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	853-UNIMOD:267	0.01	28.0	1	1	1
PRT	sp|Q96CS3|FAF2_HUMAN	FAS-associated factor 2 OS=Homo sapiens OX=9606 GN=FAF2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	167-UNIMOD:188,168-UNIMOD:267	0.04	27.0	1	1	1
PRT	sp|O95347-2|SMC2_HUMAN	Isoform 2 of Structural maintenance of chromosomes protein 2 OS=Homo sapiens OX=9606 GN=SMC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	900-UNIMOD:188,909-UNIMOD:188	0.02	27.0	2	2	2
PRT	sp|O94804|STK10_HUMAN	Serine/threonine-protein kinase 10 OS=Homo sapiens OX=9606 GN=STK10 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	739-UNIMOD:267,754-UNIMOD:267	0.02	27.0	1	1	1
PRT	sp|P30050-2|RL12_HUMAN	Isoform 2 of 60S ribosomal protein L12 OS=Homo sapiens OX=9606 GN=RPL12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	108-UNIMOD:4,113-UNIMOD:267,129-UNIMOD:4	0.27	27.0	1	1	1
PRT	sp|Q9Y2X3|NOP58_HUMAN	Nucleolar protein 58 OS=Homo sapiens OX=9606 GN=NOP58 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	106-UNIMOD:4	0.04	27.0	1	1	1
PRT	sp|Q7L2H7-2|EIF3M_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit M OS=Homo sapiens OX=9606 GN=EIF3M	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	128-UNIMOD:188,144-UNIMOD:188	0.10	27.0	1	1	1
PRT	sp|Q9BRK5-4|CAB45_HUMAN	Isoform 4 of 45 kDa calcium-binding protein OS=Homo sapiens OX=9606 GN=SDF4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.06	27.0	1	1	1
PRT	sp|P57772-2|SELB_HUMAN	Isoform 2 of Selenocysteine-specific elongation factor OS=Homo sapiens OX=9606 GN=EEFSEC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	277-UNIMOD:4	0.04	27.0	1	1	1
PRT	sp|P78527-2|PRKDC_HUMAN	Isoform 2 of DNA-dependent protein kinase catalytic subunit OS=Homo sapiens OX=9606 GN=PRKDC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	700-UNIMOD:188,703-UNIMOD:4,709-UNIMOD:188,1886-UNIMOD:188,1892-UNIMOD:188	0.01	27.0	3	2	1
PRT	sp|P46977-2|STT3A_HUMAN	Isoform 2 of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A OS=Homo sapiens OX=9606 GN=STT3A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	518-UNIMOD:188,521-UNIMOD:188	0.02	27.0	1	1	1
PRT	sp|O60884|DNJA2_HUMAN	DnaJ homolog subfamily A member 2 OS=Homo sapiens OX=9606 GN=DNAJA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|Q96EY1-3|DNJA3_HUMAN	Isoform 3 of DnaJ homolog subfamily A member 3, mitochondrial OS=Homo sapiens OX=9606 GN=DNAJA3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.05	27.0	1	1	1
PRT	sp|P23526-2|SAHH_HUMAN	Isoform 2 of Adenosylhomocysteinase OS=Homo sapiens OX=9606 GN=AHCY	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	361-UNIMOD:188,373-UNIMOD:188	0.03	27.0	1	1	1
PRT	sp|P23396|RS3_HUMAN	40S ribosomal protein S3 OS=Homo sapiens OX=9606 GN=RPS3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	202-UNIMOD:188,214-UNIMOD:188	0.06	27.0	2	1	0
PRT	sp|Q96AE4|FUBP1_HUMAN	Far upstream element-binding protein 1 OS=Homo sapiens OX=9606 GN=FUBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.04	27.0	1	1	1
PRT	sp|Q9Y697-2|NFS1_HUMAN	Isoform Cytoplasmic of Cysteine desulfurase, mitochondrial OS=Homo sapiens OX=9606 GN=NFS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	166-UNIMOD:188,179-UNIMOD:188	0.04	27.0	1	1	1
PRT	sp|Q9BRP1|PDD2L_HUMAN	Programmed cell death protein 2-like OS=Homo sapiens OX=9606 GN=PDCD2L PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	46-UNIMOD:267,49-UNIMOD:4,51-UNIMOD:267	0.06	27.0	1	1	1
PRT	sp|Q9Y696|CLIC4_HUMAN	Chloride intracellular channel protein 4 OS=Homo sapiens OX=9606 GN=CLIC4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	110-UNIMOD:188,124-UNIMOD:188	0.08	27.0	2	1	0
PRT	sp|Q13442|HAP28_HUMAN	28 kDa heat- and acid-stable phosphoprotein OS=Homo sapiens OX=9606 GN=PDAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	132-UNIMOD:188,137-UNIMOD:188	0.07	27.0	1	1	1
PRT	sp|Q92499-3|DDX1_HUMAN	Isoform 3 of ATP-dependent RNA helicase DDX1 OS=Homo sapiens OX=9606 GN=DDX1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	259-UNIMOD:35	0.02	27.0	2	1	0
PRT	sp|Q29RF7|PDS5A_HUMAN	Sister chromatid cohesion protein PDS5 homolog A OS=Homo sapiens OX=9606 GN=PDS5A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|P04637-8|P53_HUMAN	Isoform 8 of Cellular tumor antigen p53 OS=Homo sapiens OX=9606 GN=TP53	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	117-UNIMOD:267,135-UNIMOD:267	0.10	27.0	1	1	1
PRT	sp|P82909|RT36_HUMAN	28S ribosomal protein S36, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS36 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	57-UNIMOD:188	0.17	27.0	2	1	0
PRT	sp|P07311|ACYP1_HUMAN	Acylphosphatase-1 OS=Homo sapiens OX=9606 GN=ACYP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.13	27.0	1	1	1
PRT	sp|P50226|ST1A2_HUMAN	Sulfotransferase 1A2 OS=Homo sapiens OX=9606 GN=SULT1A2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	122-UNIMOD:188	0.06	27.0	2	1	0
PRT	sp|P09327|VILI_HUMAN	Villin-1 OS=Homo sapiens OX=9606 GN=VIL1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|Q92614-5|MY18A_HUMAN	Isoform 5 of Unconventional myosin-XVIIIa OS=Homo sapiens OX=9606 GN=MYO18A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|P0DJD0|RGPD1_HUMAN	RANBP2-like and GRIP domain-containing protein 1 OS=Homo sapiens OX=9606 GN=RGPD1 PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	1093-UNIMOD:4	0.01	27.0	2	1	0
PRT	sp|Q8N543-2|OGFD1_HUMAN	Isoform 2 of Prolyl 3-hydroxylase OGFOD1 OS=Homo sapiens OX=9606 GN=OGFOD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	168-UNIMOD:4	0.04	27.0	1	1	1
PRT	sp|Q92922|SMRC1_HUMAN	SWI/SNF complex subunit SMARCC1 OS=Homo sapiens OX=9606 GN=SMARCC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	2	1	0
PRT	sp|P63167|DYL1_HUMAN	Dynein light chain 1, cytoplasmic OS=Homo sapiens OX=9606 GN=DYNLL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	36-UNIMOD:188,43-UNIMOD:188	0.15	27.0	1	1	1
PRT	sp|P09651|ROA1_HUMAN	Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	null	93-UNIMOD:27	0.04	27.0	1	1	1
PRT	sp|P14618|KPYM_HUMAN	Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	270-UNIMOD:188,278-UNIMOD:267	0.02	27.0	2	1	0
PRT	sp|P29144|TPP2_HUMAN	Tripeptidyl-peptidase 2 OS=Homo sapiens OX=9606 GN=TPP2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	197-UNIMOD:4	0.02	27.0	1	1	1
PRT	sp|P43487|RANG_HUMAN	Ran-specific GTPase-activating protein OS=Homo sapiens OX=9606 GN=RANBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	99-UNIMOD:4,107-UNIMOD:35	0.11	27.0	1	1	0
PRT	sp|Q2VIR3|IF2GL_HUMAN	Eukaryotic translation initiation factor 2 subunit 3B OS=Homo sapiens OX=9606 GN=EIF2S3B PE=2 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	null	39-UNIMOD:28,54-UNIMOD:188	0.04	27.0	1	1	0
PRT	sp|P49721|PSB2_HUMAN	Proteasome subunit beta type-2 OS=Homo sapiens OX=9606 GN=PSMB2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	185-UNIMOD:188,198-UNIMOD:188	0.09	27.0	1	1	1
PRT	sp|Q9NR09|BIRC6_HUMAN	Baculoviral IAP repeat-containing protein 6 OS=Homo sapiens OX=9606 GN=BIRC6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	2892-UNIMOD:4,2902-UNIMOD:267,2907-UNIMOD:188	0.00	27.0	1	1	1
PRT	sp|Q15102|PA1B3_HUMAN	Platelet-activating factor acetylhydrolase IB subunit gamma OS=Homo sapiens OX=9606 GN=PAFAH1B3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	93-UNIMOD:267,95-UNIMOD:188	0.06	27.0	2	1	0
PRT	sp|Q13885|TBB2A_HUMAN	Tubulin beta-2A chain OS=Homo sapiens OX=9606 GN=TUBB2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	1-UNIMOD:35,12-UNIMOD:4,86-UNIMOD:267,103-UNIMOD:188	0.11	27.0	2	2	1
PRT	sp|O00161-2|SNP23_HUMAN	Isoform SNAP-23b of Synaptosomal-associated protein 23 OS=Homo sapiens OX=9606 GN=SNAP23	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.09	26.0	1	1	0
PRT	sp|O94776-2|MTA2_HUMAN	Isoform 2 of Metastasis-associated protein MTA2 OS=Homo sapiens OX=9606 GN=MTA2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	36-UNIMOD:4	0.05	26.0	1	1	1
PRT	sp|Q9UBW8|CSN7A_HUMAN	COP9 signalosome complex subunit 7a OS=Homo sapiens OX=9606 GN=COPS7A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.05	26.0	1	1	1
PRT	sp|Q13825-2|AUHM_HUMAN	Isoform 2 of Methylglutaconyl-CoA hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=AUH	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.07	26.0	1	1	0
PRT	sp|Q08J23-2|NSUN2_HUMAN	Isoform 2 of RNA cytosine C(5)-methyltransferase NSUN2 OS=Homo sapiens OX=9606 GN=NSUN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	46-UNIMOD:188,56-UNIMOD:188	0.02	26.0	1	1	1
PRT	sp|O75369-6|FLNB_HUMAN	Isoform 6 of Filamin-B OS=Homo sapiens OX=9606 GN=FLNB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	1955-UNIMOD:188,1956-UNIMOD:188,1945-UNIMOD:267	0.01	26.0	3	2	1
PRT	sp|Q9HAV7|GRPE1_HUMAN	GrpE protein homolog 1, mitochondrial OS=Homo sapiens OX=9606 GN=GRPEL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.08	26.0	1	1	1
PRT	sp|Q96FW1|OTUB1_HUMAN	Ubiquitin thioesterase OTUB1 OS=Homo sapiens OX=9606 GN=OTUB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	198-UNIMOD:267	0.04	26.0	2	1	0
PRT	sp|Q16513-4|PKN2_HUMAN	Isoform 4 of Serine/threonine-protein kinase N2 OS=Homo sapiens OX=9606 GN=PKN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	293-UNIMOD:267,302-UNIMOD:267	0.02	26.0	2	1	0
PRT	sp|P49257|LMAN1_HUMAN	Protein ERGIC-53 OS=Homo sapiens OX=9606 GN=LMAN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.05	26.0	1	1	1
PRT	sp|P49368-2|TCPG_HUMAN	Isoform 2 of T-complex protein 1 subunit gamma OS=Homo sapiens OX=9606 GN=CCT3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|O75122-2|CLAP2_HUMAN	Isoform 2 of CLIP-associating protein 2 OS=Homo sapiens OX=9606 GN=CLASP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|O43504|LTOR5_HUMAN	Ragulator complex protein LAMTOR5 OS=Homo sapiens OX=9606 GN=LAMTOR5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	88-UNIMOD:188	0.12	26.0	1	1	1
PRT	sp|Q9NUQ3-2|TXLNG_HUMAN	Isoform 2 of Gamma-taxilin OS=Homo sapiens OX=9606 GN=TXLNG	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	165-UNIMOD:188,175-UNIMOD:188	0.03	26.0	1	1	1
PRT	sp|P06493-2|CDK1_HUMAN	Isoform 2 of Cyclin-dependent kinase 1 OS=Homo sapiens OX=9606 GN=CDK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.05	26.0	1	1	1
PRT	sp|Q7Z417-2|NUFP2_HUMAN	Isoform 2 of Nuclear fragile X mental retardation-interacting protein 2 OS=Homo sapiens OX=9606 GN=NUFIP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.10	26.0	1	1	1
PRT	sp|Q86VP6|CAND1_HUMAN	Cullin-associated NEDD8-dissociated protein 1 OS=Homo sapiens OX=9606 GN=CAND1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|Q9H993|ARMT1_HUMAN	Damage-control phosphatase ARMT1 OS=Homo sapiens OX=9606 GN=ARMT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	141-UNIMOD:188,144-UNIMOD:188	0.05	26.0	1	1	1
PRT	sp|Q9Y3P9|RBGP1_HUMAN	Rab GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RABGAP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q9UQ88-8|CD11A_HUMAN	Isoform SV12 of Cyclin-dependent kinase 11A OS=Homo sapiens OX=9606 GN=CDK11A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.08	26.0	1	1	0
PRT	sp|P19174-2|PLCG1_HUMAN	Isoform 2 of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 OS=Homo sapiens OX=9606 GN=PLCG1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|O00264|PGRC1_HUMAN	Membrane-associated progesterone receptor component 1 OS=Homo sapiens OX=9606 GN=PGRMC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.08	26.0	1	1	1
PRT	sp|Q13907|IDI1_HUMAN	Isopentenyl-diphosphate Delta-isomerase 1 OS=Homo sapiens OX=9606 GN=IDI1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	39-UNIMOD:4	0.05	26.0	1	1	1
PRT	sp|P56937-3|DHB7_HUMAN	Isoform 3 of 3-keto-steroid reductase OS=Homo sapiens OX=9606 GN=HSD17B7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.05	26.0	1	1	1
PRT	sp|Q9H788-2|SH24A_HUMAN	Isoform 2 of SH2 domain-containing protein 4A OS=Homo sapiens OX=9606 GN=SH2D4A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	70-UNIMOD:188,81-UNIMOD:188	0.03	26.0	1	1	1
PRT	sp|P13010|XRCC5_HUMAN	X-ray repair cross-complementing protein 5 OS=Homo sapiens OX=9606 GN=XRCC5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	195-UNIMOD:188	0.02	26.0	1	1	1
PRT	sp|Q07065|CKAP4_HUMAN	Cytoskeleton-associated protein 4 OS=Homo sapiens OX=9606 GN=CKAP4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|Q10713|MPPA_HUMAN	Mitochondrial-processing peptidase subunit alpha OS=Homo sapiens OX=9606 GN=PMPCA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	251-UNIMOD:35,266-UNIMOD:4,268-UNIMOD:267	0.04	26.0	1	1	1
PRT	sp|P20020-5|AT2B1_HUMAN	Isoform E of Plasma membrane calcium-transporting ATPase 1 OS=Homo sapiens OX=9606 GN=ATP2B1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|P07195|LDHB_HUMAN	L-lactate dehydrogenase B chain OS=Homo sapiens OX=9606 GN=LDHB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	119-UNIMOD:188,127-UNIMOD:188	0.04	26.0	1	1	1
PRT	sp|P61106|RAB14_HUMAN	Ras-related protein Rab-14 OS=Homo sapiens OX=9606 GN=RAB14 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	26-UNIMOD:4,34-UNIMOD:188,35-UNIMOD:188	0.06	26.0	2	1	0
PRT	sp|Q02252-2|MMSA_HUMAN	Isoform 2 of Methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial OS=Homo sapiens OX=9606 GN=ALDH6A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.04	26.0	1	1	1
PRT	sp|Q6PKG0-3|LARP1_HUMAN	Isoform 2 of La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|Q6NXT1|ANR54_HUMAN	Ankyrin repeat domain-containing protein 54 OS=Homo sapiens OX=9606 GN=ANKRD54 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	152-UNIMOD:4,172-UNIMOD:267	0.10	26.0	1	1	1
PRT	sp|Q9Y2B0|CNPY2_HUMAN	Protein canopy homolog 2 OS=Homo sapiens OX=9606 GN=CNPY2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	171-UNIMOD:4	0.09	26.0	1	1	1
PRT	sp|Q14684-2|RRP1B_HUMAN	Isoform 2 of Ribosomal RNA processing protein 1 homolog B OS=Homo sapiens OX=9606 GN=RRP1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|P13804-2|ETFA_HUMAN	Isoform 2 of Electron transfer flavoprotein subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=ETFA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	36-UNIMOD:188,52-UNIMOD:188	0.10	26.0	1	1	1
PRT	sp|A6NDY0-2|EPAB2_HUMAN	Isoform 2 of Embryonic polyadenylate-binding protein 2 OS=Homo sapiens OX=9606 GN=PABPN1L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	180-UNIMOD:4,182-UNIMOD:188,188-UNIMOD:188	0.05	26.0	2	1	0
PRT	sp|P60891-2|PRPS1_HUMAN	Isoform 2 of Ribose-phosphate pyrophosphokinase 1 OS=Homo sapiens OX=9606 GN=PRPS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.07	26.0	1	1	1
PRT	sp|Q5T8P6|RBM26_HUMAN	RNA-binding protein 26 OS=Homo sapiens OX=9606 GN=RBM26 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.01	26.0	1	1	0
PRT	sp|Q9H089|LSG1_HUMAN	Large subunit GTPase 1 homolog OS=Homo sapiens OX=9606 GN=LSG1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	null	587-UNIMOD:28	0.03	26.0	1	1	1
PRT	sp|Q13825|AUHM_HUMAN	Methylglutaconyl-CoA hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=AUH PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	269-UNIMOD:267,270-UNIMOD:188	0.06	26.0	1	1	0
PRT	sp|Q6UXN9|WDR82_HUMAN	WD repeat-containing protein 82 OS=Homo sapiens OX=9606 GN=WDR82 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	287-UNIMOD:4	0.07	26.0	1	1	1
PRT	sp|Q15233-2|NONO_HUMAN	Isoform 2 of Non-POU domain-containing octamer-binding protein OS=Homo sapiens OX=9606 GN=NONO	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|P02794|FRIH_HUMAN	Ferritin heavy chain OS=Homo sapiens OX=9606 GN=FTH1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.08	25.0	1	1	1
PRT	sp|Q8WUF5|IASPP_HUMAN	RelA-associated inhibitor OS=Homo sapiens OX=9606 GN=PPP1R13L PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	205-UNIMOD:267,235-UNIMOD:267	0.04	25.0	1	1	1
PRT	sp|P30711|GSTT1_HUMAN	Glutathione S-transferase theta-1 OS=Homo sapiens OX=9606 GN=GSTT1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.07	25.0	1	1	1
PRT	sp|Q9P0J1|PDP1_HUMAN	[Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Homo sapiens OX=9606 GN=PDP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	499-UNIMOD:267	0.03	25.0	1	1	1
PRT	sp|Q56VL3|OCAD2_HUMAN	OCIA domain-containing protein 2 OS=Homo sapiens OX=9606 GN=OCIAD2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	130-UNIMOD:4,134-UNIMOD:4,137-UNIMOD:4,138-UNIMOD:188,140-UNIMOD:188	0.08	25.0	2	1	0
PRT	sp|Q9NWM0-2|SMOX_HUMAN	Isoform 2 of Spermine oxidase OS=Homo sapiens OX=9606 GN=SMOX	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.04	25.0	1	1	1
PRT	sp|O14562|UBFD1_HUMAN	Ubiquitin domain-containing protein UBFD1 OS=Homo sapiens OX=9606 GN=UBFD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	100-UNIMOD:188,111-UNIMOD:188	0.05	25.0	1	1	1
PRT	sp|P35573-2|GDE_HUMAN	Isoform 5 of Glycogen debranching enzyme OS=Homo sapiens OX=9606 GN=AGL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|Q92878-3|RAD50_HUMAN	Isoform 3 of DNA repair protein RAD50 OS=Homo sapiens OX=9606 GN=RAD50	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|Q6WCQ1-3|MPRIP_HUMAN	Isoform 3 of Myosin phosphatase Rho-interacting protein OS=Homo sapiens OX=9606 GN=MPRIP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	460-UNIMOD:188	0.02	25.0	1	1	0
PRT	sp|Q86WG5-3|MTMRD_HUMAN	Isoform 3 of Myotubularin-related protein 13 OS=Homo sapiens OX=9606 GN=SBF2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	886-UNIMOD:4	0.02	25.0	1	1	1
PRT	sp|Q9BUJ2-3|HNRL1_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 OS=Homo sapiens OX=9606 GN=HNRNPUL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	246-UNIMOD:188,261-UNIMOD:188	0.03	25.0	1	1	1
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	268-UNIMOD:267	0.03	25.0	1	1	1
PRT	sp|Q13576|IQGA2_HUMAN	Ras GTPase-activating-like protein IQGAP2 OS=Homo sapiens OX=9606 GN=IQGAP2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	684-UNIMOD:188,696-UNIMOD:188	0.01	25.0	1	1	1
PRT	sp|Q9UBS4|DJB11_HUMAN	DnaJ homolog subfamily B member 11 OS=Homo sapiens OX=9606 GN=DNAJB11 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.06	25.0	1	1	1
PRT	sp|Q5JNZ5|RS26L_HUMAN	Putative 40S ribosomal protein S26-like 1 OS=Homo sapiens OX=9606 GN=RPS26P11 PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	74-UNIMOD:4,77-UNIMOD:4,82-UNIMOD:188	0.11	25.0	1	1	1
PRT	sp|Q14739|LBR_HUMAN	Delta(14)-sterol reductase LBR OS=Homo sapiens OX=9606 GN=LBR PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|P07384|CAN1_HUMAN	Calpain-1 catalytic subunit OS=Homo sapiens OX=9606 GN=CAPN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q15642-5|CIP4_HUMAN	Isoform 5 of Cdc42-interacting protein 4 OS=Homo sapiens OX=9606 GN=TRIP10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	273-UNIMOD:188	0.04	25.0	1	1	1
PRT	sp|Q9UNE7-2|CHIP_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase CHIP OS=Homo sapiens OX=9606 GN=STUB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	122-UNIMOD:267	0.06	25.0	1	1	1
PRT	sp|Q8WUJ3-2|CEMIP_HUMAN	Isoform 2 of Cell migration-inducing and hyaluronan-binding protein OS=Homo sapiens OX=9606 GN=CEMIP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q5XXA6|ANO1_HUMAN	Anoctamin-1 OS=Homo sapiens OX=9606 GN=ANO1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	96-UNIMOD:188,104-UNIMOD:188	0.01	25.0	1	1	1
PRT	sp|O95782-2|AP2A1_HUMAN	Isoform B of AP-2 complex subunit alpha-1 OS=Homo sapiens OX=9606 GN=AP2A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|P68036-2|UB2L3_HUMAN	Isoform 2 of Ubiquitin-conjugating enzyme E2 L3 OS=Homo sapiens OX=9606 GN=UBE2L3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.10	25.0	1	1	1
PRT	sp|Q9BYT8|NEUL_HUMAN	Neurolysin, mitochondrial OS=Homo sapiens OX=9606 GN=NLN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|P19338|NUCL_HUMAN	Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q99613-2|EIF3C_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit C OS=Homo sapiens OX=9606 GN=EIF3C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|P49589|SYCC_HUMAN	Cysteine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=CARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	280-UNIMOD:188,285-UNIMOD:188	0.02	25.0	1	1	0
PRT	sp|O43242|PSMD3_HUMAN	26S proteasome non-ATPase regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PSMD3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.03	25.0	1	1	0
PRT	sp|Q9NQC3|RTN4_HUMAN	Reticulon-4 OS=Homo sapiens OX=9606 GN=RTN4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.03	25.0	1	1	0
PRT	sp|P13647|K2C5_HUMAN	Keratin, type II cytoskeletal 5 OS=Homo sapiens OX=9606 GN=KRT5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	383-UNIMOD:188,389-UNIMOD:35,391-UNIMOD:267	0.02	25.0	3	1	0
PRT	sp|Q15185|TEBP_HUMAN	Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	58-UNIMOD:4	0.11	25.0	1	1	0
PRT	sp|O00161|SNP23_HUMAN	Synaptosomal-associated protein 23 OS=Homo sapiens OX=9606 GN=SNAP23 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	25-UNIMOD:267,26-UNIMOD:267	0.07	25.0	1	1	0
PRT	sp|A2RUQ5|CQ102_HUMAN	Uncharacterized protein C17orf102 OS=Homo sapiens OX=9606 GN=C17orf102 PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	21-UNIMOD:4,24-UNIMOD:267	0.11	25.0	1	1	1
PRT	sp|Q9Y5X1|SNX9_HUMAN	Sorting nexin-9 OS=Homo sapiens OX=9606 GN=SNX9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	414-UNIMOD:188,425-UNIMOD:188	0.03	24.0	1	1	1
PRT	sp|O14980|XPO1_HUMAN	Exportin-1 OS=Homo sapiens OX=9606 GN=XPO1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|P62633-7|CNBP_HUMAN	Isoform 7 of Cellular nucleic acid-binding protein OS=Homo sapiens OX=9606 GN=CNBP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	94-UNIMOD:4,102-UNIMOD:4,105-UNIMOD:4	0.14	24.0	1	1	1
PRT	sp|O14828|SCAM3_HUMAN	Secretory carrier-associated membrane protein 3 OS=Homo sapiens OX=9606 GN=SCAMP3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.08	24.0	1	1	1
PRT	sp|Q86XP3-2|DDX42_HUMAN	Isoform 2 of ATP-dependent RNA helicase DDX42 OS=Homo sapiens OX=9606 GN=DDX42	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	220-UNIMOD:4,227-UNIMOD:4	0.02	24.0	1	1	1
PRT	sp|Q8N6R0-2|EFNMT_HUMAN	Isoform 5 of eEF1A lysine and N-terminal methyltransferase OS=Homo sapiens OX=9606 GN=EEF1AKNMT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	140-UNIMOD:4	0.05	24.0	1	1	1
PRT	sp|P12429|ANXA3_HUMAN	Annexin A3 OS=Homo sapiens OX=9606 GN=ANXA3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.05	24.0	1	1	1
PRT	sp|Q14160-2|SCRIB_HUMAN	Isoform 2 of Protein scribble homolog OS=Homo sapiens OX=9606 GN=SCRIB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|P11388|TOP2A_HUMAN	DNA topoisomerase 2-alpha OS=Homo sapiens OX=9606 GN=TOP2A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	131-UNIMOD:188,134-UNIMOD:188	0.01	24.0	1	1	1
PRT	sp|P31689-2|DNJA1_HUMAN	Isoform 2 of DnaJ homolog subfamily A member 1 OS=Homo sapiens OX=9606 GN=DNAJA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.07	24.0	1	1	1
PRT	sp|Q06830|PRDX1_HUMAN	Peroxiredoxin-1 OS=Homo sapiens OX=9606 GN=PRDX1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.07	24.0	1	1	1
PRT	sp|Q9UEY8-2|ADDG_HUMAN	Isoform 1 of Gamma-adducin OS=Homo sapiens OX=9606 GN=ADD3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|O00571-2|DDX3X_HUMAN	Isoform 2 of ATP-dependent RNA helicase DDX3X OS=Homo sapiens OX=9606 GN=DDX3X	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q9UKX7-2|NUP50_HUMAN	Isoform 2 of Nuclear pore complex protein Nup50 OS=Homo sapiens OX=9606 GN=NUP50	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	153-UNIMOD:4	0.05	24.0	1	1	1
PRT	sp|O95487-2|SC24B_HUMAN	Isoform 2 of Protein transport protein Sec24B OS=Homo sapiens OX=9606 GN=SEC24B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|P04899-6|GNAI2_HUMAN	Isoform 6 of Guanine nucleotide-binding protein G(i) subunit alpha-2 OS=Homo sapiens OX=9606 GN=GNAI2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	14-UNIMOD:4	0.06	24.0	1	1	1
PRT	sp|Q96T37-4|RBM15_HUMAN	Isoform 4 of RNA-binding protein 15 OS=Homo sapiens OX=9606 GN=RBM15	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|P20839|IMDH1_HUMAN	Inosine-5'-monophosphate dehydrogenase 1 OS=Homo sapiens OX=9606 GN=IMPDH1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.05	24.0	1	1	1
PRT	sp|O75683|SURF6_HUMAN	Surfeit locus protein 6 OS=Homo sapiens OX=9606 GN=SURF6 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	19-UNIMOD:4	0.04	24.0	1	1	1
PRT	sp|Q15393|SF3B3_HUMAN	Splicing factor 3B subunit 3 OS=Homo sapiens OX=9606 GN=SF3B3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	936-UNIMOD:188,942-UNIMOD:188	0.01	24.0	1	1	1
PRT	sp|P28715|ERCC5_HUMAN	DNA repair protein complementing XP-G cells OS=Homo sapiens OX=9606 GN=ERCC5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|P16949|STMN1_HUMAN	Stathmin OS=Homo sapiens OX=9606 GN=STMN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.09	24.0	1	1	1
PRT	sp|Q8ND24-2|RN214_HUMAN	Isoform 2 of RING finger protein 214 OS=Homo sapiens OX=9606 GN=RNF214	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.05	24.0	1	1	0
PRT	sp|Q9NZB2|F120A_HUMAN	Constitutive coactivator of PPAR-gamma-like protein 1 OS=Homo sapiens OX=9606 GN=FAM120A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|O43399-6|TPD54_HUMAN	Isoform 6 of Tumor protein D54 OS=Homo sapiens OX=9606 GN=TPD52L2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	84-UNIMOD:188,85-UNIMOD:188	0.09	24.0	1	1	1
PRT	sp|P30101|PDIA3_HUMAN	Protein disulfide-isomerase A3 OS=Homo sapiens OX=9606 GN=PDIA3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	129-UNIMOD:188,130-UNIMOD:188	0.02	24.0	2	1	0
PRT	sp|P48556|PSMD8_HUMAN	26S proteasome non-ATPase regulatory subunit 8 OS=Homo sapiens OX=9606 GN=PSMD8 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|Q07866-8|KLC1_HUMAN	Isoform S of Kinesin light chain 1 OS=Homo sapiens OX=9606 GN=KLC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q01105|SET_HUMAN	Protein SET OS=Homo sapiens OX=9606 GN=SET PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	154-UNIMOD:188,167-UNIMOD:188	0.06	24.0	1	1	1
PRT	sp|P35813-2|PPM1A_HUMAN	Isoform Alpha-2 of Protein phosphatase 1A OS=Homo sapiens OX=9606 GN=PPM1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	71-UNIMOD:4,72-UNIMOD:4,86-UNIMOD:188	0.06	24.0	1	1	1
PRT	sp|P26038|MOES_HUMAN	Moesin OS=Homo sapiens OX=9606 GN=MSN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q71U36|TBA1A_HUMAN	Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	96-UNIMOD:188,105-UNIMOD:267	0.05	24.0	2	1	0
PRT	sp|P51991|ROA3_HUMAN	Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens OX=9606 GN=HNRNPA3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	196-UNIMOD:4	0.03	24.0	1	1	0
PRT	sp|Q9Y617|SERC_HUMAN	Phosphoserine aminotransferase OS=Homo sapiens OX=9606 GN=PSAT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null	6-UNIMOD:28	0.06	24.0	1	1	1
PRT	sp|Q96L92|SNX27_HUMAN	Sorting nexin-27 OS=Homo sapiens OX=9606 GN=SNX27 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.03	24.0	1	1	0
PRT	sp|O15382|BCAT2_HUMAN	Branched-chain-amino-acid aminotransferase, mitochondrial OS=Homo sapiens OX=9606 GN=BCAT2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|P31749|AKT1_HUMAN	RAC-alpha serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=AKT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	400-UNIMOD:188,406-UNIMOD:267	0.03	24.0	1	1	1
PRT	sp|Q8ND24|RN214_HUMAN	RING finger protein 214 OS=Homo sapiens OX=9606 GN=RNF214 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	509-UNIMOD:267	0.04	24.0	1	1	0
PRT	sp|Q9P0L0|VAPA_HUMAN	Vesicle-associated membrane protein-associated protein A OS=Homo sapiens OX=9606 GN=VAPA PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null	155-UNIMOD:28	0.08	24.0	1	1	1
PRT	sp|O00442|RTCA_HUMAN	RNA 3'-terminal phosphate cyclase OS=Homo sapiens OX=9606 GN=RTCA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q9HCE1|MOV10_HUMAN	Helicase MOV-10 OS=Homo sapiens OX=9606 GN=MOV10 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	947-UNIMOD:4	0.03	24.0	1	1	1
PRT	sp|A3KMH1|VWA8_HUMAN	von Willebrand factor A domain-containing protein 8 OS=Homo sapiens OX=9606 GN=VWA8 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	668-UNIMOD:267,683-UNIMOD:188	0.01	24.0	1	1	1
PRT	sp|Q8NBJ5|GT251_HUMAN	Procollagen galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=COLGALT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	338-UNIMOD:35,345-UNIMOD:35	0.03	24.0	1	1	1
PRT	sp|P49736|MCM2_HUMAN	DNA replication licensing factor MCM2 OS=Homo sapiens OX=9606 GN=MCM2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	793-UNIMOD:35	0.02	24.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	SHLVHGSSPGVMGTSVATSASK	1	sp|P35658-2|NU214_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0		ms_run[2]:scan=3542	24.084	2	2096.0321	2096.0321	K	I	1027	1049
PSM	HELLLGAGSGPGAGQQQATPGALLQAGPPR	2	sp|Q96DI7|SNR40_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0		ms_run[2]:scan=8399	54.177	2	2848.4944	2848.4944	R	C	22	52
PSM	THTGKYWTLTATGGVQSTASSK	3	sp|Q16658|FSCN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0		ms_run[2]:scan=4993	32.864	2	2281.1339	2281.1339	R	N	309	331
PSM	HVDLLEVAQETDGFSGSDLKEMCR	4	sp|Q8NBU5|ATAD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	23-UNIMOD:4	ms_run[2]:scan=9822	63.469	3	2735.2531	2735.2531	R	D	281	305
PSM	HCIMQANAEYHQSILAK	5	sp|Q8WUM4|PDC6I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	2-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=4866	32.104	2	2018.9762	2018.9762	K	Q	249	266
PSM	IVHAFDMEDLGDKAVYCR	6	sp|Q9NZ45|CISD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	17-UNIMOD:4	ms_run[2]:scan=7711	49.719	2	2137.9925	2137.9925	K	C	56	74
PSM	KHPDADSLYVEEVDVGEIAPR	7	sp|Q12904|AIMP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0		ms_run[2]:scan=7848	50.574	2	2338.1441	2338.1441	R	T	167	188
PSM	MHDLNTDQENLVGTHDAPIR	8	sp|O43684-2|BUB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	20-UNIMOD:267	ms_run[2]:scan=5409	35.397	2	2285.0734	2285.0734	K	C	81	101
PSM	RVEHNQSYSQAGITETEWTSGSSK	9	sp|P42167|LAP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0		ms_run[2]:scan=4761	31.445	3	2681.2318	2681.2318	R	G	216	240
PSM	ESGSLSPEHGPVVVHCSAGIGR	10	sp|P18031|PTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	16-UNIMOD:4	ms_run[2]:scan=4583	30.393	2	2231.0753	2231.0753	R	S	200	222
PSM	FNNWGGSLSLGHPFGATGCR	11	sp|P55084-2|ECHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	19-UNIMOD:4	ms_run[2]:scan=8984	57.97	2	2133.9803	2133.9803	K	L	395	415
PSM	GGLKGSEVGFHGAAPDISVK	12	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	4-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=5640	36.811	2	1937.0409	1937.0409	K	G	5525	5545
PSM	GKITDLANLSAANHDAAIFPGGFGAAK	13	sp|P0DPI2-2|GAL3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=9573	61.847	2	2626.3503	2626.3503	R	N	115	142
PSM	TTIHQLTMQKEEDTSGYR	14	sp|P15924|DESP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=4290	28.666	2	2137.011	2137.0110	K	A	1375	1393
PSM	ELFSPLHALNFGIGGDTTR	15	sp|P68402-3|PA1B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=11381	74.096	2	2044.0378	2044.0378	R	H	61	80
PSM	FHDPDSAVVAQHLTNTVFVDR	16	sp|Q05519-2|SRS11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	21-UNIMOD:267	ms_run[2]:scan=8326	53.714	2	2377.169	2377.1690	K	A	83	104
PSM	GHYTEGAELVDSVLDVVRK	17	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=11153	72.455	2	2086.0695	2086.0695	K	E	104	123
PSM	HIDSAHLYNNEEQVGLAIR	18	sp|Q04828|AK1C1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=6437	41.763	2	2178.0818	2178.0818	R	S	48	67
PSM	HIYYITGETKDQVANSAFVER	19	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=6439	41.776	2	2440.2023	2440.2023	K	L	490	511
PSM	HSQAVEELAEQLEQTKR	20	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=7214	46.603	2	1995.0021	1995.0021	K	V	1194	1211
PSM	VTVAGGVHISGLHTESAPR	21	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	19-UNIMOD:267	ms_run[2]:scan=5108	33.572	2	1897.0045	1897.0045	R	R	1086	1105
PSM	GRASSHSSQTQGGGSVTK	22	sp|P02545|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0		ms_run[1]:scan=449	5.621885	2	1730.826049	1730.829588	R	K	400	418
PSM	TGVHHYSGNNIELGTACGK	23	sp|P62888|RL30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	17-UNIMOD:4,19-UNIMOD:188	ms_run[1]:scan=3576	24.304636666666667	2	2020.936600	2019.952802	K	Y	69	88
PSM	DIQQHKEEAWVIGSVVAR	24	sp|P22102|PUR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=7635	49.256	2	2064.0752	2064.0752	R	A	752	770
PSM	FNNWGGSLSLGHPFGATGCR	25	sp|P55084-2|ECHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	19-UNIMOD:4,20-UNIMOD:267	ms_run[2]:scan=8981	57.953	2	2143.9886	2143.9886	K	L	395	415
PSM	HAAENPGKYNILGTNTIMDK	26	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=6454	41.872	2	2186.079	2186.0790	K	M	498	518
PSM	HCIMQANAEYHQSILAK	27	sp|Q8WUM4|PDC6I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	2-UNIMOD:4	ms_run[2]:scan=4868	32.115	2	2012.9561	2012.9561	K	Q	249	266
PSM	HIQEHYGGTATFYLSQAADGAK	28	sp|P51570|GALK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=6566	42.572	2	2364.1135	2364.1135	R	V	367	389
PSM	KSDIYVCMISFAHNVAAQGK	29	sp|P50395-2|GDIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	7-UNIMOD:4	ms_run[2]:scan=10495	67.945	3	2238.0925	2238.0925	R	Y	284	304
PSM	MHDLNTDQENLVGTHDAPIR	30	sp|O43684-2|BUB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:35,20-UNIMOD:267	ms_run[2]:scan=4898	32.296	2	2301.0683	2301.0683	K	C	81	101
PSM	NYGFVHIEDKTAAEDAIR	31	sp|Q9BWF3-3|RBM4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=6489	42.094	2	2047.9963	2047.9963	K	N	36	54
PSM	RGQTCVVHYTGMLEDGK	32	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	5-UNIMOD:4	ms_run[2]:scan=4974	32.755	2	1949.9088	1949.9088	K	K	19	36
PSM	SGEHDFGAAFDGDGDRNMILGK	33	sp|P36871-3|PGM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	18-UNIMOD:35	ms_run[2]:scan=6640	43.025	2	2324.0128	2324.0128	K	H	81	103
PSM	TGVHHYSGNNIELGTACGK	34	sp|P62888|RL30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	17-UNIMOD:4,19-UNIMOD:188	ms_run[2]:scan=2941	20.146	2	2019.9528	2019.9528	K	Y	69	88
PSM	TGVHHYSGNNIELGTACGK	35	sp|P62888|RL30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	17-UNIMOD:4	ms_run[2]:scan=2942	20.152	2	2013.9327	2013.9327	K	Y	69	88
PSM	TNIVTASVDAINFHDKIR	36	sp|O00154-2|BACH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=9019	58.195	2	2013.0643	2013.0643	K	K	226	244
PSM	VFQSLPHENKPLTLSNYQTNK	37	sp|P04080|CYTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	10-UNIMOD:188,21-UNIMOD:188	ms_run[2]:scan=5981	38.914	2	2469.3055	2469.3055	R	A	69	90
PSM	VTSEELHYFVQNHFTSAR	38	sp|P22695|QCR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	18-UNIMOD:267	ms_run[2]:scan=7839	50.52	2	2174.042	2174.0420	K	M	200	218
PSM	QLFHPEQLITGKEDAANNYAR	39	sp|P68366|TBA4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0	1-UNIMOD:28,12-UNIMOD:188,21-UNIMOD:267	ms_run[1]:scan=9114	58.805659999999996	2	2413.1991	2413.1992	R	G	85	106
PSM	TGVHHYSGNNIELGTACGK	40	sp|P62888|RL30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	17-UNIMOD:4	ms_run[1]:scan=3577	24.310698333333335	2	2014.909900	2013.932673	K	Y	69	88
PSM	LKDSGHLLTQSSPGEPTGFQK	41	sp|Q6ZMZ3|SYNE3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	2-UNIMOD:188,21-UNIMOD:188	ms_run[1]:scan=4831	31.88939166666667	2	2239.146749	2238.168319	K	T	889	910
PSM	AHQTGIHATEELKEFFAK	42	sp|Q6IBS0|TWF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:1	ms_run[2]:scan=8857	57.162	2	2098.0484	2098.0484	M	A	2	20
PSM	FHDPDSAVVAQHLTNTVFVDR	43	sp|Q05519-2|SRS11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=8324	53.698	2	2367.1608	2367.1608	K	A	83	104
PSM	FSGWYDADLSPAGHEEAKR	44	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=6585	42.681	2	2134.9708	2134.9708	R	G	22	41
PSM	HATALEELSEQLEQAKR	45	sp|P35580|MYH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=8747	56.424	2	1951.9963	1951.9963	R	F	1201	1218
PSM	HLCQQLQAEQAAAEKR	46	sp|Q14980-4|NUMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	3-UNIMOD:4	ms_run[2]:scan=3573	24.283	2	1879.9323	1879.9323	K	H	1365	1381
PSM	IHFIEAQDLQGKDTYLK	47	sp|A0FGR8-4|ESYT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=7139	46.154	2	2018.0473	2018.0473	R	G	185	202
PSM	IHVYGYSMAYGPAQHAISTEK	48	sp|Q9NRX4|PHP14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	8-UNIMOD:35,21-UNIMOD:188	ms_run[2]:scan=5643	36.828	2	2344.1253	2344.1253	K	I	88	109
PSM	KAHLMEIQVNGGTVAEK	49	sp|P39023|RL3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=4884	32.215	2	1835.9966	1835.9966	K	L	177	194
PSM	KITVPGNFQGHSGAQCITCSYK	50	sp|Q08945|SSRP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:188,16-UNIMOD:4,19-UNIMOD:4,22-UNIMOD:188	ms_run[2]:scan=5567	36.362	2	2464.203	2464.2030	R	A	325	347
PSM	KPLVLCGDLNVAHEEIDLR	51	sp|P27695|APEX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	6-UNIMOD:4	ms_run[2]:scan=8416	54.282	2	2190.1467	2190.1467	R	N	203	222
PSM	KVTSVVFHPSQDLVFSASPDATIR	52	sp|Q9UMS4|PRP19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=8510	54.876	2	2600.3599	2600.3599	K	I	266	290
PSM	MHDLNTDQENLVGTHDAPIR	53	sp|O43684-2|BUB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:35	ms_run[2]:scan=4903	32.328	2	2291.0601	2291.0601	K	C	81	101
PSM	SGEHDFGAAFDGDGDRNMILGK	54	sp|P36871-3|PGM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=7577	48.881	2	2308.0179	2308.0179	K	H	81	103
PSM	SGVYQHVTGEMMGGHAIR	55	sp|P07858|CATB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	18-UNIMOD:267	ms_run[2]:scan=5667	36.977	2	1938.9068	1938.9068	K	I	264	282
PSM	STHEFLHEVPAASEEIFK	56	sp|Q9H269|VPS16_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=7810	50.345	2	2070.0058	2070.0058	R	I	322	340
PSM	STHEFLHEVPAASEEIFK	57	sp|Q9H269|VPS16_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	18-UNIMOD:188	ms_run[2]:scan=7812	50.356	2	2076.0259	2076.0259	R	I	322	340
PSM	TEAEIAHIALETLEGHQR	58	sp|O75955|FLOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=10053	64.995	2	2017.0229	2017.0229	K	A	92	110
PSM	TREEECHFYAGGQVYPGEASR	59	sp|Q13162|PRDX4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	6-UNIMOD:4	ms_run[2]:scan=4807	31.736	2	2442.0659	2442.0659	R	V	46	67
PSM	TREGNDLYHEMIESGVINLK	60	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=9732	62.877	2	2317.1372	2317.1372	R	D	240	260
PSM	YHVPVVVVPEGSASDTHEQAILR	61	sp|P04844-2|RPN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=7274	46.965	2	2502.2867	2502.2867	R	L	235	258
PSM	QLLHNFPPDQLTSSGAPFWSGPKR	62	sp|P22314|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	1-UNIMOD:28	ms_run[1]:scan=10906	70.75216166666667	3	2662.3162	2662.3282	R	C	724	748
PSM	QSQHDKIDASELSFPFHESILK	63	sp|P42166|LAP2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	1-UNIMOD:28	ms_run[1]:scan=9916	64.09578833333333	2	2538.2369	2538.2385	K	V	479	501
PSM	TKDLPVTEAVFSALVTGHAR	64	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0		ms_run[1]:scan=10827	70.209285	2	2111.129567	2111.137504	K	A	225	245
PSM	AHQTGIHATEELKEFFAK	65	sp|Q6IBS0|TWF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:1,13-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=8860	57.185	2	2110.0886	2110.0886	M	A	2	20
PSM	AVAFQNPQTHVIENLHAAAYR	66	sp|P22695|QCR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=7109	45.967	2	2349.1978	2349.1978	K	N	163	184
PSM	AVHTVDFTADKYHVVSGADDYTVK	67	sp|Q8TED0-3|UTP15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=6391	41.47	2	2637.2711	2637.2711	K	L	105	129
PSM	GGGGPGGGGPGGGSAGGPSQPPGGGGPGIRK	68	sp|Q92945|FUBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=2430	17.093	2	2397.1534	2397.1534	R	D	41	72
PSM	GHVSELEADLAEQQHLR	69	sp|O00291-3|HIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=6151	39.948	2	1930.9497	1930.9497	K	Q	407	424
PSM	GKITDLANLSAANHDAAIFPGGFGAAK	70	sp|P0DPI2-2|GAL3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	2-UNIMOD:188,27-UNIMOD:188	ms_run[2]:scan=9572	61.841	2	2638.3906	2638.3906	R	N	115	142
PSM	GYSLVSGGTDNHLVLVDLRPK	71	sp|P34897-3|GLYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=8729	56.304	2	2239.1961	2239.1961	R	G	348	369
PSM	HGAEVIDTPVFELKETLMGK	72	sp|P12081-4|HARS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	14-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=10794	69.989	3	2225.1805	2225.1805	R	Y	87	107
PSM	HLIPAANTGESKVFYYK	73	sp|P62258-2|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	12-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=5819	37.925	2	1949.045	1949.0450	K	M	85	102
PSM	HNSILQLDPSIPGVFR	74	sp|Q9Y487|VPP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=10352	66.97	2	1791.9632	1791.9632	R	G	511	527
PSM	HVAEVLEYTKDEQLESLFQR	75	sp|P05198|IF2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=9685	62.57	2	2433.2176	2433.2176	R	T	114	134
PSM	KVSQPIEGHAASFAQFK	76	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=5181	34.008	2	1843.9581	1843.9581	R	M	189	206
PSM	LCFLDKVEPHATIAEIK	77	sp|Q9NZ01|TECR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	2-UNIMOD:4	ms_run[2]:scan=8243	53.183	2	1983.0499	1983.0499	K	N	17	34
PSM	LKGTVGEPTYDAEFQHFLR	78	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=8462	54.571	2	2207.1011	2207.1011	K	G	3892	3911
PSM	RGPGPVDLLLCCGDFQAVR	79	sp|Q9UK59|DBR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:267,11-UNIMOD:4,12-UNIMOD:4,19-UNIMOD:267	ms_run[2]:scan=10339	66.877	2	2149.0676	2149.0676	R	N	26	45
PSM	TFVNITPAEVGVLVGKDR	80	sp|P07737|PROF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=10292	66.563	2	1914.0575	1914.0575	K	S	39	57
PSM	VFQSLPHENKPLTLSNYQTNK	81	sp|P04080|CYTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=5963	38.8	2	2457.2652	2457.2652	R	A	69	90
PSM	YNHSHDQLVLTGSSDSR	82	sp|Q53HC9|EIPR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	17-UNIMOD:267	ms_run[2]:scan=2723	18.803	2	1924.8903	1924.8903	R	V	280	297
PSM	YNHSHDQLVLTGSSDSR	83	sp|Q53HC9|EIPR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=2727	18.827	2	1914.882	1914.8820	R	V	280	297
PSM	VIHDNFGIVEGLMTTVHAITATQK	84	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0		ms_run[1]:scan=12847	88.18720666666667	3	2594.341048	2594.352658	K	T	163	187
PSM	QSQHDKIDASELSFPFHESILK	85	sp|P42166|LAP2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:28,6-UNIMOD:188,22-UNIMOD:188	ms_run[1]:scan=9917	64.101995	2	2550.2771	2550.2788	K	V	479	501
PSM	AVAFQNPQTHVIENLHAAAYR	86	sp|P22695|QCR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	21-UNIMOD:267	ms_run[2]:scan=7104	45.939	3	2359.2061	2359.2061	K	N	163	184
PSM	DVHNIYGLYVHMATADGLR	87	sp|Q14697|GANAB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	19-UNIMOD:267	ms_run[2]:scan=10481	67.852	2	2154.0556	2154.0556	R	Q	570	589
PSM	ELFSPLHALNFGIGGDTTR	88	sp|P68402-3|PA1B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	19-UNIMOD:267	ms_run[2]:scan=11376	74.06	2	2054.0461	2054.0461	R	H	61	80
PSM	EVVHTVSLHEIDVINSR	89	sp|Q9Y230-2|RUVB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	17-UNIMOD:267	ms_run[2]:scan=6971	45.114	2	1956.0304	1956.0304	K	T	192	209
PSM	FVIHCNSPVWGADKCEELLEK	90	sp|O75367-2|H2AY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	5-UNIMOD:4,14-UNIMOD:188,15-UNIMOD:4,21-UNIMOD:188	ms_run[2]:scan=7854	50.61	3	2542.2387	2542.2387	K	T	269	290
PSM	GFCFLEYEDHKTAAQAR	91	sp|O60506-5|HNRPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:4	ms_run[2]:scan=6700	43.403	2	2041.9316	2041.9316	R	R	135	152
PSM	HAAENPGKYNILGTNTIMDK	92	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	8-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=6462	41.924	2	2198.1193	2198.1193	K	M	498	518
PSM	HADHSSLTLGSGSSTTR	93	sp|Q7Z6Z7-2|HUWE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=1844	13.606	2	1712.8078	1712.8078	R	L	2522	2539
PSM	HAPINSAQHLDNVDQTGPK	94	sp|O43159|RRP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=2776	19.117	2	2040.9977	2040.9977	K	A	139	158
PSM	HTWMEDADSCVAHNALECAR	95	sp|O94906-2|PRP6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	10-UNIMOD:4,18-UNIMOD:4	ms_run[2]:scan=7421	47.909	2	2371.9732	2371.9732	K	A	541	561
PSM	IHFIEAQDLQGKDTYLK	96	sp|A0FGR8-4|ESYT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	12-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=7140	46.16	2	2030.0875	2030.0875	R	G	185	202
PSM	IHVYGYSMAYGPAQHAISTEK	97	sp|Q9NRX4|PHP14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	8-UNIMOD:35	ms_run[2]:scan=5651	36.875	2	2338.1052	2338.1052	K	I	88	109
PSM	IMRPDDANVAGNVHGGTILK	98	sp|O00154-2|BACH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=5425	35.489	2	2077.0739	2077.0739	R	M	17	37
PSM	KHEAIETDIVAYSGR	99	sp|O15020-2|SPTN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=5147	33.804	2	1687.8529	1687.8529	R	V	466	481
PSM	KITVPGNFQGHSGAQCITCSYK	100	sp|Q08945|SSRP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	16-UNIMOD:4,19-UNIMOD:4	ms_run[2]:scan=5564	36.339	2	2452.1627	2452.1627	R	A	325	347
PSM	KVAPQNDSFGTQLPPMHQQQR	101	sp|Q96AE4-2|FUBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=4922	32.445	2	2406.1863	2406.1863	K	S	77	98
PSM	KVSQPIEGHAASFAQFK	102	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=5186	34.036	2	1855.9983	1855.9983	R	M	189	206
PSM	LDKAQIHDLVLVGGSTR	103	sp|P0DMV8-2|HS71A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=6583	42.669	2	1821.0108	1821.0108	K	I	271	288
PSM	LDKSQIHDIVLVGGSTR	104	sp|P11142-2|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=6080	39.503	2	1837.0058	1837.0058	K	I	326	343
PSM	LVSNHSLHETSSVFVDSLTK	105	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	20-UNIMOD:188	ms_run[2]:scan=7122	46.05	2	2205.1373	2205.1373	R	A	2513	2533
PSM	LVSNHSLHETSSVFVDSLTK	106	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=7130	46.097	2	2199.1172	2199.1172	R	A	2513	2533
PSM	NHIENQDECVLNVISHAR	107	sp|Q9BZE1|RM37_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	9-UNIMOD:4	ms_run[2]:scan=7251	46.825	2	2147.0178	2147.0178	R	L	145	163
PSM	NKHEMVVYEAASAIVNLPGCSAK	108	sp|Q9Y678|COPG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	2-UNIMOD:188,20-UNIMOD:4,23-UNIMOD:188	ms_run[2]:scan=9569	61.819	2	2499.2653	2499.2653	R	E	261	284
PSM	NNRQPYAVSELAGHQTSAESWGTGR	109	sp|P36578|RL4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=6005	39.068	3	2715.275	2715.2750	K	A	47	72
PSM	NNRQPYAVSELAGHQTSAESWGTGR	110	sp|P36578|RL4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:267,25-UNIMOD:267	ms_run[2]:scan=6043	39.296	3	2735.2915	2735.2915	K	A	47	72
PSM	SHFECEKETPQSLAFTR	111	sp|Q9UDY2-5|ZO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	5-UNIMOD:4	ms_run[2]:scan=5121	33.651	2	2065.9527	2065.9527	R	G	611	628
PSM	SNAHYNLQNAFNLAEQHLGLTK	112	sp|Q01082-3|SPTB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	22-UNIMOD:188	ms_run[2]:scan=10806	70.071	3	2488.2554	2488.2554	K	L	215	237
PSM	THINIVVIGHVDSGK	113	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=5641	36.817	2	1587.8733	1587.8733	K	S	6	21
PSM	TLQAGLSSNHVSHGEVLR	114	sp|O95163|ELP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=4115	27.615	2	1903.9864	1903.9864	K	K	672	690
PSM	VIHDNFGIVEGLMTTVHAITATQK	115	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	13-UNIMOD:35	ms_run[2]:scan=11764	76.995	3	2610.3476	2610.3476	K	T	163	187
PSM	VKHEVSGETVVFQGGALGK	116	sp|Q5VYK3|ECM29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	2-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=5150	33.82	2	1953.0722	1953.0722	R	T	1038	1057
PSM	NLLHVTDTGVGMTREELVK	117	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0		ms_run[1]:scan=7202	46.536703333333335	2	2111.107185	2111.104489	K	N	143	162
PSM	AAIDWFDGKEFHGNIIK	118	sp|Q92804-2|RBP56_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=9474	61.196	2	1959.9843	1959.9843	K	V	295	312
PSM	AHSIQIMKVEEIAASK	119	sp|Q02543|RL18A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	8-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=6069	39.447	2	1765.9799	1765.9799	R	C	121	137
PSM	AHSIQIMKVEEIAASK	120	sp|Q02543|RL18A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=6070	39.452	2	1753.9397	1753.9397	R	C	121	137
PSM	EKLHAVNAEECNVLQGR	121	sp|O75521-2|ECI2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	11-UNIMOD:4	ms_run[2]:scan=4499	29.904	2	1965.9691	1965.9691	R	W	323	340
PSM	FHMDSETHDPIDLQTK	122	sp|Q9Y2L1-2|RRP44_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	16-UNIMOD:188	ms_run[2]:scan=5658	36.92	2	1918.8827	1918.8827	R	E	609	625
PSM	FVIHCNSPVWGADKCEELLEK	123	sp|O75367-2|H2AY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=7868	50.693	3	2530.1985	2530.1985	K	T	269	290
PSM	GGLKGSEVGFHGAAPDISVK	124	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=5639	36.806	3	1937.0409	1937.0409	K	G	5525	5545
PSM	GKITDLANLSAANHDAAIFPGGFGAAK	125	sp|P0DPI2-2|GAL3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	2-UNIMOD:188,27-UNIMOD:188	ms_run[2]:scan=9571	61.835	3	2638.3906	2638.3906	R	N	115	142
PSM	HADHSSLTLGSGSSTTR	126	sp|Q7Z6Z7-2|HUWE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	17-UNIMOD:267	ms_run[2]:scan=1838	13.573	2	1722.8161	1722.8161	R	L	2522	2539
PSM	HAPINSAQHLDNVDQTGPK	127	sp|O43159|RRP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	19-UNIMOD:188	ms_run[2]:scan=2781	19.152	2	2047.0178	2047.0178	K	A	139	158
PSM	HGAEVIDTPVFELKETLMGK	128	sp|P12081-4|HARS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=10818	70.149	3	2213.1402	2213.1402	R	Y	87	107
PSM	HLDGKDENFAATDAIPSNVLR	129	sp|Q99549|MPP8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=7208	46.568	2	2282.1291	2282.1291	K	D	551	572
PSM	KHEAIETDIAAYEER	130	sp|Q01082-3|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=5351	35.046	2	1773.8533	1773.8533	K	V	450	465
PSM	KPMVLGHEASGTVEK	131	sp|Q00796-2|DHSO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=2245	16.013	2	1581.8185	1581.8185	K	V	64	79
PSM	KSDIYVCMISFAHNVAAQGK	132	sp|P50395-2|GDIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:188,7-UNIMOD:4,20-UNIMOD:188	ms_run[2]:scan=10494	67.94	3	2250.1328	2250.1328	R	Y	284	304
PSM	KSDIYVCMISFAHNVAAQGK	133	sp|P50395-2|GDIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:188,7-UNIMOD:4,20-UNIMOD:188	ms_run[2]:scan=10498	67.963	2	2250.1328	2250.1328	R	Y	284	304
PSM	LHQEYVPSAHLSGTCTCLAWAPAR	134	sp|Q15061|WDR43_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	15-UNIMOD:4,17-UNIMOD:4,24-UNIMOD:267	ms_run[2]:scan=7330	47.329	3	2734.2983	2734.2983	R	L	48	72
PSM	MCKQDPSVLHTEEMR	135	sp|Q8NFI4|F10A5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:35,2-UNIMOD:4	ms_run[2]:scan=2881	19.791	2	1875.8277	1875.8277	K	F	15	30
PSM	NVVEELLSGNPHIEKESAR	136	sp|Q96BS2-3|CHP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=8677	55.961	2	2120.0862	2120.0862	R	S	110	129
PSM	RGAPAAATAPAPTAHK	137	sp|Q92522|H1X_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=939	8.4274	2	1486.8005	1486.8005	R	A	128	144
PSM	SHLMSLYSACSSEVPHGPVDQK	138	sp|O95816-2|BAG2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	10-UNIMOD:4	ms_run[2]:scan=6311	40.948	2	2428.1151	2428.1151	K	F	100	122
PSM	SHTEEDCTEELFDFLHAR	139	sp|P07919|QCR6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	7-UNIMOD:4	ms_run[2]:scan=10520	68.111	2	2234.9539	2234.9539	R	D	61	79
PSM	SHYAAEEISEKLSQLQAR	140	sp|O15020-2|SPTN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=7742	49.911	2	2059.0334	2059.0334	R	R	1977	1995
PSM	SLETEHKALTSEIALLQSR	141	sp|P04843|RPN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=8741	56.379	2	2125.1379	2125.1379	K	L	518	537
PSM	SVEMHHEALSEALPGDNVGFNVK	142	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	23-UNIMOD:188	ms_run[2]:scan=7281	47.01	2	2485.2003	2485.2003	K	N	291	314
PSM	THSQGGYGSQGYKYNWK	143	sp|Q9Y285-2|SYFA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=3745	25.354	2	1959.8864	1959.8864	R	L	268	285
PSM	TREEECHFYAGGQVYPGEASR	144	sp|Q13162|PRDX4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:4	ms_run[2]:scan=4804	31.718	3	2442.0659	2442.0659	R	V	46	67
PSM	VILHLKEDQTEYLEER	145	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=6096	39.595	2	2014.0371	2014.0371	K	R	186	202
PSM	VILHLKEDQTEYLEER	146	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=6260	40.613	2	2014.0371	2014.0371	K	R	186	202
PSM	YGDSEFTVQSTTGHCVHMR	147	sp|P52597|HNRPF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	15-UNIMOD:4	ms_run[2]:scan=4911	32.376	2	2210.9473	2210.9473	R	G	276	295
PSM	YHVPVVVVPEGSASDTHEQAILR	148	sp|P04844-2|RPN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	23-UNIMOD:267	ms_run[2]:scan=7273	46.959	2	2512.295	2512.2950	R	L	235	258
PSM	SLDLDISKTNVNGGAIALGHPLGGSGSR	149	sp|P42765|THIM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0		ms_run[1]:scan=8558	55.18427833333333	3	2706.391423	2705.409656	R	I	333	361
PSM	FHMDSETHDPIDLQTK	150	sp|Q9Y2L1-2|RRP44_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=5653	36.888	2	1912.8625	1912.8625	R	E	609	625
PSM	FLQEHGSDSFLAEHK	151	sp|Q00688|FKBP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=5031	33.1	2	1743.8216	1743.8216	K	L	28	43
PSM	FQSSHHPTDITSLDQYVER	152	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	19-UNIMOD:267	ms_run[2]:scan=6748	43.696	2	2269.0639	2269.0639	R	M	512	531
PSM	GEHSIVYLKPSYAFGSVGK	153	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=7226	46.676	2	2038.0524	2038.0524	K	E	214	233
PSM	GFGFVTFDDHDPVDKIVLQK	154	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	15-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=10296	66.588	2	2288.188	2288.1880	R	Y	142	162
PSM	GHVSELEADLAEQQHLR	155	sp|O00291-3|HIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	17-UNIMOD:267	ms_run[2]:scan=6139	39.867	2	1940.958	1940.9580	K	Q	407	424
PSM	GHYTEGAELVDSVLDVVRK	156	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=11144	72.392	3	2086.0695	2086.0695	K	E	104	123
PSM	HELLLGAGSGPGAGQQQATPGALLQAGPPR	157	sp|Q96DI7|SNR40_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=8403	54.204	3	2848.4944	2848.4944	R	C	22	52
PSM	HQGVMVGMGQKDSYVGDEAQSK	158	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=4303	28.746	2	2350.0682	2350.0682	R	R	40	62
PSM	HTWMEDADSCVAHNALECAR	159	sp|O94906-2|PRP6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	10-UNIMOD:4,18-UNIMOD:4,20-UNIMOD:267	ms_run[2]:scan=7431	47.969	2	2381.9815	2381.9815	K	A	541	561
PSM	IAQPGDHVSVTGIFLPILR	160	sp|P33993-2|MCM7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	19-UNIMOD:267	ms_run[2]:scan=11851	77.615	2	2042.1552	2042.1552	R	T	264	283
PSM	ICANHYITPMMELKPNAGSDR	161	sp|P43487-2|RANG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	2-UNIMOD:4	ms_run[2]:scan=7040	45.541	3	2417.129	2417.1290	K	A	98	119
PSM	KFDEVLVNHFCEEFGK	162	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:188,11-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=8866	57.221	2	2008.9756	2008.9756	R	K	235	251
PSM	KPLVLCGDLNVAHEEIDLR	163	sp|P27695|APEX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:4	ms_run[2]:scan=8404	54.209	3	2190.1467	2190.1467	R	N	203	222
PSM	KPMVLGHEASGTVEK	164	sp|Q00796-2|DHSO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=2263	16.119	2	1593.8587	1593.8587	K	V	64	79
PSM	KSDIYVCMISFAHNVAAQGK	165	sp|P50395-2|GDIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	7-UNIMOD:4	ms_run[2]:scan=10499	67.969	2	2238.0925	2238.0925	R	Y	284	304
PSM	KVTSVVFHPSQDLVFSASPDATIR	166	sp|Q9UMS4|PRP19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=8507	54.86	3	2600.3599	2600.3599	K	I	266	290
PSM	LHQEYVPSAHLSGTCTCLAWAPAR	167	sp|Q15061|WDR43_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	15-UNIMOD:4,17-UNIMOD:4,24-UNIMOD:267	ms_run[2]:scan=7331	47.334	2	2734.2983	2734.2983	R	L	48	72
PSM	MHDLNTDQENLVGTHDAPIR	168	sp|O43684-2|BUB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	20-UNIMOD:267	ms_run[2]:scan=5406	35.38	3	2285.0734	2285.0734	K	C	81	101
PSM	NHEEEVKGLQAQIASSGLTVEVDAPK	169	sp|P05783|K1C18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=8233	53.12	2	2748.393	2748.3930	K	S	216	242
PSM	NHIENQDECVLNVISHAR	170	sp|Q9BZE1|RM37_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	9-UNIMOD:4	ms_run[2]:scan=7262	46.895	3	2147.0178	2147.0178	R	L	145	163
PSM	NKHEMVVYEAASAIVNLPGCSAK	171	sp|Q9Y678|COPG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	20-UNIMOD:4	ms_run[2]:scan=9565	61.791	2	2487.225	2487.2250	R	E	261	284
PSM	SGDHLHNDSQIEADFR	172	sp|P11387|TOP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=4432	29.519	2	1839.8136	1839.8136	M	L	2	18
PSM	SGPFGQIFRPDNFVFGQSGAGNNWAK	173	sp|P04350|TBB4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=11620	75.846	3	2797.3361	2797.3361	R	G	78	104
PSM	SHLVHGSSPGVMGTSVATSASK	174	sp|P35658-2|NU214_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	22-UNIMOD:188	ms_run[2]:scan=3541	24.077	2	2102.0522	2102.0522	K	I	1027	1049
PSM	SHTEEDCTEELFDFLHAR	175	sp|P07919|QCR6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	7-UNIMOD:4,18-UNIMOD:267	ms_run[2]:scan=10519	68.105	2	2244.9621	2244.9621	R	D	61	79
PSM	SWASLFHDSKPSSSSPVAYVETK	176	sp|Q14694|UBP10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=8698	56.104	3	2509.2125	2509.2125	K	Y	341	364
PSM	TLTELILDAQEHVKNPYK	177	sp|P17480-2|UBF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=10274	66.444	2	2111.1263	2111.1263	R	G	84	102
PSM	VIHLSNLPHSGYSDSAVLK	178	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	19-UNIMOD:188	ms_run[2]:scan=6468	41.959	2	2042.0892	2042.0892	R	L	497	516
PSM	YGDGGSSFQSTTGHCVHMR	179	sp|P55795|HNRH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	15-UNIMOD:4	ms_run[2]:scan=3591	24.394	2	2082.8636	2082.8636	R	G	276	295
PSM	YHINSVHAEDWFVVNPTTTK	180	sp|Q96ME7-2|ZN512_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=8347	53.843	2	2357.144	2357.1440	K	S	380	400
PSM	HTGPGILSMANAGPNTNGSQFFICTAK	181	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	24-UNIMOD:4,27-UNIMOD:188	ms_run[1]:scan=9873	63.80308833333333	3	2797.324724	2796.341898	K	T	92	119
PSM	HYGGLTGLNKAETAAK	182	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0		ms_run[1]:scan=3302	22.352421666666668	2	1629.846492	1629.847470	R	H	91	107
PSM	VTSEELHYFVQNHFTSAR	183	sp|P22695|QCR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0		ms_run[1]:scan=7838	50.51377333333333	2	2165.039107	2164.033767	K	M	200	218
PSM	KVTHAVVTVPAYFNDAQR	184	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0		ms_run[1]:scan=5973	38.86456833333334	2	2016.061296	2015.058859	K	Q	164	182
PSM	AVAFQNPQTHVIENLHAAAYR	185	sp|P22695|QCR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	21-UNIMOD:267	ms_run[2]:scan=7106	45.949	2	2359.2061	2359.2061	K	N	163	184
PSM	EAIVNSCVFVHQTLHQANAR	186	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:4,20-UNIMOD:267	ms_run[2]:scan=6495	42.131	2	2303.1469	2303.1469	R	L	3141	3161
PSM	EHANKLIEVANLACSISNNEEGVK	187	sp|P35221-3|CTNA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:188,14-UNIMOD:4,24-UNIMOD:188	ms_run[2]:scan=8945	57.724	2	2650.3423	2650.3423	R	L	55	79
PSM	FAANPNQNKNVALLSQLYHSPAR	188	sp|Q15717|ELAV1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=7673	49.487	3	2552.3248	2552.3248	K	R	183	206
PSM	FIIHAPPGEFNEVFNDVR	189	sp|P47755|CAZA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=10504	68.004	2	2100.0429	2100.0429	K	L	20	38
PSM	GFKATDCVGHDVVTLLR	190	sp|P19367-4|HXK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:4	ms_run[2]:scan=8386	54.095	2	1886.9673	1886.9673	K	D	610	627
PSM	HAAENPGKYNILGTNTIMDK	191	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=6459	41.903	3	2186.079	2186.0790	K	M	498	518
PSM	HASQKDYSSGFGGK	192	sp|Q14247|SRC8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=1357	10.81	2	1467.6743	1467.6743	K	Y	148	162
PSM	HEKEDGAISTIVLR	193	sp|P50990|TCPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=5137	33.746	2	1566.8366	1566.8366	K	G	365	379
PSM	HGVDHQVISVTFEK	194	sp|Q15020|SART3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	14-UNIMOD:188	ms_run[2]:scan=5093	33.481	2	1600.8305	1600.8305	R	A	392	406
PSM	HLNEIDLFHCIDPNDSK	195	sp|Q15185-3|TEBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	10-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=8592	55.41	2	2071.9729	2071.9729	K	H	49	66
PSM	HQGVMVGMGQKDSYVGDEAQSK	196	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	11-UNIMOD:188,22-UNIMOD:188	ms_run[2]:scan=4302	28.74	3	2362.1084	2362.1084	R	R	40	62
PSM	HVAEVLEYTKDEQLESLFQR	197	sp|P05198|IF2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=9677	62.518	3	2433.2176	2433.2176	R	T	114	134
PSM	HVVLGAIENKVESK	198	sp|P41227-2|NAA10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	10-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=4592	30.445	2	1533.8917	1533.8917	R	G	155	169
PSM	ICANHYITPMMELKPNAGSDR	199	sp|P43487-2|RANG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:4	ms_run[2]:scan=7043	45.557	2	2417.129	2417.1290	K	A	98	119
PSM	IGEEQSAEDAEDGPPELLFIHGGHTAK	200	sp|Q16576|RBBP7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=8033	51.79	3	2846.3359	2846.3359	K	I	349	376
PSM	IKSEHPGLSIGDTAK	201	sp|P26583|HMGB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=2740	18.895	2	1563.8659	1563.8659	K	K	113	128
PSM	ILHENTQTDKALYNR	202	sp|Q6UB35|C1TM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=2847	19.586	2	1814.9275	1814.9275	R	L	507	522
PSM	IVHAFDMEDLGDKAVYCR	203	sp|Q9NZ45|CISD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	17-UNIMOD:4	ms_run[2]:scan=7696	49.63	3	2137.9925	2137.9925	K	C	56	74
PSM	KIDGQQTIIACIESHQFQAK	204	sp|P47755|CAZA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	11-UNIMOD:4	ms_run[2]:scan=8477	54.665	2	2314.174	2314.1740	K	N	147	167
PSM	KLDAGNQLALIEELHK	205	sp|Q92616|GCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=7912	50.959	2	1790.989	1790.9890	K	E	2222	2238
PSM	LAHEVGWKYQAVTATLEEK	206	sp|P40429|RL13A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	8-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=7069	45.717	2	2184.1618	2184.1618	R	R	141	160
PSM	LCFLDKVEPHATIAEIK	207	sp|Q9NZ01|TECR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:4,6-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=8235	53.132	2	1995.0902	1995.0902	K	N	17	34
PSM	LGHGEEELETEKDFSR	208	sp|O60306|AQR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=4252	28.428	2	1874.8646	1874.8646	R	Y	879	895
PSM	LHGLDEEAEQKLFSEK	209	sp|P33991|MCM4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=6741	43.652	2	1871.9265	1871.9265	R	R	429	445
PSM	LHQAKEQYEALQEETR	210	sp|Q9UPN3-4|MACF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=3546	24.108	2	1971.965	1971.9650	K	V	1636	1652
PSM	LHQEYVPSAHLSGTCTCLAWAPAR	211	sp|Q15061|WDR43_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	15-UNIMOD:4,17-UNIMOD:4	ms_run[2]:scan=7333	47.346	3	2724.2901	2724.2901	R	L	48	72
PSM	LHTLEEEKEELAQYQK	212	sp|Q9UQE7|SMC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=5748	37.487	2	1986.9898	1986.9898	R	W	200	216
PSM	LKQDTYGDIYNFPIHAFDK	213	sp|Q9BXY0|MAK16_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=9584	61.914	2	2284.1164	2284.1164	R	A	170	189
PSM	LNPTWNHPDQDTEAGFKR	214	sp|Q9HB07|MYG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=4822	31.831	2	2124.9977	2124.9977	R	A	202	220
PSM	LTLSALLDGKNVNAGGHK	215	sp|P21796|VDAC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=7558	48.76	2	1806.9952	1806.9952	K	L	257	275
PSM	LTLYDIAHTPGVAADLSHIETK	216	sp|P40926-2|MDHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	22-UNIMOD:188	ms_run[2]:scan=10486	67.887	2	2370.2527	2370.2527	R	A	53	75
PSM	MHDLNTDQENLVGTHDAPIR	217	sp|O43684-2|BUB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:35,20-UNIMOD:267	ms_run[2]:scan=4902	32.324	3	2301.0683	2301.0683	K	C	81	101
PSM	NKGDSHLNVQVSNFK	218	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=4138	27.75	2	1697.8888	1697.8888	K	S	247	262
PSM	NKGDSHLNVQVSNFK	219	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=4139	27.756	2	1685.8485	1685.8485	K	S	247	262
PSM	SHTEEDCTEELFDFLHAR	220	sp|P07919|QCR6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:4,18-UNIMOD:267	ms_run[2]:scan=10518	68.099	3	2244.9621	2244.9621	R	D	61	79
PSM	SPAPPLLHVAALGQK	221	sp|Q8N163-2|CCAR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=7271	46.949	2	1497.8667	1497.8667	K	Q	124	139
PSM	THINIVVIGHVDSGK	222	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	15-UNIMOD:188	ms_run[2]:scan=5637	36.79	2	1593.8934	1593.8934	K	S	6	21
PSM	TIKVWQLGSSSPNFTLEGHEK	223	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=8421	54.316	2	2357.2016	2357.2016	R	G	137	158
PSM	TPELNLDQFHDKTPYTIMFGPDK	224	sp|P27824-3|CALX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	12-UNIMOD:188,23-UNIMOD:188	ms_run[2]:scan=10622	68.834	2	2718.3402	2718.3402	K	C	63	86
PSM	TRAEAEAAAVHGAR	225	sp|Q5T8P6-5|RBM26_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=1163	9.7012	2	1408.7171	1408.7171	K	F	461	475
PSM	TTNAGPLHPYWPQHLR	226	sp|Q15125|EBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:1,16-UNIMOD:267	ms_run[2]:scan=7733	49.853	2	1938.9728	1938.9728	M	L	2	18
PSM	TTNAGPLHPYWPQHLR	227	sp|Q15125|EBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:1	ms_run[2]:scan=7729	49.825	2	1928.9646	1928.9646	M	L	2	18
PSM	VHELNEEIGKLLAK	228	sp|Q9Y383-3|LC7L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	10-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=7670	49.471	2	1603.9336	1603.9336	R	V	123	137
PSM	VICILSHPIKNTNDANSCQIIIPQNQVNR	229	sp|P50395-2|GDIB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:4,18-UNIMOD:4	ms_run[2]:scan=7555	48.742	3	3358.7238	3358.7238	R	K	255	284
PSM	VPTISINKTDGCHAYLSK	230	sp|Q01518-2|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	12-UNIMOD:4	ms_run[2]:scan=5299	34.725	2	2003.0146	2003.0146	K	N	404	422
PSM	LTIHGDLYYEGKEFETR	231	sp|Q13435|SF3B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=6881	44.544934999999995	2	2071.000816	2070.005821	K	L	584	601
PSM	VEPFLPGHYEVLDLKPNGK	232	sp|P08243|ASNS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	15-UNIMOD:188,19-UNIMOD:188	ms_run[1]:scan=9025	58.233823333333326	2	2164.158114	2163.176699	K	V	177	196
PSM	AAPRPAPVAQPPAAAPPSAVGSSAAAPR	233	sp|Q9Y6H1|CHCH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=4646	30.758	3	2532.3561	2532.3561	R	Q	24	52
PSM	AIEKLEEEQHALFAR	234	sp|Q70UQ0-4|IKIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=6642	43.037	2	1782.9264	1782.9264	K	D	237	252
PSM	ALDVMVSTFHKYSGK	235	sp|P26447|S10A4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	11-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=7233	46.72	2	1693.89	1693.8900	K	E	8	23
PSM	ALPGQLKPFETLLSQNQGGK	236	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=10078	65.161	2	2125.1532	2125.1532	K	T	122	142
PSM	DLAALHEICVAHSDELR	237	sp|P20936-2|RASA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	9-UNIMOD:4	ms_run[2]:scan=7582	48.916	2	1947.9473	1947.9473	R	T	817	834
PSM	EHANKLIEVANLACSISNNEEGVK	238	sp|P35221-3|CTNA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	14-UNIMOD:4	ms_run[2]:scan=8947	57.735	2	2638.3021	2638.3021	R	L	55	79
PSM	FQSSHHPTDITSLDQYVER	239	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=6746	43.685	2	2259.0556	2259.0556	R	M	512	531
PSM	GKAHAAVWNAQEAQADFAK	240	sp|O00170|AIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	2-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=5223	34.257	3	2024.0267	2024.0267	R	V	272	291
PSM	GKAHAAVWNAQEAQADFAK	241	sp|O00170|AIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=5239	34.354	2	2011.9864	2011.9864	R	V	272	291
PSM	GMGSLDAMDKHLSSQNR	242	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=4895	32.28	2	1845.8462	1845.8462	R	Y	413	430
PSM	HGVDHQVISVTFEK	243	sp|Q15020|SART3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=5092	33.475	2	1594.8104	1594.8104	R	A	392	406
PSM	HIDYFNNQIIVDLVEQQHK	244	sp|O94832|MYO1D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	19-UNIMOD:188	ms_run[2]:scan=10939	70.974	3	2358.2064	2358.2064	K	G	432	451
PSM	HIGYDDSSKGFDYK	245	sp|P31153-2|METK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=4178	27.991	2	1630.7264	1630.7264	K	T	26	40
PSM	HIYYITGETKDQVANSAFVER	246	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=6443	41.804	3	2440.2023	2440.2023	K	L	490	511
PSM	HLSPYATLTVGDSSHK	247	sp|Q9BSJ8|ESYT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	16-UNIMOD:188	ms_run[2]:scan=4625	30.639	2	1717.8731	1717.8731	K	T	818	834
PSM	HSQAVEELAEQLEQTKR	248	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=7211	46.589	3	1995.0021	1995.0021	K	V	1194	1211
PSM	HTGPGILSMANAGPNTNGSQFFICTAK	249	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	24-UNIMOD:4	ms_run[2]:scan=9611	62.092	3	2790.3218	2790.3218	K	T	92	119
PSM	HVDLLEVAQETDGFSGSDLKEMCR	250	sp|Q8NBU5|ATAD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	23-UNIMOD:4	ms_run[2]:scan=9832	63.534	2	2735.2531	2735.2531	R	D	281	305
PSM	HVVLGAIENKVESK	251	sp|P41227-2|NAA10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=4607	30.53	2	1521.8515	1521.8515	R	G	155	169
PSM	ICRDLSHIGDAVVISCAK	252	sp|P12004|PCNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	2-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=6557	42.515	2	2013.0136	2013.0136	R	D	147	165
PSM	IKGCWDSIHVVEVQEK	253	sp|P47756-2|CAPZB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	2-UNIMOD:188,4-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=6383	41.418	2	1938.0072	1938.0072	K	S	144	160
PSM	KAAEAHVDAHYYEQNEQPTGTCAACITGDNR	254	sp|P55263-3|ADK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	22-UNIMOD:4,25-UNIMOD:4	ms_run[2]:scan=4614	30.575	3	3476.511	3476.5110	R	S	119	150
PSM	KIDGQQTIIACIESHQFQAK	255	sp|P47755|CAZA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	11-UNIMOD:4	ms_run[2]:scan=8475	54.655	3	2314.174	2314.1740	K	N	147	167
PSM	KLFIGGLSFETTDESLR	256	sp|P09651-3|ROA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=9971	64.455	2	1911.9942	1911.9942	R	S	15	32
PSM	KPAAGLSAAPVPTAPAAGAPLMDFGNDFVPPAPR	257	sp|Q9NQC3-2|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=11062	71.794	3	3270.686	3270.6860	R	G	58	92
PSM	KSNIHCNTIAPNAGSR	258	sp|P51659-3|DHB4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:4	ms_run[2]:scan=1313	10.564	2	1738.8533	1738.8533	R	M	166	182
PSM	LQFHNVKPECLEAYNK	259	sp|O75323|NIPS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	10-UNIMOD:4	ms_run[2]:scan=5686	37.098	2	1988.9778	1988.9778	K	I	76	92
PSM	PKFYCDYCDTYLTHDSPSVR	260	sp|P09234|RU1C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	5-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=6660	43.152	3	2523.0835	2523.0835	M	K	2	22
PSM	SEMEMAHLYSLCDAAHAQTEVAKK	261	sp|O94826|TOM70_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	12-UNIMOD:4	ms_run[2]:scan=6950	44.981	3	2719.2404	2719.2404	K	Y	577	601
PSM	SGPFGQIFRPDNFVFGQSGAGNNWAK	262	sp|P04350|TBB4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	9-UNIMOD:267,26-UNIMOD:188	ms_run[2]:scan=11608	75.761	3	2813.3645	2809.3764	R	G	78	104
PSM	SGVYQHVTGEMMGGHAIR	263	sp|P07858|CATB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	18-UNIMOD:267	ms_run[2]:scan=5661	36.938	3	1938.9068	1938.9068	K	I	264	282
PSM	SLDLDISKTNVNGGAIALGHPLGGSGSR	264	sp|P42765|THIM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=8459	54.554	3	2705.4097	2705.4097	R	I	333	361
PSM	SLYHDISGDTSGDYRK	265	sp|P50995-2|ANX11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=4180	28.001	2	1812.8279	1812.8279	K	I	447	463
PSM	STKHWELTAEGEEIAR	266	sp|Q9Y285-2|SYFA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=5290	34.669	2	1855.9064	1855.9064	R	E	57	73
PSM	TDRYTIHSQLEHLQSK	267	sp|Q9BWJ5|SF3B5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:1	ms_run[2]:scan=5632	36.762	2	1996.9967	1996.9967	M	Y	2	18
PSM	TLEHLQLSHDQLLEVK	268	sp|P52789|HXK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=7066	45.699	2	1902.0211	1902.0211	K	R	473	489
PSM	TTHYTPLACGSNPLKR	269	sp|O60832-2|DKC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	9-UNIMOD:4	ms_run[2]:scan=4368	29.132	2	1814.9098	1814.9098	R	E	66	82
PSM	VALLSGGGSGHEPAHAGFIGK	270	sp|Q3LXA3-2|TKFC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=5493	35.909	2	1961.0119	1961.0119	R	G	49	70
PSM	VDIDAPDVDVHGPDWHLK	271	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	18-UNIMOD:188	ms_run[2]:scan=7767	50.069	2	2032.995	2032.9950	K	M	731	749
PSM	VDINTPDVDVHGPDWHLK	272	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	18-UNIMOD:188	ms_run[2]:scan=7556	48.748	2	2062.0215	2062.0215	K	M	4762	4780
PSM	VLISSLKDCLHGIEAK	273	sp|Q8N684-2|CPSF7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	7-UNIMOD:188,9-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=7683	49.545	2	1794.0112	1794.0112	R	S	382	398
PSM	VNKDSLTDLYVQHAIPLPQR	274	sp|Q9BVC5-2|ASHWN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=8423	54.328	2	2306.2383	2306.2383	R	D	82	102
PSM	VPTISINKTDGCHAYLSK	275	sp|Q01518-2|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	8-UNIMOD:188,12-UNIMOD:4,18-UNIMOD:188	ms_run[2]:scan=5294	34.692	2	2015.0549	2015.0549	K	N	404	422
PSM	YGDGGSTFQSTTGHCVHMR	276	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	15-UNIMOD:4,19-UNIMOD:267	ms_run[2]:scan=3762	25.455	2	2106.8875	2106.8875	R	G	276	295
PSM	YLVALGHAYHPEEFVCSQCGK	277	sp|Q9NR12-2|PDLI7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	16-UNIMOD:4,19-UNIMOD:4,21-UNIMOD:188	ms_run[2]:scan=7500	48.392	2	2470.1505	2470.1505	R	V	259	280
PSM	QLFHPEQLITGKEDAANNYAR	278	sp|P68366|TBA4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:28	ms_run[1]:scan=9102	58.73092166666667	3	2397.1717	2397.1708	R	G	85	106
PSM	QLPAHDQDPSKCHELSPR	279	sp|Q9UGI8|TES_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:28,11-UNIMOD:188,12-UNIMOD:4,18-UNIMOD:267	ms_run[1]:scan=3861	26.06696	2	2112.9975	2112.9977	K	E	153	171
PSM	VFLENVIRDAVTYTEHAK	280	sp|P62805|H4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	8-UNIMOD:267,18-UNIMOD:188	ms_run[1]:scan=12088	79.52928166666666	2	2120.114415	2120.123702	K	R	61	79
PSM	DQFLDTLQAHGHDVNSFVR	281	sp|Q15021|CND1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	19-UNIMOD:267	ms_run[1]:scan=8626	55.63074666666667	2	2209.067675	2208.058749	R	S	363	382
PSM	AHKGSTLSQWSLGNGTPVTSK	282	sp|Q7Z2K6|ERMP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=5682	37.072	2	2155.1022	2155.1022	R	G	806	827
PSM	AHQKELAAQLNEEAK	283	sp|Q9Y5B9|SP16H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=2444	17.181	2	1678.8638	1678.8638	R	R	476	491
PSM	AHQVVEDGYEFFAKR	284	sp|P62136-3|PP1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=6823	44.173	2	1794.8689	1794.8689	R	Q	203	218
PSM	APPNATLEHFYLTSGKQPK	285	sp|Q96G23|CERS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=6158	39.994	2	2098.0847	2098.0847	R	Q	78	97
PSM	ASIHEAWTDGKEAMLR	286	sp|P12814-2|ACTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=6099	39.61	2	1813.8781	1813.8781	K	Q	403	419
PSM	AVIQHFQEKVESLEQEAANER	287	sp|P05067-10|A4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=8837	57.035	2	2454.2139	2454.2139	K	Q	299	320
PSM	CERPLQGYSVEYQLLNGGELHR	288	sp|P16144-4|ITB4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:4	ms_run[2]:scan=8725	56.276	3	2617.2707	2617.2707	R	L	1483	1505
PSM	DFNHINVELSLLGKK	289	sp|P32969|RL9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=9007	58.124	2	1725.9414	1725.9414	R	K	37	52
PSM	DVHNIYGLYVHMATADGLR	290	sp|Q14697|GANAB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=10478	67.834	2	2144.0473	2144.0473	R	Q	570	589
PSM	EGHPVTSEPSRPEPAVFK	291	sp|Q16762|THTR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=3878	26.17	2	1962.9799	1962.9799	K	A	137	155
PSM	EYGSCSHHYQQLLQSLEQGAQEESR	292	sp|Q15149-3|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	5-UNIMOD:4	ms_run[2]:scan=8937	57.673	3	2963.3104	2963.3104	R	C	980	1005
PSM	EYGSCSHHYQQLLQSLEQGAQEESR	293	sp|Q15149-3|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	5-UNIMOD:4	ms_run[2]:scan=8941	57.699	2	2963.3104	2963.3104	R	C	980	1005
PSM	FAIGSQVSEHSIIKDFTK	294	sp|P33992|MCM5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	14-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=8521	54.943	2	2018.0875	2018.0875	R	Q	683	701
PSM	FAIGSQVSEHSIIKDFTK	295	sp|P33992|MCM5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=8523	54.955	2	2006.0473	2006.0473	R	Q	683	701
PSM	FQSSHHPTDITSLDQYVER	296	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	19-UNIMOD:267	ms_run[2]:scan=6754	43.735	3	2269.0639	2269.0639	R	M	512	531
PSM	GEHSIVYLKPSYAFGSVGK	297	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	9-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=7231	46.708	2	2050.0926	2050.0926	K	E	214	233
PSM	GFGFVTFDDHDPVDKIVLQK	298	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=10297	66.593	2	2276.1477	2276.1477	R	Y	142	162
PSM	GFGFVYFQNHDAADKAAVVK	299	sp|Q13151|ROA0_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=7843	50.542	2	2195.1202	2195.1202	R	F	140	160
PSM	GHYTIGKEIIDPVLDR	300	sp|P68366-2|TBA4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=7352	47.474	2	1824.9734	1824.9734	R	I	91	107
PSM	HGNLEEAEHLLQDAIK	301	sp|Q86UA1-2|PRP39_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	16-UNIMOD:188	ms_run[2]:scan=9577	61.871	3	1821.9317	1821.9317	R	N	72	88
PSM	HSELLQKVEPLQK	302	sp|Q9Y2Q9|RT28_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=4591	30.439	2	1547.8671	1547.8671	R	G	59	72
PSM	HTGYVIELQHVVK	303	sp|P47897-2|SYQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	13-UNIMOD:188	ms_run[2]:scan=5770	37.62	2	1527.8505	1527.8505	R	G	629	642
PSM	HWVAPGGPYSAETPGVPSPIAALK	304	sp|Q8IU81|I2BP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=9150	59.034	2	2401.243	2401.2430	R	N	404	428
PSM	HYGGLTGLNKAETAAK	305	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	10-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=3305	22.372	2	1641.8877	1641.8877	R	H	91	107
PSM	IADPEHDHTGFLTEYVATR	306	sp|P27361-2|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=7168	46.328	2	2171.0283	2171.0283	R	W	190	209
PSM	IKSDHPGISITDLSK	307	sp|Q08945|SSRP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=5130	33.703	2	1609.8675	1609.8675	K	K	565	580
PSM	IKSDHPGISITDLSK	308	sp|Q08945|SSRP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=5144	33.789	2	1621.9078	1621.9078	K	K	565	580
PSM	IKSEHPGLSIGDTAK	309	sp|P26583|HMGB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=2736	18.876	2	1551.8257	1551.8257	K	K	113	128
PSM	KHGLEVIYMIEPIDEYCVQQLK	310	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:188,9-UNIMOD:35,17-UNIMOD:4,22-UNIMOD:188	ms_run[2]:scan=9674	62.499	3	2732.3956	2732.3956	R	E	513	535
PSM	KHGLEVIYMIEPIDEYCVQQLK	311	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	17-UNIMOD:4	ms_run[2]:scan=10824	70.191	3	2704.3604	2704.3604	R	E	513	535
PSM	KITVPGNFQGHSGAQCITCSYK	312	sp|Q08945|SSRP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	16-UNIMOD:4,19-UNIMOD:4	ms_run[2]:scan=5560	36.319	3	2452.1627	2452.1627	R	A	325	347
PSM	KMQAHIQDLEEQLDEEEGAR	313	sp|P35580|MYH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=7070	45.723	2	2368.0965	2368.0965	K	Q	947	967
PSM	LEMYNILKAEHDSILAEK	314	sp|P26639|SYTC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	8-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=9920	64.12	2	2128.1277	2128.1277	R	A	58	76
PSM	LHQEYVPSAHLSGTCTCLAWAPAR	315	sp|Q15061|WDR43_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:4,17-UNIMOD:4	ms_run[2]:scan=7334	47.352	2	2724.2901	2724.2901	R	L	48	72
PSM	LRGWEAFLNAPEANR	316	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:267,15-UNIMOD:267	ms_run[2]:scan=9117	58.823	2	1762.9018	1762.9018	R	G	366	381
PSM	LTLYDIAHTPGVAADLSHIETK	317	sp|P40926-2|MDHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=10474	67.809	2	2364.2325	2364.2325	R	A	53	75
PSM	LVLEMVHHNTASLEK	318	sp|Q9UIG0-2|BAZ1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:188	ms_run[2]:scan=5552	36.271	2	1725.9179	1725.9179	K	L	87	102
PSM	LVSNHSLHETSSVFVDSLTK	319	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	20-UNIMOD:188	ms_run[2]:scan=7120	46.04	3	2205.1373	2205.1373	R	A	2513	2533
PSM	MHEDINEEWISDKTR	320	sp|P28331-3|NDUS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:35	ms_run[2]:scan=5078	33.392	2	1917.8527	1917.8527	R	F	166	181
PSM	MIPCDFLIPVQTQHPIR	321	sp|P06744|G6PI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:35,4-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=9140	58.97	2	2090.0681	2090.0681	K	K	401	418
PSM	NHIILQENAQHATR	322	sp|Q69YN2-3|C19L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=2156	15.512	2	1643.8492	1643.8492	R	F	72	86
PSM	NIDDGTSDRPYSHALVAGIDR	323	sp|P61353|RL27_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	9-UNIMOD:267,21-UNIMOD:267	ms_run[2]:scan=5870	38.245	2	2291.1045	2291.1045	K	Y	28	49
PSM	NIDDGTSDRPYSHALVAGIDR	324	sp|P61353|RL27_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=5877	38.288	2	2271.088	2271.0880	K	Y	28	49
PSM	PKFYCDYCDTYLTHDSPSVR	325	sp|P09234|RU1C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	5-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=6670	43.213	2	2523.0835	2523.0835	M	K	2	22
PSM	QDLPNAMNAAEITDKLGLHSLR	326	sp|P61204-2|ARF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=10051	64.983	2	2406.2325	2406.2325	K	H	91	113
PSM	SCPVVQSSQHLFLDLPKLEK	327	sp|P56192-2|SYMC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:4,17-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=9644	62.301	2	2336.2601	2336.2601	R	R	440	460
PSM	SGVYQHVTGEMMGGHAIR	328	sp|P07858|CATB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=5668	36.983	3	1928.8985	1928.8985	K	I	264	282
PSM	SHFEQWGTLTDCVVMRDPNTK	329	sp|P09651-3|ROA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	12-UNIMOD:4	ms_run[2]:scan=8175	52.745	2	2520.1526	2520.1526	R	R	32	53
PSM	SHLMSLYSACSSEVPHGPVDQK	330	sp|O95816-2|BAG2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	10-UNIMOD:4,22-UNIMOD:188	ms_run[2]:scan=6324	41.033	2	2434.1353	2434.1353	K	F	100	122
PSM	SIYGEKFEDENFILK	331	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=8711	56.189	2	1830.904	1830.9040	K	H	77	92
PSM	SKGLAPDLPEDLYHLIK	332	sp|P62277|RS13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=10695	69.321	2	1908.0357	1908.0357	K	K	77	94
PSM	SLHSCSVKGEEEVFLIGK	333	sp|O94916-2|NFAT5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	5-UNIMOD:4,8-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=6715	43.493	2	2030.0545	2030.0545	K	N	375	393
PSM	SPAPPLLHVAALGQK	334	sp|Q8N163-2|CCAR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:188	ms_run[2]:scan=7249	46.814	2	1503.8869	1503.8869	K	Q	124	139
PSM	SYEALVQHVIEDHER	335	sp|Q9H2P0|ADNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:267	ms_run[2]:scan=8479	54.677	2	1833.8885	1833.8885	K	I	232	247
PSM	SYEALVQHVIEDHER	336	sp|Q9H2P0|ADNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=8478	54.671	2	1823.8802	1823.8802	K	I	232	247
PSM	TGVHHYSGNNIELGTACGK	337	sp|P62888|RL30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	17-UNIMOD:4,19-UNIMOD:188	ms_run[2]:scan=3132	21.272	2	2019.9528	2019.9528	K	Y	69	88
PSM	TPELNLDQFHDKTPYTIMFGPDK	338	sp|P27824-3|CALX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=10617	68.8	2	2706.3	2706.3000	K	C	63	86
PSM	TREGNDLYHEMIESGVINLK	339	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=9729	62.861	3	2317.1372	2317.1372	R	D	240	260
PSM	VHPNSVHICAVVVEYETK	340	sp|P16435|NCPR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	9-UNIMOD:4	ms_run[2]:scan=6480	42.035	2	2080.0412	2080.0412	K	A	464	482
PSM	VIHDNFGIVEGLMTTVHAITATQK	341	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	13-UNIMOD:35,24-UNIMOD:188	ms_run[2]:scan=11665	76.21	2	2616.3677	2616.3677	K	T	163	187
PSM	VQKHQAFEAELSANQSR	342	sp|Q13813-2|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=3115	21.166	2	1941.9657	1941.9657	K	I	611	628
PSM	VSGFTFSHHPGQYNLCATSSDDGTVK	343	sp|Q8TEQ6|GEMI5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	16-UNIMOD:4,26-UNIMOD:188	ms_run[2]:scan=6408	41.578	3	2817.276	2817.2760	R	I	67	93
PSM	VTWYCCGPTVYDASHMGHAR	344	sp|P49589-3|SYCC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	5-UNIMOD:4,6-UNIMOD:4,20-UNIMOD:267	ms_run[2]:scan=6883	44.557	2	2377.0066	2377.0066	K	S	133	153
PSM	YGDGGSSFQSTTGHCVHMR	345	sp|P55795|HNRH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:4,19-UNIMOD:267	ms_run[2]:scan=3600	24.445	2	2092.8719	2092.8719	R	G	276	295
PSM	YHVPVVVVPEGSASDTHEQAILR	346	sp|P04844-2|RPN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	23-UNIMOD:267	ms_run[2]:scan=7272	46.954	3	2512.295	2512.2950	R	L	235	258
PSM	YKPVCNQVECHPYFNR	347	sp|P42330|AK1C3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	5-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=4408	29.377	2	2109.9513	2109.9513	K	S	184	200
PSM	YSHLQPGDHLTDITLK	348	sp|Q15046|SYK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	16-UNIMOD:188	ms_run[2]:scan=6017	39.14	2	1842.9571	1842.9571	K	V	112	128
PSM	QLFHPEQLITGKEDAANNYAR	349	sp|P68366|TBA4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:28,12-UNIMOD:188,21-UNIMOD:267	ms_run[1]:scan=9119	58.838919999999995	3	2413.2005	2413.1992	R	G	85	106
PSM	QLFHPEQLITGKEDAANNYAR	350	sp|P68366|TBA4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:28	ms_run[1]:scan=9107	58.760533333333335	2	2397.1708	2397.1708	R	G	85	106
PSM	ACQSIYPLHDVFVRK	351	sp|P61247|RS3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:4	ms_run[2]:scan=6992	45.24	2	1831.9403	1831.9403	K	V	200	215
PSM	AEVQKLQMEAPHIIVGTPGR	352	sp|P60842-2|IF4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=7014	45.38	2	2173.1678	2173.1678	R	V	142	162
PSM	AHQKELAAQLNEEAK	353	sp|Q9Y5B9|SP16H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=2445	17.186	2	1690.9041	1690.9041	R	R	476	491
PSM	AHQTGIHATEELKEFFAK	354	sp|Q6IBS0|TWF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:1,13-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=8852	57.134	3	2110.0886	2110.0886	M	A	2	20
PSM	AHQVVEDGYEFFAKR	355	sp|P62136-3|PP1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=6815	44.123	3	1794.8689	1794.8689	R	Q	203	218
PSM	AVHTVDFTADKYHVVSGADDYTVK	356	sp|Q8TED0-3|UTP15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=6384	41.425	3	2637.2711	2637.2711	K	L	105	129
PSM	DFNHINVELSLLGKK	357	sp|P32969|RL9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=9016	58.179	2	1737.9816	1737.9816	R	K	37	52
PSM	ELVTQQLPHLLKDVGSLDEK	358	sp|Q99584|S10AD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	12-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=10260	66.353	2	2273.267	2273.2670	K	M	40	60
PSM	FFHPEEWADLFQAAGAK	359	sp|P04066|FUCO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	17-UNIMOD:188	ms_run[2]:scan=11678	76.308	2	1968.9466	1968.9466	R	Y	114	131
PSM	GFAFVTFDDHDSVDKIVIQK	360	sp|P09651-3|ROA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9855	63.685	2	2280.1426	2280.1426	R	Y	147	167
PSM	GGVHLTKDPNVVGQLAK	361	sp|Q96I99|SUCB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=5091	33.47	2	1731.9632	1731.9632	K	Q	102	119
PSM	GIHQSTIDLKNELK	362	sp|Q14258|TRI25_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	10-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=4883	32.209	2	1606.9081	1606.9081	K	Q	336	350
PSM	GVNTVFHCASPPPSSNNKELFYR	363	sp|Q15738|NSDHL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	8-UNIMOD:4	ms_run[2]:scan=6494	42.124	3	2620.2493	2620.2493	K	V	97	120
PSM	HDPNMKYELQLANPK	364	sp|Q6P2Q9|PRP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=5304	34.752	2	1796.888	1796.8880	R	E	2288	2303
PSM	HIDYFNNQIIVDLVEQQHK	365	sp|O94832|MYO1D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	19-UNIMOD:188	ms_run[2]:scan=10968	71.168	2	2358.2064	2358.2064	K	G	432	451
PSM	HIQQVDCSGNDLEQLHIK	366	sp|P52948-6|NUP98_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	7-UNIMOD:4	ms_run[2]:scan=5704	37.209	3	2133.0273	2133.0273	R	V	1602	1620
PSM	HLIPAANTGESKVFYYK	367	sp|P62258-2|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=5811	37.873	2	1937.0047	1937.0047	K	M	85	102
PSM	HQGVMVGMGQKDSYVGDEAQSK	368	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=4293	28.684	3	2350.0682	2350.0682	R	R	40	62
PSM	HTTSIFDDFSHYEK	369	sp|Q9Y5A9-2|YTHD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:188	ms_run[2]:scan=7787	50.2	2	1731.7836	1731.7836	K	R	499	513
PSM	HVAVTNMNEHSSR	370	sp|P33176|KINH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=1047	9.0334	2	1480.6841	1480.6841	R	S	191	204
PSM	HYGGLTGLNKAETAAK	371	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=3530	24	2	1629.8475	1629.8475	R	H	91	107
PSM	IDTHNIIVNQLVFPDPEKPCK	372	sp|O43681|ASNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	18-UNIMOD:188,20-UNIMOD:4,21-UNIMOD:188	ms_run[2]:scan=9165	59.131	2	2488.3187	2488.3187	K	M	270	291
PSM	IPGMLIIDTPGHESFSNLR	373	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9839	63.581	2	2096.0725	2096.0725	R	N	695	714
PSM	KFLDTSHYSTAGSSSVR	374	sp|Q96A65|EXOC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=4049	27.205	2	1841.8908	1841.8908	R	E	240	257
PSM	KHPDASVNFSEFSK	375	sp|P09429|HMGB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=4985	32.819	2	1591.7631	1591.7631	K	K	30	44
PSM	KLDAGNQLALIEELHK	376	sp|Q92616|GCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=7913	50.965	2	1803.0293	1803.0293	K	E	2222	2238
PSM	MDIDAPDVDVHGPDWHLK	377	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	18-UNIMOD:188	ms_run[2]:scan=8159	52.645	2	2064.9671	2064.9671	K	M	2030	2048
PSM	NHDHQEIAVPVANLK	378	sp|O75607|NPM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	15-UNIMOD:188	ms_run[2]:scan=5002	32.92	2	1689.8894	1689.8894	R	L	88	103
PSM	NLPLADQGSSHHITVK	379	sp|P15924|DESP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	16-UNIMOD:188	ms_run[2]:scan=4095	27.494	2	1721.9156	1721.9156	K	I	690	706
PSM	NVTKDHIMEIFSTYGK	380	sp|Q15287-3|RNPS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=8630	55.659	2	1881.9295	1881.9295	R	I	134	150
PSM	NVTKDHIMEIFSTYGK	381	sp|Q15287-3|RNPS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=8632	55.67	2	1893.9697	1893.9697	R	I	134	150
PSM	PPSAFFLFCSEYRPK	382	sp|P09429|HMGB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	9-UNIMOD:4	ms_run[2]:scan=10487	67.893	2	1844.892	1844.8920	R	I	98	113
PSM	QDLPNAMNAAEITDKLGLHSLR	383	sp|P61204-2|ARF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=10050	64.977	3	2406.2325	2406.2325	K	H	91	113
PSM	RGPGPVDLLLCCGDFQAVR	384	sp|Q9UK59|DBR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	11-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=10348	66.941	2	2129.051	2129.0510	R	N	26	45
PSM	SCPVVQSSQHLFLDLPKLEK	385	sp|P56192-2|SYMC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:4	ms_run[2]:scan=9649	62.335	2	2324.2199	2324.2199	R	R	440	460
PSM	SIYGEKFEDENFILK	386	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=8709	56.173	2	1842.9442	1842.9442	K	H	77	92
PSM	SLHQFLLEPITCHAWNR	387	sp|Q92747|ARC1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:1,12-UNIMOD:4	ms_run[2]:scan=11097	72.03	3	2163.0684	2163.0684	M	D	2	19
PSM	SLHSCSVKGEEEVFLIGK	388	sp|O94916-2|NFAT5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	5-UNIMOD:4	ms_run[2]:scan=6721	43.533	2	2018.0143	2018.0143	K	N	375	393
PSM	SLQEEHVAVAQLREEAER	389	sp|Q15149-3|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	13-UNIMOD:267,18-UNIMOD:267	ms_run[2]:scan=5759	37.555	2	2113.0667	2113.0667	R	R	1618	1636
PSM	SVEMHHEALSEALPGDNVGFNVK	390	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:35	ms_run[2]:scan=6892	44.616	2	2495.1751	2495.1751	K	N	291	314
PSM	SVEMHHEALSEALPGDNVGFNVK	391	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:35,23-UNIMOD:188	ms_run[2]:scan=6896	44.644	2	2501.1952	2501.1952	K	N	291	314
PSM	SVEMHHEALSEALPGDNVGFNVK	392	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=7282	47.016	2	2479.1802	2479.1802	K	N	291	314
PSM	TFVPAMTAIHGPPITAPVVCTR	393	sp|Q96RN5-3|MED15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	20-UNIMOD:4	ms_run[2]:scan=9578	61.877	3	2335.2181	2335.2181	R	K	530	552
PSM	TIKVWQLGSSSPNFTLEGHEK	394	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:188,21-UNIMOD:188	ms_run[2]:scan=8418	54.294	2	2369.2418	2369.2418	R	G	137	158
PSM	TLEGELHDLRGQVAK	395	sp|P02545-5|LMNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=6544	42.436	2	1664.8846	1664.8846	R	L	58	73
PSM	TSGHVDKFADFMVK	396	sp|P41250|GARS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=6061	39.404	2	1580.7657	1580.7657	K	D	191	205
PSM	TYSECEDGTYSPEISWHHR	397	sp|P48651-3|PTSS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	5-UNIMOD:4	ms_run[2]:scan=5490	35.891	2	2352.9706	2352.9706	K	K	212	231
PSM	VHELNEEIGKLLAK	398	sp|Q9Y383-3|LC7L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=7678	49.52	2	1591.8934	1591.8934	R	V	123	137
PSM	VIISAPSADAPMFVMGVNHEKYDNSLK	399	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9241	59.617	2	2932.4463	2932.4463	R	I	119	146
PSM	VLISSLKDCLHGIEAK	400	sp|Q8N684-2|CPSF7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	9-UNIMOD:4	ms_run[2]:scan=7684	49.551	2	1781.971	1781.9710	R	S	382	398
PSM	YGDGGSTFQSTTGHCVHMR	401	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	15-UNIMOD:4	ms_run[2]:scan=3769	25.498	2	2096.8793	2096.8793	R	G	276	295
PSM	THINIVVIGHVDSGK	402	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=6007	39.078340000000004	2	1587.873088	1587.873290	K	S	6	21
PSM	KVTHAVVTVPAYFNDAQR	403	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=5957	38.76144	2	2016.061296	2015.058859	K	Q	164	182
PSM	MHDLNTDQENLVGTHDAPIR	404	sp|O43684|BUB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=5407	35.385238333333334	3	2276.070901	2275.065143	K	C	81	101
PSM	LGEEAFFYHSNCKEPGIAGLMK	405	sp|Q9P016|THYN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	12-UNIMOD:4	ms_run[1]:scan=9047	58.37694499999999	2	2497.171013	2497.177002	K	I	107	129
PSM	AAPRPAPVAQPPAAAPPSAVGSSAAAPR	406	sp|Q9Y6H1|CHCH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=4655	30.811	2	2532.3561	2532.3561	R	Q	24	52
PSM	AAVHLEGKIEQAQR	407	sp|P18206|VINC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=2693	18.645	2	1548.8372	1548.8372	K	W	489	503
PSM	AEVQKLQMEAPHIIVGTPGR	408	sp|P60842-2|IF4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=7007	45.336	3	2173.1678	2173.1678	R	V	142	162
PSM	AVEHINKTIAPALVSK	409	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=4430	29.508	2	1689.9778	1689.9778	K	K	65	81
PSM	CKAEHDQLLLNYAK	410	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:4,2-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=4845	31.974	2	1713.8911	1713.8911	K	K	110	124
PSM	DTSFEQHVLWHTGGK	411	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	15-UNIMOD:188	ms_run[2]:scan=6172	40.083	2	1746.8421	1746.8421	R	G	1725	1740
PSM	FQAHQQQGNKAEK	412	sp|Q9HCU5|PREB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=525	6.0795	2	1512.7433	1512.7433	R	A	95	108
PSM	FVIHCNSPVWGADKCEELLEK	413	sp|O75367-2|H2AY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	5-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=7877	50.746	2	2530.1985	2530.1985	K	T	269	290
PSM	GFGFVTFDDHDPVDKIVLQK	414	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	15-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=10449	67.642	2	2288.188	2288.1880	R	Y	142	162
PSM	GFGFVTFDDHDPVDKIVLQK	415	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=10295	66.584	3	2276.1477	2276.1477	R	Y	142	162
PSM	GFGFVTFDDHDPVDKIVLQK	416	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=10443	67.601	2	2276.1477	2276.1477	R	Y	142	162
PSM	GKITDLANLSAANHDAAIFPGGFGAAK	417	sp|P0DPI2-2|GAL3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=9568	61.814	3	2626.3503	2626.3503	R	N	115	142
PSM	GLKYQEGGVESAFHK	418	sp|P40121-2|CAPG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=4492	29.862	2	1660.8612	1660.8612	R	T	113	128
PSM	GQEETPSWEHILFTCCHNR	419	sp|Q8TCD5|NT5C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	15-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=8785	56.692	2	2400.0375	2400.0375	R	H	151	170
PSM	GQSLGYAFAEFQEHEHALK	420	sp|Q9NW13-2|RBM28_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=8909	57.496	2	2161.0229	2161.0229	K	A	396	415
PSM	HAAEVARDNLAEELEGVAGR	421	sp|P48681|NEST_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=7700	49.653	3	2106.0454	2106.0454	K	C	75	95
PSM	HAPINSAQHLDNVDQTGPK	422	sp|O43159|RRP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=2791	19.221	3	2040.9977	2040.9977	K	A	139	158
PSM	HIDSAHLYNNEEQVGLAIR	423	sp|Q04828|AK1C1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=6426	41.694	3	2178.0818	2178.0818	R	S	48	67
PSM	HIGYDDSSKGFDYK	424	sp|P31153-2|METK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	9-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=4175	27.975	2	1642.7666	1642.7666	K	T	26	40
PSM	HIPGAAFFDIDQCSDR	425	sp|P25325|THTM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	13-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=8633	55.676	2	1857.8344	1857.8344	R	T	53	69
PSM	HLCQQLQAEQAAAEKR	426	sp|Q14980-4|NUMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:4	ms_run[2]:scan=3570	24.264	3	1879.9323	1879.9323	K	H	1365	1381
PSM	HLIPAANTGESKVFYYK	427	sp|P62258-2|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=5810	37.867	3	1937.0047	1937.0047	K	M	85	102
PSM	HTGYVIELQHVVK	428	sp|P47897-2|SYQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=5775	37.65	2	1521.8304	1521.8304	R	G	629	642
PSM	HTTSIFDDFAHYEK	429	sp|Q9BYJ9|YTHD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	14-UNIMOD:188	ms_run[2]:scan=8185	52.81	2	1715.7887	1715.7887	K	R	528	542
PSM	IGGVQQDTILAEGLHFR	430	sp|Q99623-2|PHB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	17-UNIMOD:267	ms_run[2]:scan=9330	60.215	3	1862.9878	1862.9878	R	I	55	72
PSM	IKGCWDSIHVVEVQEK	431	sp|P47756-2|CAPZB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	4-UNIMOD:4	ms_run[2]:scan=6385	41.431	2	1925.9669	1925.9669	K	S	144	160
PSM	KAIIIFVPVPQLK	432	sp|P62081|RS7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=10301	66.613	2	1464.9432	1464.9432	R	S	58	71
PSM	KHTLSYVDVGTGK	433	sp|P31040-3|SDHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=2916	19.995	2	1415.7811	1415.7811	R	V	479	492
PSM	KMQAHIQDLEEQLDEEEGAR	434	sp|P35580|MYH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=7071	45.729	3	2368.0965	2368.0965	K	Q	947	967
PSM	KQELEEILHDLESR	435	sp|P35580|MYH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=10342	66.901	2	1737.8897	1737.8897	K	V	917	931
PSM	KVMSQNFTNCHTK	436	sp|Q13283-2|G3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:188,10-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=1561	11.993	2	1605.7794	1605.7794	R	I	64	77
PSM	KVMSQNFTNCHTK	437	sp|Q13283-2|G3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	10-UNIMOD:4	ms_run[2]:scan=1565	12.016	2	1593.7392	1593.7392	R	I	64	77
PSM	LEMYNILKAEHDSILAEK	438	sp|P26639|SYTC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=9918	64.108	2	2116.0874	2116.0874	R	A	58	76
PSM	LGHAEQKDEMVPR	439	sp|Q9P258|RCC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=1724	12.921	2	1508.7406	1508.7406	R	L	362	375
PSM	LHFDNCVLKPATEGK	440	sp|Q5T9A4-3|ATD3B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:4	ms_run[2]:scan=5195	34.09	2	1727.8665	1727.8665	R	R	441	456
PSM	LKGIEEEEILPGFILCDPNNLCHSGR	441	sp|P15170|ERF3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	16-UNIMOD:4,22-UNIMOD:4	ms_run[2]:scan=10897	70.692	3	3009.4688	3009.4688	R	T	366	392
PSM	LKGTVGEPTYDAEFQHFLR	442	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=8460	54.559	3	2207.1011	2207.1011	K	G	3892	3911
PSM	LTLYDIAHTPGVAADLSHIETK	443	sp|P40926-2|MDHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=10468	67.768	3	2364.2325	2364.2325	R	A	53	75
PSM	LVLEMVHHNTASLEK	444	sp|Q9UIG0-2|BAZ1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=5554	36.282	2	1719.8978	1719.8978	K	L	87	102
PSM	MKPLVVFVLGGPGAGK	445	sp|P30085-2|KCY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=10002	64.662	2	1568.9113	1568.9113	-	G	1	17
PSM	NAEFDRHEIQIYEEVAK	446	sp|Q9NZW5|MPP6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=7207	46.562	2	2090.0069	2090.0069	R	M	316	333
PSM	NIDDGTSDRPYSHALVAGIDR	447	sp|P61353|RL27_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	9-UNIMOD:267,21-UNIMOD:267	ms_run[2]:scan=5873	38.268	3	2291.1045	2291.1045	K	Y	28	49
PSM	NLSTVMDEIHTVLKK	448	sp|Q8IX12-2|CCAR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=10650	69.017	2	1726.9288	1726.9288	R	D	1102	1117
PSM	NNRQPYAVSELAGHQTSAESWGTGR	449	sp|P36578|RL4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=6008	39.084	2	2715.275	2715.2750	K	A	47	72
PSM	NSKHEELMLGDPCLK	450	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	13-UNIMOD:4	ms_run[2]:scan=5284	34.63	2	1769.844	1769.8440	K	D	648	663
PSM	RVEHNQSYSQAGITETEWTSGSSK	451	sp|P42167|LAP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=4767	31.486	2	2681.2318	2681.2318	R	G	216	240
PSM	RYESHPVCADLQAK	452	sp|Q9NX63|MIC19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	8-UNIMOD:4	ms_run[2]:scan=2319	16.449	2	1672.7991	1672.7991	K	I	176	190
PSM	SHEQVLEEMLEAGLDPSQRPK	453	sp|Q8WVB6|CTF18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=10222	66.11	3	2392.1693	2392.1693	K	Q	346	367
PSM	SHLVHGSSPGVMGTSVATSASK	454	sp|P35658-2|NU214_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	22-UNIMOD:188	ms_run[2]:scan=3543	24.09	3	2102.0522	2102.0522	K	I	1027	1049
PSM	SHYKVGENADSQIK	455	sp|P07305-2|H10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	4-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=1622	12.351	2	1586.8091	1586.8091	K	L	39	53
PSM	SHYKVGENADSQIK	456	sp|P07305-2|H10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=1623	12.356	2	1574.7689	1574.7689	K	L	39	53
PSM	SLHQFLLEPITCHAWNR	457	sp|Q92747|ARC1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:1,12-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=11109	72.113	2	2173.0766	2173.0766	M	D	2	19
PSM	SPTLYGISHDDLKGDPLLDQR	458	sp|O75643|U520_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=8311	53.619	2	2339.1757	2339.1757	R	R	932	953
PSM	SQLGAHHTTPVGDGAAGTR	459	sp|Q5BJD5-3|TM41B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	19-UNIMOD:267	ms_run[2]:scan=1524	11.767	2	1841.9008	1841.9008	R	G	10	29
PSM	STANKYQVFFFGTHETAFLGPK	460	sp|P51858-2|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=10110	65.365	3	2489.2379	2489.2379	K	D	33	55
PSM	STANKYQVFFFGTHETAFLGPK	461	sp|P51858-2|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=10129	65.491	2	2489.2379	2489.2379	K	D	33	55
PSM	TGTITTFEHAHNMR	462	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	13-UNIMOD:35,14-UNIMOD:267	ms_run[2]:scan=2446	17.191	2	1640.7605	1640.7605	K	V	482	496
PSM	TIKVWQLGSSSPNFTLEGHEK	463	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:188,21-UNIMOD:188	ms_run[2]:scan=8430	54.374	3	2369.2418	2369.2418	R	G	137	158
PSM	TREEECHFYAGGQVYPGEASR	464	sp|Q13162|PRDX4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:267,6-UNIMOD:4,21-UNIMOD:267	ms_run[2]:scan=4806	31.73	3	2462.0824	2462.0824	R	V	46	67
PSM	TSGHVDKFADFMVK	465	sp|P41250|GARS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	7-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=6059	39.395	2	1592.806	1592.8060	K	D	191	205
PSM	TVLQRPLSLIQGPPGTGK	466	sp|Q92900-2|RENT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=7921	51.016	2	1861.0785	1861.0785	K	T	481	499
PSM	TYSECEDGTYSPEISWHHR	467	sp|P48651-3|PTSS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	5-UNIMOD:4,19-UNIMOD:267	ms_run[2]:scan=5489	35.885	2	2362.9788	2362.9788	K	K	212	231
PSM	YAEIVHLTLPDGTKR	468	sp|P21281|VATB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=6954	45.005	2	1711.9257	1711.9257	R	S	68	83
PSM	YGDGGSTFQSTTGHCVHMR	469	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	15-UNIMOD:4	ms_run[2]:scan=3757	25.425	2	2096.8793	2096.8793	R	G	276	295
PSM	YLVALGHAYHPEEFVCSQCGK	470	sp|Q9NR12-2|PDLI7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	16-UNIMOD:4,19-UNIMOD:4,21-UNIMOD:188	ms_run[2]:scan=7502	48.405	3	2470.1505	2470.1505	R	V	259	280
PSM	YQGKADAPVALVVHMAPASVLVDSR	471	sp|Q9BQ52-2|RNZ2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=10114	65.395	3	2593.3686	2593.3686	R	Y	235	260
PSM	YSHLQPGDHLTDITLK	472	sp|Q15046|SYK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=6015	39.128	2	1836.937	1836.9370	K	V	112	128
PSM	DGQVHLFEHILNGYCK	473	sp|Q15061|WDR43_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	15-UNIMOD:4,16-UNIMOD:188	ms_run[1]:scan=8439	54.427865000000004	2	1935.924057	1934.940446	R	K	293	309
PSM	CRDDSFFGETSHNYHK	474	sp|P43243|MATR3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:267,16-UNIMOD:188	ms_run[1]:scan=5168	33.927953333333335	2	1997.8315	1997.8292	R	F	230	246
PSM	VLKQVHPDTGISSK	475	sp|Q96A08|H2B1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	3-UNIMOD:188,14-UNIMOD:188	ms_run[1]:scan=1937	14.136814999999999	2	1519.877435	1519.876100	K	A	46	60
PSM	IGTHNGTFHCDEALACALLR	476	sp|Q9HB07|MYG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	10-UNIMOD:4,16-UNIMOD:4,20-UNIMOD:267	ms_run[1]:scan=9432	60.914928333333336	2	2266.048402	2265.065825	R	L	47	67
PSM	ERDSASFNPELLTHILDGSPEK	477	sp|Q15067|ACOX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=10704	69.38094166666666	3	2455.197603	2454.202683	R	T	8	30
PSM	LREIELLCQEHGQENDDLVQR	478	sp|Q15555|MARE2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	8-UNIMOD:4	ms_run[1]:scan=6886	44.58020833333333	3	2594.267461	2593.255464	K	L	272	293
PSM	TVIVHGFTLGEKGEK	479	sp|Q9NSE4|SYIM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=5346	35.01225	2	1613.887683	1613.877707	K	M	650	665
PSM	QIFLGGVDKHTQFWR	480	sp|P12236|ADT3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:28,9-UNIMOD:188,15-UNIMOD:267	ms_run[1]:scan=10241	66.23026166666666	2	1829.9547	1829.9543	K	Y	97	112
PSM	TFTEMDSHEEKVFR	481	sp|P48444|COPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=4968	32.717675	2	1756.773914	1754.793385	R	A	132	146
PSM	AAIDWFDGKEFHGNIIK	482	sp|Q92804-2|RBP56_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	9-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=9481	61.239	2	1972.0246	1972.0246	K	V	295	312
PSM	ALPGQLKPFETLLSQNQGGK	483	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=10079	65.167	2	2137.1934	2137.1934	K	T	122	142
PSM	CLLDTFKHTDEEFLK	484	sp|Q9H0C8|ILKAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:4	ms_run[2]:scan=9256	59.716	2	1894.9135	1894.9135	R	Q	190	205
PSM	DNGLLAKPTHGDIIR	485	sp|P04181-2|OAT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=4955	32.644	2	1618.8791	1618.8791	R	F	261	276
PSM	EVDIGIPDATGRLEILQIHTK	486	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=10132	65.514	2	2317.2642	2317.2642	R	N	366	387
PSM	EYGSCSHHYQQLLQSLEQGAQEESR	487	sp|Q15149-3|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	5-UNIMOD:4,25-UNIMOD:267	ms_run[2]:scan=8934	57.657	2	2973.3187	2973.3187	R	C	980	1005
PSM	FIIHAPPGEFNEVFNDVR	488	sp|P47755|CAZA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	18-UNIMOD:267	ms_run[2]:scan=10505	68.01	2	2110.0511	2110.0511	K	L	20	38
PSM	FQSSHHPTDITSLDQYVER	489	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=6745	43.679	3	2259.0556	2259.0556	R	M	512	531
PSM	GKAHAAVWNAQEAQADFAK	490	sp|O00170|AIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=5225	34.273	3	2011.9864	2011.9864	R	V	272	291
PSM	GNDISSGTVLSDYVGSGPPKGTGLHR	491	sp|P30086|PEBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7153	46.241	2	2570.2725	2570.2725	K	Y	94	120
PSM	GQHEPSKPPPAGETVTGGFGAK	492	sp|Q9H6F5|CCD86_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=3464	23.541	2	2148.06	2148.0600	R	K	191	213
PSM	GVIVDKDFSHPQMPK	493	sp|P48643-2|TCPE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=5419	35.454	2	1708.9009	1708.9009	K	K	134	149
PSM	HCIMQANAEYHQSILAK	494	sp|Q8WUM4|PDC6I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=4874	32.155	3	2018.9762	2018.9762	K	Q	249	266
PSM	HDDRLNEESGALLQCALLYTSCAGQR	495	sp|P53992|SC24C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	15-UNIMOD:4,22-UNIMOD:4	ms_run[2]:scan=10916	70.818	3	2976.3818	2976.3818	K	R	795	821
PSM	HDGSEPCVDVLFGDGHR	496	sp|Q96EL3|RM53_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=6862	44.422	3	1905.8303	1905.8303	R	L	57	74
PSM	HDGSEPCVDVLFGDGHR	497	sp|Q96EL3|RM53_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=6865	44.439	2	1905.8303	1905.8303	R	L	57	74
PSM	HNIQFSSFDIFSDEEVRQGLK	498	sp|O76003|GLRX3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=10268	66.407	3	2495.2081	2495.2081	K	A	172	193
PSM	HNSILQLDPSIPGVFR	499	sp|Q9Y487|VPP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	16-UNIMOD:267	ms_run[2]:scan=10353	66.976	2	1801.9714	1801.9714	R	G	511	527
PSM	HQGVMVGMGQKDSYVGDEAQSK	500	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	11-UNIMOD:188,22-UNIMOD:188	ms_run[2]:scan=4297	28.707	2	2362.1084	2362.1084	R	R	40	62
PSM	HTTSIFDDFSHYEK	501	sp|Q9Y5A9-2|YTHD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7786	50.194	2	1725.7635	1725.7635	K	R	499	513
PSM	IADPEHDHTGFLTEYVATR	502	sp|P27361-2|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	19-UNIMOD:267	ms_run[2]:scan=7170	46.34	2	2181.0366	2181.0366	R	W	190	209
PSM	IGEEQSAEDAEDGPPELLFIHGGHTAK	503	sp|Q16576|RBBP7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	27-UNIMOD:188	ms_run[2]:scan=8057	51.957	2	2852.356	2852.3560	K	I	349	376
PSM	IPGMLIIDTPGHESFSNLR	504	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	19-UNIMOD:267	ms_run[2]:scan=9811	63.398	3	2106.0807	2106.0807	R	N	695	714
PSM	IPGMLIIDTPGHESFSNLR	505	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	19-UNIMOD:267	ms_run[2]:scan=9823	63.475	2	2106.0807	2106.0807	R	N	695	714
PSM	KHGLEVIYMIEPIDEYCVQQLK	506	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:188,17-UNIMOD:4,22-UNIMOD:188	ms_run[2]:scan=10812	70.107	3	2716.4007	2716.4007	R	E	513	535
PSM	KHPDSSVNFAEFSK	507	sp|P26583|HMGB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=4811	31.764	2	1591.7631	1591.7631	K	K	30	44
PSM	LDKSQIHDIVLVGGSTR	508	sp|P11142-2|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=6081	39.508	3	1837.0058	1837.0058	K	I	326	343
PSM	LGAQLADLHLDNKK	509	sp|Q9HA64|KT3K_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=5645	36.839	2	1534.8467	1534.8467	K	L	103	117
PSM	LHTLEEEKEELAQYQK	510	sp|Q9UQE7|SMC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=5750	37.499	3	1986.9898	1986.9898	R	W	200	216
PSM	LQFHNVKPECLEAYNK	511	sp|O75323|NIPS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:188,10-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=5698	37.17	2	2001.0181	2001.0181	K	I	76	92
PSM	MAQDLKDIIEHLNTSGAPADTSDPLQQICK	512	sp|P37198|NUP62_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:35,29-UNIMOD:4	ms_run[2]:scan=10635	68.919	3	3324.5966	3324.5966	R	I	447	477
PSM	MGPLGLDHMASSIER	513	sp|P52272-2|HNRPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:35	ms_run[2]:scan=6986	45.207	2	1628.7651	1628.7651	R	M	418	433
PSM	MKHYEVEILDAK	514	sp|Q9NZ01|TECR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=5218	34.229	2	1486.7893	1486.7893	-	T	1	13
PSM	NLPLADQGSSHHITVK	515	sp|P15924|DESP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=4092	27.478	2	1715.8955	1715.8955	K	I	690	706
PSM	NLVEQHIQDIVVHYTFNK	516	sp|P04843|RPN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=10665	69.118	3	2196.1328	2196.1328	K	V	415	433
PSM	QELSHALYQHDAACR	517	sp|Q9UMS4|PRP19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	14-UNIMOD:4	ms_run[2]:scan=2990	20.437	2	1797.8217	1797.8217	R	V	101	116
PSM	QKHSQAVEELAEQLEQTK	518	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7174	46.368	2	2095.0546	2095.0546	R	R	1192	1210
PSM	SKGLAPDLPEDLYHLIK	519	sp|P62277|RS13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=10692	69.297	2	1920.0759	1920.0759	K	K	77	94
PSM	SLHQFLLEPITCHAWNR	520	sp|Q92747|ARC1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:1,12-UNIMOD:4	ms_run[2]:scan=11104	72.078	2	2163.0684	2163.0684	M	D	2	19
PSM	SLKAYGELPEHAK	521	sp|P47813|IF1AX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=3230	21.884	2	1453.7968	1453.7968	R	I	102	115
PSM	SQDHFHVFVGDLSPEITTEDIK	522	sp|P31483-3|TIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9321	60.156	2	2513.2074	2513.2074	R	A	102	124
PSM	SQLGAHHTTPVGDGAAGTR	523	sp|Q5BJD5-3|TM41B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=1504	11.644	2	1831.8925	1831.8925	R	G	10	29
PSM	SYEALVQHVIEDHER	524	sp|Q9H2P0|ADNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=8476	54.66	3	1823.8802	1823.8802	K	I	232	247
PSM	TGVHHYSGNNIELGTACGK	525	sp|P62888|RL30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	17-UNIMOD:4	ms_run[2]:scan=3126	21.233	2	2013.9327	2013.9327	K	Y	69	88
PSM	TPELNLDQFHDKTPYTIMFGPDK	526	sp|P27824-3|CALX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=10614	68.781	3	2706.3	2706.3000	K	C	63	86
PSM	VFLENVIRDAVTYTEHAK	527	sp|P62805|H4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=12087	79.523	2	2104.0953	2104.0953	K	R	61	79
PSM	VHLVGIDIFTGK	528	sp|Q9GZV4|IF5A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9522	61.509	2	1297.7394	1297.7394	K	K	56	68
PSM	VNPFRPGDSEPPPAPGAQR	529	sp|Q15942|ZYX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=4665	30.868	2	1987.9864	1987.9864	K	A	36	55
PSM	YGDSEFTVQSTTGHCVHMR	530	sp|P52597|HNRPF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	15-UNIMOD:4,19-UNIMOD:267	ms_run[2]:scan=4914	32.393	2	2220.9556	2220.9556	R	G	276	295
PSM	YGICAHENKELANAR	531	sp|Q8IUH4|ZDH13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	4-UNIMOD:4	ms_run[2]:scan=2864	19.69	2	1744.8315	1744.8315	R	E	25	40
PSM	YIKEYVTCHTCR	532	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	8-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=2655	18.425	2	1628.7439	1628.7439	R	S	274	286
PSM	YSDFVVHEIGKDGR	533	sp|Q96PZ0|PUS7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=5101	33.529	2	1620.7896	1620.7896	R	I	134	148
PSM	QVEVTVHKGDECQLVGPAQPSHWK	534	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:28,8-UNIMOD:188,12-UNIMOD:4,24-UNIMOD:188	ms_run[1]:scan=6399	41.521361666666664	3	2723.3521	2723.3523	K	V	954	978
PSM	RMEELHNQEVQK	535	sp|Q15233|NONO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=1316	10.585221666666666	2	1540.756646	1539.746375	R	R	325	337
PSM	TFTEMDSHEEKVFR	536	sp|P48444|COPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	11-UNIMOD:188,14-UNIMOD:267	ms_run[1]:scan=4967	32.71172833333333	2	1772.802959	1770.821783	R	A	132	146
PSM	ISHGEVLEWQKTFEEK	537	sp|Q9BXP5|SRRT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	11-UNIMOD:188,16-UNIMOD:188	ms_run[1]:scan=7181	46.40705833333333	2	1972.015984	1971.014050	R	L	654	670
PSM	LISSDGHEFIVKR	538	sp|Q15369|ELOC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=4501	29.914776666666665	2	1499.807622	1499.809627	K	E	21	34
PSM	DKHPPELQVAFADCAADIK	539	sp|Q96EY7|PTCD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	14-UNIMOD:4	ms_run[1]:scan=7837	50.50854	3	2124.034378	2124.030990	R	S	538	557
PSM	CKAEHDQLLLNYAK	540	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:188,14-UNIMOD:188	ms_run[1]:scan=6186	40.16495166666667	2	1696.8638	1696.8640	K	K	110	124
PSM	IKGCWDSIHVVEVQEK	541	sp|P47756|CAPZB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	2-UNIMOD:188,4-UNIMOD:4,16-UNIMOD:188	ms_run[1]:scan=6409	41.58329833333333	3	1939.017265	1938.007191	K	S	144	160
PSM	GPWGGTLGWGLSLSVTRAR	542	sp|A1A5B4-3|ANO9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	17-UNIMOD:267	ms_run[1]:scan=1934	14.114508333333335	2	1981.075936	1980.056898	R	G	164	183
PSM	AFHNEAQVNPERK	543	sp|P17987|TCPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=1335	10.693	2	1538.759	1538.7590	R	N	469	482
PSM	AHQTGIHATEELKEFFAK	544	sp|Q6IBS0|TWF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:1	ms_run[2]:scan=8856	57.157	3	2098.0484	2098.0484	M	A	2	20
PSM	ALDVMVSTFHKYSGK	545	sp|P26447|S10A4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=7237	46.746	2	1681.8498	1681.8498	K	E	8	23
PSM	ALEATTEHIRQELAVFCSPEPPAK	546	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	17-UNIMOD:4	ms_run[2]:scan=9714	62.763	2	2693.3483	2693.3483	R	T	2145	2169
PSM	ANALHATNNLQIIPDFSLKDSR	547	sp|Q9P2R3|ANFY1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9028	58.252	3	2437.2714	2437.2714	K	D	567	589
PSM	ANATNKLTVIAEQIQHLQEQAR	548	sp|Q9BV19|CA050_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10185	65.862	3	2475.3194	2475.3194	R	K	72	94
PSM	CKAEHDQLLLNYAK	549	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:4	ms_run[2]:scan=4859	32.06	2	1701.8508	1701.8508	K	K	110	124
PSM	DIQQHKEEAWVIGSVVAR	550	sp|P22102|PUR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	6-UNIMOD:188,18-UNIMOD:267	ms_run[2]:scan=7633	49.246	2	2080.1036	2076.1155	R	A	752	770
PSM	EYGSCSHHYQQLLQSLEQGAQEESR	551	sp|Q15149-3|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	5-UNIMOD:4,25-UNIMOD:267	ms_run[2]:scan=8932	57.647	3	2973.3187	2973.3187	R	C	980	1005
PSM	FAGSGNEENRNNAYPHK	552	sp|Q8NBF2-2|NHLC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=1304	10.512	2	1903.8561	1903.8561	R	A	31	48
PSM	FDPETNSDDACTYHPGVPVFHDALK	553	sp|Q9UHD1-2|CHRD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	11-UNIMOD:4	ms_run[2]:scan=7488	48.32	3	2831.2497	2831.2497	R	G	14	39
PSM	FFTVKLPVALDPGAK	554	sp|P04843|RPN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10422	67.464	2	1601.9181	1601.9181	R	I	112	127
PSM	FHDPDSAVVAQHLTNTVFVDR	555	sp|Q05519-2|SRS11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8318	53.664	3	2367.1608	2367.1608	K	A	83	104
PSM	FQAHQQQGNKAEK	556	sp|Q9HCU5|PREB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	10-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=528	6.0959	2	1524.7836	1524.7836	R	A	95	108
PSM	GFGFVSYEKHEDANK	557	sp|Q13310-2|PABP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=4890	32.249	2	1726.7951	1726.7951	K	A	232	247
PSM	GIHQSTIDLKNELK	558	sp|Q14258|TRI25_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=4885	32.221	2	1594.8679	1594.8679	K	Q	336	350
PSM	GNWAHSGFPEIAFGR	559	sp|P52701-4|MSH6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9169	59.156	2	1644.7797	1644.7797	K	Y	152	167
PSM	HATALEELSEQLEQAKR	560	sp|P35580|MYH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	16-UNIMOD:188,17-UNIMOD:267	ms_run[2]:scan=8765	56.551	2	1968.0247	1964.0366	R	F	1201	1218
PSM	HLAEQFAVGEIITDMAKK	561	sp|Q99986|VRK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10287	66.532	3	2000.0401	2000.0401	R	E	18	36
PSM	HSELLQKVEPLQK	562	sp|Q9Y2Q9|RT28_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=4588	30.425	2	1559.9074	1559.9074	R	G	59	72
PSM	HTTEAAAGALQNITAGDRR	563	sp|Q9Y446|PKP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=4707	31.122	2	1951.9824	1951.9824	R	W	623	642
PSM	IDTHNIIVNQLVFPDPEKPCK	564	sp|O43681|ASNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	20-UNIMOD:4	ms_run[2]:scan=9160	59.098	2	2476.2784	2476.2784	K	M	270	291
PSM	IFHTVTTTDDPVIRK	565	sp|O15371-2|EIF3D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=4471	29.745	3	1741.9363	1741.9363	R	L	174	189
PSM	IHFIEAQDLQGKDTYLK	566	sp|A0FGR8-4|ESYT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=7138	46.149	3	2018.0473	2018.0473	R	G	185	202
PSM	IHFPLATYAPVISAEK	567	sp|P68366-2|TBA4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	16-UNIMOD:188	ms_run[2]:scan=9648	62.329	2	1761.9761	1761.9761	R	A	250	266
PSM	IHVYGYSMAYGPAQHAISTEK	568	sp|Q9NRX4|PHP14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	8-UNIMOD:35,21-UNIMOD:188	ms_run[2]:scan=5631	36.756	3	2344.1253	2344.1253	K	I	88	109
PSM	IISKIENHEGVR	569	sp|P14618-3|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=1886	13.845	2	1393.7678	1393.7678	K	R	252	264
PSM	IKEIHDGLDFYYSSK	570	sp|Q96D46|NMD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=6457	41.891	2	1825.9289	1825.9289	R	Q	188	203
PSM	ILDWHVANTDKK	571	sp|P37837|TALDO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=4620	30.608	2	1438.7569	1438.7569	R	S	193	205
PSM	ILDWHVANTDKK	572	sp|P37837|TALDO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	11-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=4632	30.682	2	1450.7971	1450.7971	R	S	193	205
PSM	IMRPDDANVAGNVHGGTILK	573	sp|O00154-2|BACH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5401	35.347	3	2077.0739	2077.0739	R	M	17	37
PSM	IQFHNVKPEYLDAYNSLTEAVLPK	574	sp|Q9BPW8|NIPS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10748	69.672	3	2788.4436	2788.4436	K	L	74	98
PSM	IWDLNMENRPVETYQVHEYLR	575	sp|P63151|2ABA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9048	58.383	3	2704.3068	2704.3068	K	S	310	331
PSM	KEGGLGPLNIPLLADVTR	576	sp|P32119|PRDX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=11939	78.318	3	1862.0625	1862.0625	R	R	92	110
PSM	KHGLEVIYMIEPIDEYCVQQLK	577	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:188,17-UNIMOD:4,22-UNIMOD:188	ms_run[2]:scan=10822	70.173	2	2716.4007	2716.4007	R	E	513	535
PSM	KHPDASVNFSEFSK	578	sp|P09429|HMGB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=4982	32.804	2	1603.8033	1603.8033	K	K	30	44
PSM	KHPDSSVNFAEFSK	579	sp|P26583|HMGB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=4812	31.769	2	1603.8033	1603.8033	K	K	30	44
PSM	KISSDLDGHPVPK	580	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=2480	17.385	2	1391.7409	1391.7409	R	Q	102	115
PSM	LEGHKEGIVQTEQIR	581	sp|Q6P1J9|CDC73_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=2827	19.453	2	1735.9217	1735.9217	R	S	157	172
PSM	LGAQLADLHLDNKK	582	sp|Q9HA64|KT3K_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5644	36.834	3	1534.8467	1534.8467	K	L	103	117
PSM	LHQLSGSDQLESTAHSR	583	sp|O60271-5|JIP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	17-UNIMOD:267	ms_run[2]:scan=3007	20.542	3	1874.911	1874.9110	K	I	179	196
PSM	LLEGEESRLESGMQNMSIHTK	584	sp|P05787|K2C8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=7646	49.323	2	2388.1413	2388.1413	K	T	394	415
PSM	LQQLGEAHQAETEVLRR	585	sp|Q14980-4|NUMA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5282	34.619	2	1977.0392	1977.0392	R	E	771	788
PSM	LVLTQEQLHQLHSR	586	sp|Q14203-5|DCTN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=4859	32.06	2	1700.9322	1700.9322	R	L	1123	1137
PSM	LYHNEVEIEKLNK	587	sp|Q14683|SMC1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=4210	28.185	2	1627.857	1627.8570	K	E	228	241
PSM	NKITLQDVVSHSK	588	sp|P46940|IQGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=4697	31.067	2	1467.8045	1467.8045	K	K	923	936
PSM	NMSVIAHVDHGK	589	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=2544	17.751	2	1306.6452	1306.6452	R	S	21	33
PSM	NSKHEELMLGDPCLK	590	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:188,13-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=5289	34.663	2	1781.8843	1781.8843	K	D	648	663
PSM	NVTKDHIMEIFSTYGK	591	sp|Q15287-3|RNPS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8631	55.665	3	1881.9295	1881.9295	R	I	134	150
PSM	PPSAFFLFCSEYRPK	592	sp|P09429|HMGB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:4	ms_run[2]:scan=10470	67.78	3	1844.892	1844.8920	R	I	98	113
PSM	RMEELHNQEMQK	593	sp|P23246-2|SFPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=1537	11.843	2	1571.7184	1571.7184	R	R	548	560
PSM	SEMEMAHLYSLCDAAHAQTEVAKK	594	sp|O94826|TOM70_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	12-UNIMOD:4	ms_run[2]:scan=6959	45.039	2	2719.2404	2719.2404	K	Y	577	601
PSM	SGPFGQIFRPDNFVFGQSGAGNNWAK	595	sp|P04350|TBB4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=11670	76.246	3	2797.3361	2797.3361	R	G	78	104
PSM	SKGLAPDLPEDLYHLIK	596	sp|P62277|RS13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=10686	69.261	3	1920.0759	1920.0759	K	K	77	94
PSM	SLHQFLLEPITCHAWNR	597	sp|Q92747|ARC1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:1,12-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=11096	72.024	3	2173.0766	2173.0766	M	D	2	19
PSM	SPLLAGGSPPQPVVPAHK	598	sp|Q8NFH5-2|NUP35_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	18-UNIMOD:188	ms_run[2]:scan=5583	36.456	2	1756.9931	1756.9931	R	D	49	67
PSM	SVHSSVPLLNSKDPIDR	599	sp|Q13085-3|ACACA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5609	36.615	2	1862.985	1862.9850	K	I	1827	1844
PSM	SWASLFHDSKPSSSSPVAYVETK	600	sp|Q14694|UBP10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8693	56.071	2	2509.2125	2509.2125	K	Y	341	364
PSM	SYEALVQHVIEDHER	601	sp|Q9H2P0|ADNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	15-UNIMOD:267	ms_run[2]:scan=8467	54.605	3	1833.8885	1833.8885	K	I	232	247
PSM	TEAEIAHIALETLEGHQR	602	sp|O75955|FLOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10036	64.885	3	2017.0229	2017.0229	K	A	92	110
PSM	TGVELGKPTHFTVNAK	603	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=4644	30.748	2	1697.9101	1697.9101	R	A	885	901
PSM	TGVHHYSGNNIELGTACGK	604	sp|P62888|RL30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	17-UNIMOD:4,19-UNIMOD:188	ms_run[2]:scan=3396	23.072	2	2019.9528	2019.9528	K	Y	69	88
PSM	TIKVWQLGSSSPNFTLEGHEK	605	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8412	54.259	3	2357.2016	2357.2016	R	G	137	158
PSM	TNHIGHTGYLNTVTVSPDGSLCASGGK	606	sp|P63244|RACK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	22-UNIMOD:4,27-UNIMOD:188	ms_run[2]:scan=5996	39.006	2	2748.3233	2748.3233	K	D	186	213
PSM	TTITMAHLLAAREDLSK	607	sp|Q52LJ0-1|FA98B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=7726	49.809	2	1869.9982	1869.9982	K	I	264	281
PSM	TVEVPFKGDVEHTIR	608	sp|Q9P2T1-3|GMPR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5995	39	3	1725.905	1725.9050	K	D	264	279
PSM	TVLEHYALEDDPLAAFKQR	609	sp|Q3ZCQ8-3|TIM50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	17-UNIMOD:188,19-UNIMOD:267	ms_run[2]:scan=9545	61.653	2	2231.1557	2227.1676	R	Q	183	202
PSM	VDINAPDVDVHGPDWHLK	610	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	18-UNIMOD:188	ms_run[2]:scan=7598	49.023	2	2032.011	2032.0110	K	M	3584	3602
PSM	VDISAPDVDVHGPDWHLK	611	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	18-UNIMOD:188	ms_run[2]:scan=7774	50.114	2	2005.0001	2005.0001	K	M	1364	1382
PSM	VIISAPSADAPMFVMGVNHEKYDNSLK	612	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	15-UNIMOD:35,21-UNIMOD:188,27-UNIMOD:188	ms_run[2]:scan=8293	53.504	2	2960.4815	2960.4815	R	I	119	146
PSM	VILHLKEDQTEYLEER	613	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6427	41.7	2	2014.0371	2014.0371	K	R	186	202
PSM	VLKQVHPDTGISSK	614	sp|Q99880|H2B1L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=1930	14.093	2	1507.8358	1507.8358	K	A	45	59
PSM	VQIDTFKENENGEYTEHLHSASCQIK	615	sp|Q12800-4|TFCP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	23-UNIMOD:4	ms_run[2]:scan=5675	37.03	3	3076.4196	3076.4196	R	V	211	237
PSM	VVTVFSVADGYSENNVFYGHHAK	616	sp|O75083-3|WDR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9214	59.441	2	2539.2132	2539.2132	K	I	372	395
PSM	YFDGSGGNNHAVEHYR	617	sp|P45974-2|UBP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	16-UNIMOD:267	ms_run[2]:scan=2647	18.378	2	1831.7902	1831.7902	R	E	223	239
PSM	YGDSEFTVQSTTGHCVHMR	618	sp|P52597|HNRPF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	15-UNIMOD:4	ms_run[2]:scan=4910	32.371	3	2210.9473	2210.9473	R	G	276	295
PSM	YKPVCNQVECHPYFNQR	619	sp|Q04828|AK1C1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	5-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=4394	29.294	2	2238.0099	2238.0099	K	K	184	201
PSM	QVEVTVHKGDECQLVGPAQPSHWK	620	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:28,12-UNIMOD:4	ms_run[1]:scan=6401	41.53165	3	2711.3125	2711.3121	K	V	954	978
PSM	QLFHPEQLITGKEDAANNYAR	621	sp|P68366|TBA4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:28	ms_run[1]:scan=9207	59.399861666666666	3	2398.1542	2397.1712	R	G	85	106
PSM	QLEAIDQLHLEYAKR	622	sp|O43707|ACTN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:28,14-UNIMOD:188,15-UNIMOD:267	ms_run[1]:scan=9507	61.40929166666666	2	1824.9699	1824.9700	K	A	522	537
PSM	RMEELHNQEVQK	623	sp|Q15233|NONO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	1-UNIMOD:267,12-UNIMOD:188	ms_run[1]:scan=1309	10.542653333333334	2	1557.784427	1555.774773	R	R	325	337
PSM	QLLHNFPPDQLTSSGAPFWSGPKR	624	sp|P22314|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:28,23-UNIMOD:188,24-UNIMOD:267	ms_run[1]:scan=11252	73.19290833333334	3	2679.3552	2678.3572	R	C	724	748
PSM	LGEEAFFYHSNCKEPGIAGLMK	625	sp|Q9P016|THYN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	12-UNIMOD:4,13-UNIMOD:188,22-UNIMOD:188	ms_run[1]:scan=9046	58.37103166666667	3	2509.213265	2509.217260	K	I	107	129
PSM	QDLPNAMNAAEITDKLGLHSLR	626	sp|P84077|ARF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:28	ms_run[1]:scan=11141	72.35763333333334	2	2389.1942	2389.2052	K	H	128	150
PSM	VPAPSIEDICHVLSTVCKK	627	sp|P40938|RFC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	10-UNIMOD:4,17-UNIMOD:4	ms_run[1]:scan=10546	68.288565	2	2152.104500	2152.102047	R	E	184	203
PSM	HVHPTTAPDVTSSLPEEK	628	sp|Q6WCQ1|MPRIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=4052	27.223776666666666	3	1943.962168	1943.958871	K	N	481	499
PSM	FTDCGHFQNTEFHELITVVK	629	sp|O75884|RBBP9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	4-UNIMOD:4	ms_run[1]:scan=9008	58.130116666666666	2	2422.144570	2421.142331	K	S	160	180
PSM	AAVHLEGKIEQAQR	630	sp|P18206|VINC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=2689	18.628	3	1548.8372	1548.8372	K	W	489	503
PSM	AEVQKLQMEAPHIIVGTPGR	631	sp|P60842-2|IF4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	5-UNIMOD:188,20-UNIMOD:267	ms_run[2]:scan=7004	45.318	2	2189.1962	2185.2080	R	V	142	162
PSM	AHSIQIMKVEEIAASK	632	sp|Q02543|RL18A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	8-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=6068	39.443	3	1765.9799	1765.9799	R	C	121	137
PSM	AHSIQIMKVEEIAASK	633	sp|Q02543|RL18A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6071	39.456	3	1753.9397	1753.9397	R	C	121	137
PSM	ALDEYYDKHFTEFVPLR	634	sp|P38606-2|VATA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9149	59.028	2	2142.0422	2142.0422	R	T	427	444
PSM	ALVFQPVAELKDQTDFEHR	635	sp|P08237-2|PFKAM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=8920	57.567	2	2242.1382	2242.1382	R	I	686	705
PSM	ANGTTVHVGIHPSK	636	sp|Q9UNX3|RL26L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=1889	13.858	2	1416.7474	1416.7474	K	V	90	104
PSM	AQESWLNSNLQHVVVIHCR	637	sp|Q68CZ2-4|TENS3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	18-UNIMOD:4	ms_run[2]:scan=8408	54.231	2	2289.1437	2289.1437	K	G	90	109
PSM	ARQYPWGVVQVENENHCDFVK	638	sp|Q9NVA2|SEP11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	17-UNIMOD:4	ms_run[2]:scan=7592	48.983	3	2574.2074	2574.2074	K	L	252	273
PSM	ASITPGTILIILTGR	639	sp|Q02878|RL6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=13101	91.571	2	1524.9239	1524.9239	R	H	142	157
PSM	ASQKPQPNFPSPEYMIFDHEFTK	640	sp|O60763|USO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:188,23-UNIMOD:188	ms_run[2]:scan=10095	65.271	3	2749.3249	2749.3249	R	L	593	616
PSM	AVDIPHMDIEALKK	641	sp|P62906|RL10A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7264	46.905	2	1578.844	1578.8440	K	L	79	93
PSM	AVSILPLLGHGVPR	642	sp|Q9Y2W2|WBP11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:267	ms_run[2]:scan=9642	62.289	2	1437.8695	1437.8695	R	L	179	193
PSM	DHPALNYNIVSGPPSHK	643	sp|O15269-2|SPTC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	17-UNIMOD:188	ms_run[2]:scan=5347	35.018	2	1850.9371	1850.9371	K	T	76	93
PSM	DTSFEQHVLWHTGGK	644	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6171	40.078	2	1740.822	1740.8220	R	G	1725	1740
PSM	DYAFIHFDERDGAVK	645	sp|O60506-5|HNRPQ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7608	49.086	2	1781.8373	1781.8373	K	A	220	235
PSM	ESGSLSPEHGPVVVHCSAGIGR	646	sp|P18031|PTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	16-UNIMOD:4,22-UNIMOD:267	ms_run[2]:scan=4556	30.242	2	2241.0836	2241.0836	R	S	200	222
PSM	EVVHTVSLHEIDVINSR	647	sp|Q9Y230-2|RUVB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	17-UNIMOD:267	ms_run[2]:scan=6977	45.153	3	1956.0304	1956.0304	K	T	192	209
PSM	FDPETNSDDACTYHPGVPVFHDALK	648	sp|Q9UHD1-2|CHRD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	11-UNIMOD:4	ms_run[2]:scan=7485	48.3	2	2831.2497	2831.2497	R	G	14	39
PSM	FHDPDSAVVAQHLTNTVFVDR	649	sp|Q05519-2|SRS11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	21-UNIMOD:267	ms_run[2]:scan=8319	53.669	3	2377.169	2377.1690	K	A	83	104
PSM	FHTVSGSKCEIK	650	sp|Q99729-3|ROAA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	9-UNIMOD:4	ms_run[2]:scan=1534	11.827	2	1391.6867	1391.6867	K	V	216	228
PSM	GEHSIVYLKPSYAFGSVGK	651	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7240	46.763	3	2038.0524	2038.0524	K	E	214	233
PSM	GFKATDCVGHDVVTLLR	652	sp|P19367-4|HXK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	7-UNIMOD:4	ms_run[2]:scan=8378	54.043	3	1886.9673	1886.9673	K	D	610	627
PSM	GISHVIVDEIHER	653	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:267	ms_run[2]:scan=5528	36.124	2	1512.7924	1512.7924	R	D	504	517
PSM	GISHVIVDEIHER	654	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5527	36.119	2	1502.7841	1502.7841	R	D	504	517
PSM	GLVVLGFPCNQFGHQENAKNEEILNSLK	655	sp|P07203|GPX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	9-UNIMOD:4,19-UNIMOD:188,28-UNIMOD:188	ms_run[2]:scan=10435	67.551	3	3166.6272	3166.6272	R	Y	70	98
PSM	GQSLGYAFAEFQEHEHALK	656	sp|Q9NW13-2|RBM28_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	19-UNIMOD:188	ms_run[2]:scan=8908	57.49	2	2167.043	2167.0430	K	A	396	415
PSM	GTFHDDRDDGVDYWAK	657	sp|Q9NYF8-3|BCLF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5307	34.774	2	1895.8075	1895.8075	R	R	795	811
PSM	GVIVDKDFSHPQMPK	658	sp|P48643-2|TCPE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:188,13-UNIMOD:35,15-UNIMOD:188	ms_run[2]:scan=3936	26.523	2	1724.8958	1724.8958	K	K	134	149
PSM	GYFEYIEENKYSR	659	sp|Q00839-2|HNRPU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7134	46.121	2	1696.7733	1696.7733	R	A	237	250
PSM	GYIWNYGAIPQTWEDPGHNDKHTGCCGDNDPIDVCEIGSK	660	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	25-UNIMOD:4,26-UNIMOD:4,35-UNIMOD:4	ms_run[2]:scan=10077	65.155	4	4574.959	4574.9590	K	V	89	129
PSM	HAAENPGKYNILGTNTIMDK	661	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	8-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=6463	41.93	3	2198.1193	2198.1193	K	M	498	518
PSM	HDPNMKYELQLANPK	662	sp|Q6P2Q9|PRP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=5311	34.799	2	1808.9282	1808.9282	R	E	2288	2303
PSM	HGGTIPIVPTAEFQDR	663	sp|P00367-2|DHE3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7197	46.504	2	1736.8846	1736.8846	K	I	314	330
PSM	HIPGAAFFDIDQCSDR	664	sp|P25325|THTM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:4	ms_run[2]:scan=8622	55.609	2	1847.8261	1847.8261	R	T	53	69
PSM	HKLDVTSVEDYK	665	sp|P48643-2|TCPE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=4362	29.098	2	1432.7198	1432.7198	K	A	171	183
PSM	HQCITAMKEYESK	666	sp|P52948-6|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:4,8-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=2536	17.706	2	1635.7788	1635.7788	K	S	186	199
PSM	HSFTEDHYVEFSK	667	sp|Q9Y4B6-3|DCAF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:188	ms_run[2]:scan=4888	32.238	2	1630.7359	1630.7359	K	H	725	738
PSM	HTGPGILSMANAGPNTNGSQFFICTAK	668	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	24-UNIMOD:4,27-UNIMOD:188	ms_run[2]:scan=9592	61.967	2	2796.3419	2796.3419	K	T	92	119
PSM	HTTSIFDDFAHYEK	669	sp|Q9BYJ9|YTHD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=8191	52.85	2	1709.7686	1709.7686	K	R	528	542
PSM	HVNGQDQIVPGLYACGEAACASVHGANR	670	sp|P31040-3|SDHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	15-UNIMOD:4,20-UNIMOD:4,28-UNIMOD:267	ms_run[2]:scan=7309	47.188	3	2960.3645	2960.3645	R	L	279	307
PSM	HYGGLTGLNKAETAAK	671	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	16-UNIMOD:188	ms_run[2]:scan=3328	22.574	2	1635.8676	1635.8676	R	H	91	107
PSM	IKEIHDGLDFYYSSK	672	sp|Q96D46|NMD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=6456	41.885	3	1825.9289	1825.9289	R	Q	188	203
PSM	IRNPWGEVEWTGR	673	sp|P17655-2|CAN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7895	50.856	2	1598.7954	1598.7954	R	W	206	219
PSM	KDSEDNPQTLLFSATCPHWVFNVAK	674	sp|Q9NR30-2|DDX21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:188,16-UNIMOD:4,25-UNIMOD:188	ms_run[2]:scan=11322	73.682	3	2915.4315	2915.4315	K	K	295	320
PSM	KGQTHTLEDFQR	675	sp|Q99714-2|HCD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=2525	17.647	2	1458.7215	1458.7215	K	V	105	117
PSM	LCFLDKVEPHATIAEIK	676	sp|Q9NZ01|TECR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:4	ms_run[2]:scan=8244	53.189	3	1983.0499	1983.0499	K	N	17	34
PSM	LFHPLEQSIWAVK	677	sp|Q9BZF1-3|OSBL8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:188	ms_run[2]:scan=9192	59.3	2	1572.876	1572.8760	K	G	170	183
PSM	LGEEAFFYHSNCKEPGIAGLMK	678	sp|Q9P016-2|THYN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:4,13-UNIMOD:188,22-UNIMOD:188	ms_run[2]:scan=9054	58.422	2	2509.2173	2509.2173	K	I	107	129
PSM	LLETTDRPDGHQNNLR	679	sp|Q14974-2|IMB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	7-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=2662	18.469	3	1897.9509	1897.9509	K	S	365	381
PSM	LQFHNVKPECLEAYNK	680	sp|O75323|NIPS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	10-UNIMOD:4	ms_run[2]:scan=5679	37.053	3	1988.9778	1988.9778	K	I	76	92
PSM	LQFHNVKPECLEAYNK	681	sp|O75323|NIPS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	7-UNIMOD:188,10-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=5693	37.143	3	2001.0181	2001.0181	K	I	76	92
PSM	LTLYDIAHTPGVAADLSHIETK	682	sp|P40926-2|MDHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	22-UNIMOD:188	ms_run[2]:scan=10469	67.774	3	2370.2527	2370.2527	R	A	53	75
PSM	MRYVASYLLAALGGNSSPSAK	683	sp|P05387|RLA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:35	ms_run[2]:scan=10600	68.68	2	2171.1045	2171.1045	-	D	1	22
PSM	NHDHQEIAVPVANLK	684	sp|O75607|NPM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5000	32.908	2	1683.8693	1683.8693	R	L	88	103
PSM	NIDDGTSDRPYSHALVAGIDR	685	sp|P61353|RL27_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5874	38.272	3	2271.088	2271.0880	K	Y	28	49
PSM	PDPAAHLPFFYGSISR	686	sp|P43403|ZAP70_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	16-UNIMOD:267	ms_run[2]:scan=9774	63.153	3	1783.8921	1783.8921	M	A	2	18
PSM	QATINIGTIGHVAHGK	687	sp|Q2VIR3-2|IF2GL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	16-UNIMOD:188	ms_run[2]:scan=5315	34.827	2	1621.8996	1621.8996	R	S	39	55
PSM	RGPGPVDLLLCCGDFQAVR	688	sp|Q9UK59|DBR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	11-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=10332	66.821	3	2129.051	2129.0510	R	N	26	45
PSM	SHFECEKETPQSLAFTR	689	sp|Q9UDY2-5|ZO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	5-UNIMOD:4	ms_run[2]:scan=5128	33.693	3	2065.9527	2065.9527	R	G	611	628
PSM	SHHAASTTTAPTPAAR	690	sp|Q7Z6Z7-2|HUWE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	16-UNIMOD:267	ms_run[2]:scan=799	7.632	2	1585.7836	1585.7836	R	S	1084	1100
PSM	SVEMHHEALSEALPGDNVGFNVK	691	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	23-UNIMOD:188	ms_run[2]:scan=7298	47.119	3	2485.2003	2485.2003	K	N	291	314
PSM	SWASLFHDSKPSSSSPVAYVETK	692	sp|Q14694|UBP10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	10-UNIMOD:188,23-UNIMOD:188	ms_run[2]:scan=8691	56.054	2	2521.2528	2521.2528	K	Y	341	364
PSM	TCFVDCLIEQTHPEIRK	693	sp|Q15029-2|U5S1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:4,6-UNIMOD:4	ms_run[2]:scan=8655	55.818	2	2145.0347	2145.0347	K	R	108	125
PSM	TEWLDGKHVVFGK	694	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6339	41.129	2	1514.7882	1514.7882	K	V	119	132
PSM	TFVPAMTAIHGPPITAPVVCTR	695	sp|Q96RN5-3|MED15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	20-UNIMOD:4,22-UNIMOD:267	ms_run[2]:scan=9586	61.926	3	2345.2263	2345.2263	R	K	530	552
PSM	THINIVVIGHVDSGK	696	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	15-UNIMOD:188	ms_run[2]:scan=5825	37.959	2	1593.8934	1593.8934	K	S	6	21
PSM	THLSLSHNPEQK	697	sp|P11586|C1TC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=1677	12.658	2	1389.7001	1389.7001	K	G	867	879
PSM	TLEHLQLSHDQLLEVK	698	sp|P52789|HXK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	16-UNIMOD:188	ms_run[2]:scan=7075	45.757	2	1908.0412	1908.0412	K	R	473	489
PSM	TLQAGLSSNHVSHGEVLR	699	sp|O95163|ELP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	18-UNIMOD:267	ms_run[2]:scan=4106	27.561	3	1913.9947	1913.9947	K	K	672	690
PSM	TPELNLDQFHDKTPYTIMFGPDK	700	sp|P27824-3|CALX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:188,23-UNIMOD:188	ms_run[2]:scan=10610	68.751	4	2718.3402	2718.3402	K	C	63	86
PSM	TVEVPFKGDVEHTIR	701	sp|Q9P2T1-3|GMPR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5987	38.949	2	1725.905	1725.9050	K	D	264	279
PSM	VGKGEPGAAPLSAPAFSLVFPFLK	702	sp|Q92616|GCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=13067	91.259	3	2399.3253	2399.3253	R	M	963	987
PSM	VGKGEPGAAPLSAPAFSLVFPFLK	703	sp|Q92616|GCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:188,24-UNIMOD:188	ms_run[2]:scan=13068	91.265	3	2411.3656	2411.3656	R	M	963	987
PSM	VPAPSIEDICHVLSTVCKK	704	sp|P40938-2|RFC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	10-UNIMOD:4,17-UNIMOD:4,18-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=10550	68.318	2	2164.1423	2164.1423	R	E	184	203
PSM	VQQLLHICSEHFDSK	705	sp|Q13200-2|PSMD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	8-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=5742	37.448	2	1845.9139	1845.9139	K	E	450	465
PSM	VVSHLIEKLPGSVGEK	706	sp|Q9Y446|PKP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	8-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=5430	35.517	2	1703.002	1703.0020	K	S	696	712
PSM	YASICQQNGIVPIVEPEILPDGDHDLKR	707	sp|P04075-2|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	5-UNIMOD:4	ms_run[2]:scan=9534	61.584	3	3175.5972	3175.5972	R	C	228	256
PSM	NGQTREHALLAYTLGVK	708	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=7637	49.26848666666666	2	1870.992127	1870.006095	K	Q	130	147
PSM	DGQVHLFEHILNGYCK	709	sp|Q15061|WDR43_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	15-UNIMOD:4	ms_run[1]:scan=8441	54.44011333333333	2	1929.903648	1928.920317	R	K	293	309
PSM	GISHVIVDEIHER	710	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=5509	36.01159666666667	2	1502.786911	1502.784141	R	D	504	517
PSM	AAVHLEGKIEQAQR	711	sp|P18206|VINC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	8-UNIMOD:188,14-UNIMOD:267	ms_run[1]:scan=2692	18.640695	3	1565.868370	1564.865637	K	W	489	503
PSM	IQAGEIGEMKDGVPEGAQLQGPVHR	712	sp|P16989|YBOX3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	10-UNIMOD:188,25-UNIMOD:267	ms_run[1]:scan=6528	42.33663166666666	3	2632.346937	2631.340982	R	N	259	284
PSM	KVAPQNDSFGTQLPPMHQQQR	713	sp|Q96AE4-2|FUBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=4913	32.387571666666666	3	2407.190614	2406.186262	K	S	77	98
PSM	ALQDLLDFTGPPTFPKR	714	sp|Q96T17|MA7D2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	16-UNIMOD:188,17-UNIMOD:267	ms_run[1]:scan=11108	72.10715666666667	3	1931.040333	1931.048747	R	S	685	702
PSM	VPAPSIEDICHVLSTVCKK	715	sp|P40938|RFC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	10-UNIMOD:4,17-UNIMOD:4	ms_run[1]:scan=10536	68.21746166666667	3	2152.103426	2152.102047	R	E	184	203
PSM	QIFLGGVDKHTQFWR	716	sp|P12236|ADT3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:28	ms_run[1]:scan=10243	66.24240666666667	2	1813.9274	1813.9259	K	Y	97	112
PSM	FTDCGHFQNTEFHELITVVK	717	sp|O75884|RBBP9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	4-UNIMOD:4	ms_run[1]:scan=9002	58.09049833333333	3	2422.142892	2421.142331	K	S	160	180
PSM	CLAFHDISPQAPTHFLVIPK	718	sp|P49773|HINT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:385,1-UNIMOD:4,20-UNIMOD:188	ms_run[1]:scan=11456	74.67507333333333	3	2279.1763	2279.1863	R	K	38	58
PSM	TFTEMDSHEEKVFR	719	sp|P48444|COPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=4987	32.82822	2	1756.773914	1754.793385	R	A	132	146
PSM	AAPRPAPVAQPPAAAPPSAVGSSAAAPR	720	sp|Q9Y6H1|CHCH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	4-UNIMOD:267,28-UNIMOD:267	ms_run[2]:scan=4666	30.875	2	2552.3726	2552.3726	R	Q	24	52
PSM	AIEKLEEEQHALFAR	721	sp|Q70UQ0-4|IKIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6643	43.043	3	1782.9264	1782.9264	K	D	237	252
PSM	AIRDGVIEASINHEK	722	sp|O43242-2|PSMD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=4229	28.297	2	1650.8689	1650.8689	K	G	303	318
PSM	AMINLHIQKDNPK	723	sp|Q9NZ45|CISD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=4428	29.497	2	1520.8133	1520.8133	K	I	43	56
PSM	AVAFQNPQTHVIENLHAAAYR	724	sp|P22695|QCR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7096	45.89	3	2349.1978	2349.1978	K	N	163	184
PSM	AVDIPHMDIEALKK	725	sp|P62906|RL10A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=7256	46.856	2	1590.8842	1590.8842	K	L	79	93
PSM	AVIQHFQEKVESLEQEAANER	726	sp|P05067-10|A4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8826	56.962	3	2454.2139	2454.2139	K	Q	299	320
PSM	DFNHINVELSLLGKK	727	sp|P32969|RL9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	14-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=9003	58.096	3	1737.9816	1737.9816	R	K	37	52
PSM	DGNVLLHEMQIQHPTASLIAK	728	sp|P40227|TCPZ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	21-UNIMOD:188	ms_run[2]:scan=8809	56.851	2	2320.2305	2320.2305	K	V	59	80
PSM	DLSGKHPVSALMEICNK	729	sp|P18583-2|SON_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	15-UNIMOD:4	ms_run[2]:scan=6576	42.63	2	1897.939	1897.9390	K	R	2047	2064
PSM	EAILAIHKEAQR	730	sp|O43707|ACTN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=2650	18.395	2	1377.7728	1377.7728	R	I	585	597
PSM	EHALLAYTLGVK	731	sp|P68104|EF1A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7406	47.816	2	1313.7343	1313.7343	R	Q	135	147
PSM	EKLHAVNAEECNVLQGR	732	sp|O75521-2|ECI2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:4	ms_run[2]:scan=4493	29.867	3	1965.9691	1965.9691	R	W	323	340
PSM	ELNHMLSDTGNRK	733	sp|Q96FQ6|S10AG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=2353	16.645	2	1513.7307	1513.7307	K	A	45	58
PSM	FEGGDRDLEHLSK	734	sp|P13667|PDIA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=3679	24.946	2	1501.7161	1501.7161	K	F	617	630
PSM	FIIHAPPGEFNEVFNDVR	735	sp|P47755|CAZA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	18-UNIMOD:267	ms_run[2]:scan=10501	67.986	3	2110.0511	2110.0511	K	L	20	38
PSM	FYEEVHDLERK	736	sp|P55209-3|NP1L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=4237	28.344	2	1463.7045	1463.7045	K	Y	54	65
PSM	GAKEHGAVAVER	737	sp|Q9UNZ2-6|NSF1C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=813	7.7151	2	1222.6418	1222.6418	R	V	14	26
PSM	GAVDGGLSIPHSTKR	738	sp|P46777|RL5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=3598	24.433	2	1493.795	1493.7950	K	F	165	180
PSM	GEHPGLSIGDVAKK	739	sp|P09429|HMGB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=3770	25.504	2	1418.792	1418.7920	K	L	115	129
PSM	GFCFLEYEDHKTAAQAR	740	sp|O60506-5|HNRPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	3-UNIMOD:4	ms_run[2]:scan=6711	43.469	3	2041.9316	2041.9316	R	R	135	152
PSM	GGAEVQIFAPDVPQMHVIDHTK	741	sp|P0DPI2-2|GAL3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	22-UNIMOD:188	ms_run[2]:scan=8601	55.469	2	2394.2097	2394.2097	R	G	73	95
PSM	GHYTEGAELVDSVLDVVR	742	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11906	78.037	2	1957.9745	1957.9745	K	K	104	122
PSM	GISHVIVDEIHER	743	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:267	ms_run[2]:scan=5516	36.053	3	1512.7924	1512.7924	R	D	504	517
PSM	GQEETPSWEHILFTCCHNR	744	sp|Q8TCD5|NT5C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	15-UNIMOD:4,16-UNIMOD:4,19-UNIMOD:267	ms_run[2]:scan=8792	56.739	2	2410.0458	2410.0458	R	H	151	170
PSM	GVPHPEDDHSQVEGPESLR	745	sp|Q6P996-3|PDXD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=4056	27.251	3	2083.9559	2083.9559	K	-	679	698
PSM	HEELMLGDPCLKDLK	746	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	10-UNIMOD:4,12-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=7145	46.189	2	1808.9203	1808.9203	K	K	651	666
PSM	HKEVEAAQGVK	747	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=705	7.0909	2	1194.6357	1194.6357	K	I	922	933
PSM	HQLLEADISAHEDR	748	sp|Q13813-2|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=4251	28.422	3	1632.7856	1632.7856	K	L	1705	1719
PSM	HSEAATAQREEWK	749	sp|Q14103-3|HNRPD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=1373	10.897	2	1541.7223	1541.7223	R	M	86	99
PSM	IGEEQSAEDAEDGPPELLFIHGGHTAK	750	sp|Q16576|RBBP7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8058	51.963	2	2846.3359	2846.3359	K	I	349	376
PSM	IGTLEKEHNVFQNK	751	sp|Q86UP2-2|KTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=3870	26.124	2	1655.8631	1655.8631	R	I	380	394
PSM	IHFPLATYAPVISAEK	752	sp|P68366-2|TBA4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9554	61.717	2	1755.956	1755.9560	R	A	250	266
PSM	IHFPLATYAPVISAEK	753	sp|P68366-2|TBA4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9713	62.757	2	1755.956	1755.9560	R	A	250	266
PSM	KFDEVLVNHFCEEFGK	754	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:188,11-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=8870	57.248	3	2008.9756	2008.9756	R	K	235	251
PSM	KHGLEVIYMIEPIDEYCVQQLK	755	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	17-UNIMOD:4	ms_run[2]:scan=10828	70.215	2	2704.3604	2704.3604	R	E	513	535
PSM	KHPDADSLYVEEVDVGEIAPR	756	sp|Q12904|AIMP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:188,21-UNIMOD:267	ms_run[2]:scan=7846	50.562	2	2354.1725	2350.1844	R	T	167	188
PSM	KHPSSPECLVSAQK	757	sp|Q14980-4|NUMA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	8-UNIMOD:4	ms_run[2]:scan=2265	16.129	2	1566.7824	1566.7824	R	V	73	87
PSM	KISSDLDGHPVPK	758	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=2475	17.353	2	1403.7811	1403.7811	R	Q	102	115
PSM	LDHYAIIKFPLTTESAMK	759	sp|P62750|RL23A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8972	57.897	2	2077.0918	2077.0918	K	K	71	89
PSM	LFHPLEQSIWAVK	760	sp|Q9BZF1-3|OSBL8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9185	59.255	2	1566.8558	1566.8558	K	G	170	183
PSM	LHNMIVDLDNVVKK	761	sp|Q16891-3|MIC60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7540	48.646	3	1636.8971	1636.8971	K	V	299	313
PSM	LIQNNHYAMEDVATRR	762	sp|Q13813-2|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	15-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=4310	28.791	2	1949.9645	1949.9645	K	D	533	549
PSM	LLKNHDEESLECLCR	763	sp|O43432-4|IF4G3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=4743	31.334	3	1914.8928	1914.8928	K	L	637	652
PSM	LNDGHFMPVLGFGTYAPPEVPR	764	sp|P42330|AK1C3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11004	71.405	2	2413.1889	2413.1889	K	S	10	32
PSM	LPGKWPFSLSEQQLDAR	765	sp|Q96L92-2|SNX27_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9659	62.4	3	1971.0214	1971.0214	R	R	126	143
PSM	LQGHLENEDKDR	766	sp|P50747|BPL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=949	8.4831	2	1452.6957	1452.6957	R	M	303	315
PSM	LRGWEAFLNAPEANR	767	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9099	58.71	2	1742.8853	1742.8853	R	G	366	381
PSM	LRSDDIYNQVSAYPLPEHR	768	sp|Q12768|WASC5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	2-UNIMOD:267,19-UNIMOD:267	ms_run[2]:scan=7026	45.453	3	2292.1402	2292.1402	R	S	229	248
PSM	LSASLLHSHDTETR	769	sp|Q9HCU5|PREB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=2979	20.373	2	1565.7798	1565.7798	R	A	57	71
PSM	MAQALEELRSQHDEQVR	770	sp|Q03252|LMNB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5060	33.282	2	2038.9854	2038.9854	K	L	256	273
PSM	MIPCDFLIPVQTQHPIR	771	sp|P06744|G6PI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:35,4-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=9295	59.983	2	2090.0681	2090.0681	K	K	401	418
PSM	MKQVEELYHSLLELGEK	772	sp|Q13813-2|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	2-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=11071	71.854	3	2057.0906	2057.0906	R	R	1066	1083
PSM	MMNGGHYTYSENRVEK	773	sp|Q99497|PARK7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:35	ms_run[2]:scan=2148	15.461	2	1930.8302	1930.8302	K	D	133	149
PSM	NMSVIAHVDHGK	774	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	2-UNIMOD:35,12-UNIMOD:188	ms_run[2]:scan=1415	11.14	2	1328.6602	1328.6602	R	S	21	33
PSM	NPDTQWITKPVHK	775	sp|P61313|RL15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=4225	28.272	2	1562.8205	1562.8205	R	H	145	158
PSM	PLAKDLLHPSPEEEK	776	sp|P42677|RS27_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=4507	29.95	3	1701.8938	1701.8938	M	R	2	17
PSM	QALPCVAESPTVHVEVHQR	777	sp|Q15645-2|PCH2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	5-UNIMOD:4,19-UNIMOD:267	ms_run[2]:scan=5511	36.023	2	2166.0879	2166.0879	K	G	10	29
PSM	QLFHPEQLITGKEDAANNYAR	778	sp|P68366-2|TBA4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7193	46.482	3	2414.1979	2414.1979	R	G	70	91
PSM	RDQALTEEHAR	779	sp|P12814-2|ACTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:267,11-UNIMOD:267	ms_run[2]:scan=848	7.9135	2	1344.6649	1344.6649	R	Q	614	625
PSM	RDQALTEEHAR	780	sp|P12814-2|ACTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=850	7.9233	2	1324.6484	1324.6484	R	Q	614	625
PSM	RGPGPVDLLLCCGDFQAVR	781	sp|Q9UK59|DBR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:267,11-UNIMOD:4,12-UNIMOD:4,19-UNIMOD:267	ms_run[2]:scan=10341	66.894	3	2149.0676	2149.0676	R	N	26	45
PSM	SGEHDFGAAFDGDGDRNMILGK	782	sp|P36871-3|PGM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	16-UNIMOD:267,22-UNIMOD:188	ms_run[2]:scan=7575	48.869	2	2324.0463	2320.0581	K	H	81	103
PSM	SHYKVGENADSQIK	783	sp|P07305-2|H10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=1626	12.373	3	1574.7689	1574.7689	K	L	39	53
PSM	SKVTLLEGDHVR	784	sp|O75534-2|CSDE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=3113	21.154	2	1352.7412	1352.7412	K	F	275	287
PSM	SLDMDSIIAEVK	785	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:188	ms_run[2]:scan=10438	67.57	2	1325.6844	1325.6844	R	A	253	265
PSM	SLQEEHVAVAQLREEAER	786	sp|Q15149-3|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5781	37.682	2	2093.0501	2093.0501	R	R	1618	1636
PSM	SQDHFHVFVGDLSPEITTEDIK	787	sp|P31483-3|TIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	22-UNIMOD:188	ms_run[2]:scan=9337	60.261	2	2519.2276	2519.2276	R	A	102	124
PSM	TADPCCYGHTQFHLLPDK	788	sp|Q9NP92|RT30_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	5-UNIMOD:4,6-UNIMOD:4	ms_run[2]:scan=6540	42.41	2	2158.9564	2158.9564	K	L	288	306
PSM	TEWLDGKHVVFGK	789	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6174	40.093	2	1514.7882	1514.7882	K	V	119	132
PSM	TEWLDGKHVVFGK	790	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	7-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=6338	41.125	2	1526.8284	1526.8284	K	V	119	132
PSM	TEWLDGKHVVFGK	791	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	7-UNIMOD:188	ms_run[2]:scan=6352	41.217	2	1520.8083	1520.8083	K	V	119	132
PSM	THINIVVIGHVDSGK	792	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5833	38.011	2	1587.8733	1587.8733	K	S	6	21
PSM	THINIVVIGHVDSGK	793	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5648	36.86	3	1587.8733	1587.8733	K	S	6	21
PSM	THINIVVIGHVDSGK	794	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6131	39.817	2	1587.8733	1587.8733	K	S	6	21
PSM	THQKFVIATSTK	795	sp|Q02878|RL6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	4-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=2191	15.708	2	1371.7913	1371.7913	R	I	189	201
PSM	THSQGGYGSQGYKYNWK	796	sp|Q9Y285-2|SYFA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=3752	25.396	3	1959.8864	1959.8864	R	L	268	285
PSM	TPELNLDQFHDKTPYTIMFGPDK	797	sp|P27824-3|CALX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	18-UNIMOD:35	ms_run[2]:scan=9408	60.755	4	2722.2949	2722.2949	K	C	63	86
PSM	VDINAPDVEVHGPDWHLK	798	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	18-UNIMOD:188	ms_run[2]:scan=7609	49.092	2	2046.0266	2046.0266	K	M	1492	1510
PSM	VFQSLPHENKPLTLSNYQTNK	799	sp|P04080|CYTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5954	38.743	3	2457.2652	2457.2652	R	A	69	90
PSM	VHLVGIDIFTGK	800	sp|Q9GZV4|IF5A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:188	ms_run[2]:scan=9530	61.561	2	1303.7596	1303.7596	K	K	56	68
PSM	VIISAPSADAPMFVMGVNHEKYDNSLK	801	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	21-UNIMOD:188,27-UNIMOD:188	ms_run[2]:scan=9240	59.611	2	2944.4866	2944.4866	R	I	119	146
PSM	VILHLKEDQTEYLEER	802	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6242	40.5	3	2014.0371	2014.0371	K	R	186	202
PSM	VKHEVSGETVVFQGGALGK	803	sp|Q5VYK3|ECM29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	2-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=5154	33.847	3	1953.0722	1953.0722	R	T	1038	1057
PSM	VSDILHSIFSSYKEK	804	sp|O00410-2|IPO5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9416	60.809	2	1751.9094	1751.9094	K	V	782	797
PSM	VTAIHIDPATHR	805	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:267	ms_run[2]:scan=2908	19.951	2	1339.7236	1339.7236	R	Q	1052	1064
PSM	VTSEELHYFVQNHFTSAR	806	sp|P22695|QCR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7836	50.504	3	2164.0338	2164.0338	K	M	200	218
PSM	YHTINGHNCEVK	807	sp|P51991-2|ROA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	9-UNIMOD:4	ms_run[2]:scan=1120	9.4544	2	1470.6674	1470.6674	K	K	166	178
PSM	YHTVNGHNCEVR	808	sp|P09651-3|ROA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	9-UNIMOD:4	ms_run[2]:scan=917	8.2998	2	1484.6579	1484.6579	K	K	167	179
PSM	YHTVNGHNCEVR	809	sp|P09651-3|ROA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	9-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=920	8.3198	2	1494.6662	1494.6662	K	K	167	179
PSM	YSHLQPGDHLTDITLK	810	sp|Q15046|SYK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6023	39.179	3	1836.937	1836.9370	K	V	112	128
PSM	YSTHLHLAEDCMK	811	sp|P61764|STXB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=4286	28.638	2	1609.7324	1609.7324	K	H	344	357
PSM	YTIHSQLEHLQSK	812	sp|Q9BWJ5|SF3B5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=4223	28.261	2	1582.8104	1582.8104	R	Y	5	18
PSM	QEYDESGPSIVHRK	813	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:28,13-UNIMOD:267,14-UNIMOD:188	ms_run[1]:scan=3833	25.890908333333336	2	1642.7938	1642.7917	K	C	360	374
PSM	YHTINGHNAEVR	814	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	12-UNIMOD:267	ms_run[1]:scan=1685	12.704628333333334	2	1420.677175	1419.688279	K	K	174	186
PSM	IGTHNGTFHCDEALACALLR	815	sp|Q9HB07|MYG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	10-UNIMOD:4,16-UNIMOD:4	ms_run[1]:scan=9435	60.938291666666665	2	2256.040829	2255.057556	R	L	47	67
PSM	HIVENAVQKELR	816	sp|O00410|IPO5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=3499	23.792421666666666	2	1434.799195	1434.794312	K	L	540	552
PSM	QLLHNFPPDQLTSSGAPFWSGPKR	817	sp|P22314|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:28	ms_run[1]:scan=11488	74.90450666666666	3	2662.3152	2662.3282	R	C	724	748
PSM	LHNTIVEINNHK	818	sp|Q9NTJ3|SMC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=2551	17.791315	2	1431.768037	1430.763012	R	L	887	899
PSM	TVEYLHAQGVVHR	819	sp|P51812|KS6A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=3741	25.331153333333333	2	1507.806912	1507.789561	K	D	526	539
PSM	HEKVQENCIDLVGR	820	sp|O75533|SF3B1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:188,8-UNIMOD:4,14-UNIMOD:267	ms_run[1]:scan=3945	26.577981666666666	2	1712.852306	1711.864651	R	I	1028	1042
PSM	ISKIENLSNLHQLQMLELGSNR	821	sp|Q15435|PP1R7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=9082	58.59704	3	2537.347412	2536.343156	K	I	176	198
PSM	ISAEDGLKHEYFR	822	sp|Q9UQ88|CD11A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	8-UNIMOD:188,13-UNIMOD:267	ms_run[1]:scan=5220	34.24022166666667	2	1579.790598	1579.796555	R	E	700	713
PSM	TIVHESERLEALK	823	sp|Q9BT78|CSN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=4410	29.38788333333333	2	1524.834700	1523.830757	K	H	215	228
PSM	TGVHDADFEAHIIDMLAK	824	sp|Q16842|SIA4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=10738	69.60260666666666	3	1982.953787	1981.956762	K	A	323	341
PSM	GFCFLEYEDHKTAAQVK	825	sp|O60506-2|HNRPQ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:4	ms_run[1]:scan=6711	43.469251666666665	3	2041.930723	2041.956762	R	V	287	304
PSM	AERVHELNEEIGK	826	sp|Q9Y383-3|LC7L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=2573	17.927	2	1522.774	1522.7740	K	L	120	133
PSM	ALEATTEHIRQELAVFCSPEPPAK	827	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	10-UNIMOD:267,17-UNIMOD:4,24-UNIMOD:188	ms_run[2]:scan=9707	62.715	3	2709.3767	2705.3886	R	T	2145	2169
PSM	ALEEAGFKMPCQLHQVIVAR	828	sp|P17655-2|CAN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:4	ms_run[2]:scan=8217	53.019	3	2296.182	2296.1820	K	F	552	572
PSM	ALESPERPFLAILGGAK	829	sp|P00558-2|PGK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10653	69.035	2	1767.9883	1767.9883	K	V	172	189
PSM	ARGITINAAHVEYSTAAR	830	sp|P49411|EFTU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:267,18-UNIMOD:267	ms_run[2]:scan=4833	31.901	2	1920.008	1920.0080	R	H	103	121
PSM	CVHCVPLEPFDEDYLNHLEPPVK	831	sp|Q8TAT6|NPL4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:4,4-UNIMOD:4	ms_run[2]:scan=10098	65.288	3	2806.3095	2806.3095	K	H	138	161
PSM	DHPALNYNIVSGPPSHK	832	sp|O15269-2|SPTC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5338	34.961	2	1844.9169	1844.9169	K	T	76	93
PSM	DNHLLGTFDLTGIPPAPR	833	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	18-UNIMOD:267	ms_run[2]:scan=10216	66.069	2	1943.014	1943.0140	K	G	475	493
PSM	ECLQALEFLHSNQVIHR	834	sp|Q13153|PAK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:4	ms_run[2]:scan=8553	55.15	2	2093.0476	2093.0476	R	D	372	389
PSM	EFLHAQEEVKR	835	sp|P43686|PRS6B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=2694	18.65	2	1384.7099	1384.7099	K	I	71	82
PSM	ELKLENHQENSR	836	sp|Q9NX58|LYAR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=1301	10.495	2	1495.7379	1495.7379	K	N	205	217
PSM	ELVTQQLPHLLKDVGSLDEK	837	sp|Q99584|S10AD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10246	66.261	2	2261.2267	2261.2267	K	M	40	60
PSM	FAANPNQNKNVALLSQLYHSPAR	838	sp|Q15717|ELAV1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7681	49.534	4	2552.3248	2552.3248	K	R	183	206
PSM	FDPETNSDDACTYHPGVPVFHDALK	839	sp|Q9UHD1-2|CHRD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:4,25-UNIMOD:188	ms_run[2]:scan=7484	48.293	2	2837.2698	2837.2698	R	G	14	39
PSM	FGECSNKECPFLHIDPESK	840	sp|O95639-3|CPSF4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	4-UNIMOD:4,7-UNIMOD:188,9-UNIMOD:4,19-UNIMOD:188	ms_run[2]:scan=6760	43.767	2	2305.0546	2305.0546	K	I	102	121
PSM	FHMDSETHDPIDLQTK	841	sp|Q9Y2L1-2|RRP44_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5657	36.915	3	1912.8625	1912.8625	R	E	609	625
PSM	FKEANNFLWPFK	842	sp|P18124|RL7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10724	69.512	2	1539.7874	1539.7874	R	L	201	213
PSM	FVIHCNSPVWGADKCEELLEK	843	sp|O75367-2|H2AY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	5-UNIMOD:4,14-UNIMOD:188,15-UNIMOD:4,21-UNIMOD:188	ms_run[2]:scan=7896	50.861	2	2542.2387	2542.2387	K	T	269	290
PSM	GAEIVADTFRDFAVSTVPVSGPSHLR	844	sp|O95865|DDAH2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10862	70.45	3	2727.398	2727.3980	R	G	148	174
PSM	GEHPGLSIGDVAKK	845	sp|P09429|HMGB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=3775	25.532	3	1418.792	1418.7920	K	L	115	129
PSM	GLGTDEDSLIEIICSR	846	sp|P07355-2|ANXA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	14-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=11573	75.508	2	1786.8646	1786.8646	K	T	138	154
PSM	GVLKVFLENVIR	847	sp|P62805|H4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11336	73.778	2	1385.8395	1385.8395	R	D	57	69
PSM	HAPINSAQHLDNVDQTGPK	848	sp|O43159|RRP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	19-UNIMOD:188	ms_run[2]:scan=2774	19.105	3	2047.0178	2047.0178	K	A	139	158
PSM	HATALEELSEQLEQAKR	849	sp|P35580|MYH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8744	56.401	3	1951.9963	1951.9963	R	F	1201	1218
PSM	HFFLYGEFPGDER	850	sp|P18887|XRCC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:267	ms_run[2]:scan=9126	58.879	2	1622.7393	1622.7393	K	R	547	560
PSM	HKEVEAAQGVK	851	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=704	7.0867	2	1206.6759	1206.6759	K	I	922	933
PSM	HLVEENCEAVPHR	852	sp|Q9NVM4-4|ANM7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	7-UNIMOD:4	ms_run[2]:scan=2304	16.36	3	1588.7416	1588.7416	R	A	165	178
PSM	HPDASVNFSEFSKK	853	sp|P09429|HMGB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=4930	32.496	3	1603.8033	1603.8033	K	C	31	45
PSM	HQCITAMKEYESK	854	sp|P52948-6|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:4	ms_run[2]:scan=2552	17.797	2	1623.7385	1623.7385	K	S	186	199
PSM	HSQAVEELAEQLEQTKR	855	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	16-UNIMOD:188,17-UNIMOD:267	ms_run[2]:scan=7228	46.692	2	2011.0305	2007.0424	K	V	1194	1211
PSM	HTGYVIELQHVVK	856	sp|P47897-2|SYQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:188	ms_run[2]:scan=5769	37.616	3	1527.8505	1527.8505	R	G	629	642
PSM	HTWMEDADSCVAHNALECAR	857	sp|O94906-2|PRP6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	10-UNIMOD:4,18-UNIMOD:4,20-UNIMOD:267	ms_run[2]:scan=7428	47.953	3	2381.9815	2381.9815	K	A	541	561
PSM	HVAEVLEYTKDEQLESLFQR	858	sp|P05198|IF2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9684	62.564	4	2433.2176	2433.2176	R	T	114	134
PSM	IGEEQSPEDAEDGPPELLFIHGGHTAK	859	sp|Q09028-4|RBBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	27-UNIMOD:188	ms_run[2]:scan=8122	52.392	3	2878.3717	2878.3717	K	I	315	342
PSM	IGEEQSPEDAEDGPPELLFIHGGHTAK	860	sp|Q09028-4|RBBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8140	52.519	2	2872.3515	2872.3515	K	I	315	342
PSM	IGTLEKEHNVFQNK	861	sp|Q86UP2-2|KTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	6-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=3868	26.112	2	1667.9034	1667.9034	R	I	380	394
PSM	IHFPLATYAPVISAEK	862	sp|P68366-2|TBA4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	16-UNIMOD:188	ms_run[2]:scan=9495	61.327	2	1761.9761	1761.9761	R	A	250	266
PSM	IKGCWDSIHVVEVQEK	863	sp|P47756-2|CAPZB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	4-UNIMOD:4	ms_run[2]:scan=6402	41.538	3	1925.9669	1925.9669	K	S	144	160
PSM	ILDLGITGPEGHVLSRPEEVEAEAVNR	864	sp|Q16555-2|DPYL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8990	58.009	2	2899.5039	2899.5039	R	A	176	203
PSM	IPGMLIIDTPGHESFSNLR	865	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9799	63.316	3	2096.0725	2096.0725	R	N	695	714
PSM	KEIHTVPDMGK	866	sp|Q15257-4|PTPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=1830	13.526	2	1265.6841	1265.6841	K	W	28	39
PSM	KEIHTVPDMGK	867	sp|Q15257-4|PTPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=1834	13.547	2	1253.6438	1253.6438	K	W	28	39
PSM	KQDHTIVDTVLMAPR	868	sp|P16144-4|ITB4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7088	45.838	2	1722.9087	1722.9087	K	S	878	893
PSM	LEGHKEGIVQTEQIR	869	sp|Q6P1J9|CDC73_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=2832	19.486	3	1735.9217	1735.9217	R	S	157	172
PSM	LEHAYKPVQFEGSLGK	870	sp|Q86TB9-2|PATL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	6-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=5102	33.535	3	1813.9765	1813.9765	K	L	326	342
PSM	LEMYNILKAEHDSILAEK	871	sp|P26639|SYTC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	8-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=9912	64.068	3	2128.1277	2128.1277	R	A	58	76
PSM	LHIIEVGTPPTGNQPFPK	872	sp|Q00610-2|CLH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	18-UNIMOD:188	ms_run[2]:scan=7536	48.618	2	1950.067	1950.0670	K	K	228	246
PSM	LHNMIVDLDNVVKK	873	sp|Q16891-3|MIC60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=7534	48.606	3	1648.9373	1648.9373	K	V	299	313
PSM	LHNMIVDLDNVVKK	874	sp|Q16891-3|MIC60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=7550	48.709	2	1648.9373	1648.9373	K	V	299	313
PSM	LHNTIVEINNHK	875	sp|Q9NTJ3-2|SMC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:188	ms_run[2]:scan=2546	17.76	2	1436.7831	1436.7831	R	L	887	899
PSM	LICCDILDVLDKHLIPAANTGESK	876	sp|P62258-2|1433E_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:4,4-UNIMOD:4	ms_run[2]:scan=12018	78.96	4	2694.3721	2694.3721	K	V	73	97
PSM	LKVPPAINQFTQALDR	877	sp|P62424|RL7A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10291	66.557	2	1810.0101	1810.0101	R	Q	74	90
PSM	LSGPDDDPLHKQPR	878	sp|Q86TI2-4|DPP9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=2684	18.596	2	1573.7849	1573.7849	K	F	577	591
PSM	LTGIKHELQANCYEEVK	879	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:4	ms_run[2]:scan=4680	30.963	2	2031.0095	2031.0095	K	D	128	145
PSM	MHDLNTDQENLVGTHDAPIR	880	sp|O43684-2|BUB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:35	ms_run[2]:scan=4896	32.285	3	2291.0601	2291.0601	K	C	81	101
PSM	MITEHTSNDPYCFVEFYEHR	881	sp|Q01085|TIAR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=8770	56.586	3	2590.0893	2590.0893	K	D	40	60
PSM	MKHYEVEILDAK	882	sp|Q9NZ01|TECR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:35	ms_run[2]:scan=4693	31.043	2	1490.7439	1490.7439	-	T	1	13
PSM	MKQVEELYHSLLELGEK	883	sp|Q13813-2|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:35,2-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=10090	65.237	3	2073.0855	2073.0855	R	R	1066	1083
PSM	NMSVIAHVDHGK	884	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:35	ms_run[2]:scan=1416	11.145	2	1322.6401	1322.6401	R	S	21	33
PSM	NMSVIAHVDHGK	885	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:188	ms_run[2]:scan=2541	17.737	2	1312.6653	1312.6653	R	S	21	33
PSM	NNKNEFVSLINCSSQPPLISHGIGK	886	sp|O95793-2|STAU1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:188,12-UNIMOD:4,25-UNIMOD:188	ms_run[2]:scan=9078	58.569	3	2764.4369	2764.4369	K	D	431	456
PSM	NYGFVHIEDKTAAEDAIR	887	sp|Q9BWF3-3|RBM4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	10-UNIMOD:188,18-UNIMOD:267	ms_run[2]:scan=6490	42.1	2	2064.0247	2060.0366	K	N	36	54
PSM	RDQALTEEHAR	888	sp|P12814-2|ACTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=857	7.9623	3	1324.6484	1324.6484	R	Q	614	625
PSM	RLEAELAAHEPAIQGVLDTGK	889	sp|Q13813-2|SPTN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7753	49.979	3	2217.1753	2217.1753	K	K	1813	1834
PSM	RLPVPESITGFAR	890	sp|Q8N5K1|CISD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:267,13-UNIMOD:267	ms_run[2]:scan=7685	49.557	2	1461.8207	1461.8207	K	L	20	33
PSM	RVEHNQSYSQAGITETEWTSGSSK	891	sp|P42167|LAP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:267,24-UNIMOD:188	ms_run[2]:scan=4765	31.469	2	2697.2601	2693.2720	R	G	216	240
PSM	SFGHFPGPEFLDVEK	892	sp|Q8IWW6-3|RHG12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	15-UNIMOD:188	ms_run[2]:scan=9736	62.902	3	1710.8349	1710.8349	R	T	176	191
PSM	SGEHDFGAAFDGDGDRNMILGK	893	sp|P36871-3|PGM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	16-UNIMOD:267,22-UNIMOD:188	ms_run[2]:scan=7566	48.812	3	2324.0463	2320.0581	K	H	81	103
PSM	SGPFGQIFRPDNFVFGQSGAGNNWAK	894	sp|P04350|TBB4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11478	74.839	3	2797.3361	2797.3361	R	G	78	104
PSM	SGSLLYLHDTLEDIKR	895	sp|Q96JH7|VCIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8340	53.802	3	1858.9789	1858.9789	R	A	185	201
PSM	SHFECEKETPQSLAFTR	896	sp|Q9UDY2-5|ZO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	5-UNIMOD:4,7-UNIMOD:188,17-UNIMOD:267	ms_run[2]:scan=5117	33.628	2	2081.9811	2077.9930	R	G	611	628
PSM	SHFEQWGTLTDCVVMRDPNTK	897	sp|P09651-3|ROA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:4,16-UNIMOD:267,21-UNIMOD:188	ms_run[2]:scan=8177	52.758	2	2536.181	2532.1928	R	R	32	53
PSM	SLETEHKALTSEIALLQSR	898	sp|P04843|RPN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8734	56.334	3	2125.1379	2125.1379	K	L	518	537
PSM	SLNNFCSQIGDDRPISYCHFSPNSK	899	sp|O43172-2|PRP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	6-UNIMOD:4,18-UNIMOD:4	ms_run[2]:scan=7401	47.788	3	2942.3076	2942.3076	R	M	219	244
PSM	SQLGAHHTTPVGDGAAGTR	900	sp|Q5BJD5-3|TM41B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	19-UNIMOD:267	ms_run[2]:scan=1525	11.772	3	1841.9008	1841.9008	R	G	10	29
PSM	TAPYKNVNIQNFHISWK	901	sp|P12814-2|ACTN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	5-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=8444	54.458	2	2071.1042	2071.1042	K	D	158	175
PSM	TGPNLHGLFGR	902	sp|P99999|CYC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:267	ms_run[2]:scan=6805	44.064	2	1177.6232	1177.6232	K	K	29	40
PSM	THETLSHAGQK	903	sp|Q16890-4|TPD53_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:188	ms_run[2]:scan=603	6.5187	2	1213.6147	1213.6147	K	A	70	81
PSM	THINIVVIGHVDSGK	904	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	15-UNIMOD:188	ms_run[2]:scan=6288	40.79	2	1593.8934	1593.8934	K	S	6	21
PSM	THINIVVIGHVDSGK	905	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5858	38.173	3	1587.8733	1587.8733	K	S	6	21
PSM	THQKFVIATSTK	906	sp|Q02878|RL6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=2194	15.725	2	1359.751	1359.7510	R	I	189	201
PSM	THYSNIEANESEEVRQFR	907	sp|P04632|CPNS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5151	33.827	2	2208.0196	2208.0196	R	R	85	103
PSM	TKDLPVTEAVFSALVTGHAR	908	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:188,20-UNIMOD:267	ms_run[2]:scan=10826	70.203	2	2127.1659	2123.1778	K	A	225	245
PSM	TPELNLDQFHDKTPYTIMFGPDK	909	sp|P27824-3|CALX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:188,23-UNIMOD:188	ms_run[2]:scan=10611	68.758	3	2718.3402	2718.3402	K	C	63	86
PSM	TPGAATASASGAAEDGACGCLPNPGTFEECHRK	910	sp|O96008-2|TOM40_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	18-UNIMOD:4,20-UNIMOD:4,30-UNIMOD:4	ms_run[2]:scan=5978	38.893	4	3346.4401	3346.4401	R	C	57	90
PSM	TSGHVDKFADFMVK	911	sp|P41250|GARS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6062	39.409	3	1580.7657	1580.7657	K	D	191	205
PSM	TTMRPQSFYDGSHSCAR	912	sp|Q13126-7|MTAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	15-UNIMOD:4	ms_run[2]:scan=3721	25.204	3	1999.8629	1999.8629	R	G	117	134
PSM	VAMKHPSAVTACNLDLENLITDSNR	913	sp|Q9UBF2-2|COPG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:4	ms_run[2]:scan=9021	58.207	3	2768.3585	2768.3585	K	S	314	339
PSM	VAVNDAHLLQYNHR	914	sp|P17931|LEG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	14-UNIMOD:267	ms_run[2]:scan=4642	30.736	2	1658.8517	1658.8517	K	V	211	225
PSM	VCEVCSAYLGLHDNDRR	915	sp|Q9Y383-3|LC7L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:4,5-UNIMOD:4,16-UNIMOD:267,17-UNIMOD:267	ms_run[2]:scan=5174	33.965	2	2082.9478	2082.9478	R	L	186	203
PSM	VHELNEEIGKLLAK	916	sp|Q9Y383-3|LC7L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7679	49.524	3	1591.8934	1591.8934	R	V	123	137
PSM	VILHLKEDQTEYLEER	917	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6072	39.461	3	2014.0371	2014.0371	K	R	186	202
PSM	VILHLKEDQTEYLEER	918	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6400	41.527	3	2014.0371	2014.0371	K	R	186	202
PSM	VLDSGAPIKIPVGPETLGR	919	sp|P06576|ATPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8576	55.3	2	1918.0888	1918.0888	K	I	125	144
PSM	VLEEVCASPQGPGALFVQSHLEDLKK	920	sp|Q5JTH9-2|RRP12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	6-UNIMOD:4	ms_run[2]:scan=9533	61.578	3	2850.4586	2850.4586	R	T	694	720
PSM	VSDILHSIFSSYKEK	921	sp|O00410-2|IPO5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=9443	60.99	2	1763.9497	1763.9497	K	V	782	797
PSM	VSGFTFSHHPGQYNLCATSSDDGTVK	922	sp|Q8TEQ6|GEMI5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	16-UNIMOD:4,26-UNIMOD:188	ms_run[2]:scan=6412	41.601	2	2817.276	2817.2760	R	I	67	93
PSM	VSVHVIEGDHR	923	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=2283	16.233	2	1246.6418	1246.6418	K	T	2472	2483
PSM	VTSAHKGPDETLR	924	sp|P22234|PUR6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=1046	9.0288	2	1409.7263	1409.7263	R	I	299	312
PSM	VVPGFIVQGGDPTGTGSGGESIYGAPFKDEFHSR	925	sp|Q6UX04-2|CWC27_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9702	62.681	3	3464.6637	3464.6637	R	L	57	91
PSM	YGDGGSTFQSTTGHCVHMR	926	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	15-UNIMOD:4	ms_run[2]:scan=3766	25.477	3	2096.8793	2096.8793	R	G	276	295
PSM	YHQIGSGKCEIK	927	sp|O14979-3|HNRDL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	9-UNIMOD:4	ms_run[2]:scan=1424	11.192	2	1418.6976	1418.6976	R	V	176	188
PSM	YKPVCNQVECHPYFNR	928	sp|P42330|AK1C3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	5-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=4407	29.372	3	2109.9513	2109.9513	K	S	184	200
PSM	YVPVKGDHVIGIVTAK	929	sp|Q9NQT5-2|EXOS3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5394	35.306	2	1694.9719	1694.9719	R	S	109	125
PSM	TLPNGRDALDGPAAEAEPEHSFDGLR	930	sp|Q15149|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	6-UNIMOD:267,26-UNIMOD:267	ms_run[1]:scan=7482	48.28120333333333	3	2755.298765	2754.311224	K	R	2762	2788
PSM	MKQVEELYHSLLELGEK	931	sp|Q13813|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	1-UNIMOD:35	ms_run[1]:scan=10084	65.197585	2	2061.048196	2061.045243	R	R	1066	1083
PSM	QLPAHDQDPSKCHELSPR	932	sp|Q9UGI8|TES_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:28,11-UNIMOD:188,12-UNIMOD:4,18-UNIMOD:267	ms_run[1]:scan=3851	26.00415333333333	3	2112.9979	2112.9977	K	E	153	171
PSM	QQHVIETLIGKK	933	sp|P48643|TCPE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:28,11-UNIMOD:188,12-UNIMOD:188	ms_run[1]:scan=7411	47.847595	2	1387.8237	1387.8221	K	Q	503	515
PSM	KNHEEEISTLR	934	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1871	13.764468333333332	2	1354.685755	1354.684093	K	G	216	227
PSM	TEELNREVAGHTEQLQMSR	935	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=4952	32.62256	2	2228.066281	2227.065143	R	S	275	294
PSM	TEELNREVAGHTEQLQMSR	936	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=4947	32.595935	3	2227.063199	2227.065143	R	S	275	294
PSM	QQGDHSLKEHELLEQQK	937	sp|Q13435|SF3B2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:28	ms_run[1]:scan=3552	24.14821	2	2030.0002	2028.9862	K	R	166	183
PSM	TGTITTFEHAHNMR	938	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	14-UNIMOD:267	ms_run[1]:scan=3832	25.88565	2	1625.765506	1624.765543	K	V	482	496
PSM	QSVENDIHGLRK	939	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:28,11-UNIMOD:267,12-UNIMOD:188	ms_run[1]:scan=4488	29.844133333333332	2	1393.7277	1393.7280	R	V	176	188
PSM	DGNVLLHEMQIQHPTASLIAK	940	sp|P40227|TCPZ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=8805	56.82318833333333	2	2315.182586	2314.210351	K	V	59	80
PSM	EHANKLIEVANLACSISNNEEGVK	941	sp|P35221|CTNA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	14-UNIMOD:4	ms_run[1]:scan=8946	57.729594999999996	3	2639.307876	2638.302080	R	L	425	449
PSM	TLQAGLSSNHVSHGEVLR	942	sp|O95163|ELP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=4114	27.609436666666664	3	1904.990833	1903.986423	K	K	672	690
PSM	VLEENHVEHQPR	943	sp|Q9H4L5|OSBL3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	12-UNIMOD:267	ms_run[1]:scan=1172	9.756201666666666	2	1495.723698	1495.740709	R	F	842	854
PSM	GYIWNYGAIPQTWEDPGHNDKHTGCCGDNDPIDVCEIGSK	944	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	25-UNIMOD:4,26-UNIMOD:4,35-UNIMOD:4	ms_run[1]:scan=10069	65.10135333333334	5	4575.959272	4574.959048	K	V	89	129
PSM	AHPVFYQGTYSQALNDAKR	945	sp|Q96CS3|FAF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	18-UNIMOD:188,19-UNIMOD:267	ms_run[2]:scan=5862	38.196	2	2181.0938	2177.1057	R	E	150	169
PSM	AHQVVEDGYEFFAKR	946	sp|P62136-3|PP1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	14-UNIMOD:188,15-UNIMOD:267	ms_run[2]:scan=6814	44.118	3	1810.8973	1806.9092	R	Q	203	218
PSM	ALNHEIEELEKR	947	sp|O95347-2|SMC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5165	33.912	2	1479.7682	1479.7682	K	K	276	288
PSM	ANGTTVHVGIHPSK	948	sp|Q9UNX3|RL26L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	14-UNIMOD:188	ms_run[2]:scan=1885	13.841	2	1422.7675	1422.7675	K	V	90	104
PSM	APIICVLGHVDTGKTK	949	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	5-UNIMOD:4,14-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=6243	40.505	3	1719.9744	1719.9744	R	I	631	647
PSM	DIQQHKEEAWVIGSVVAR	950	sp|P22102|PUR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7638	49.274	3	2064.0752	2064.0752	R	A	752	770
PSM	DREAALWEMEEHQLQER	951	sp|O94804|STK10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:267,17-UNIMOD:267	ms_run[2]:scan=7770	50.086	3	2189.0075	2189.0075	R	H	738	755
PSM	EILGTAQSVGCNVDGRHPHDIIDDINSGAVECPAS	952	sp|P30050-2|RL12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:4,16-UNIMOD:267,32-UNIMOD:4	ms_run[2]:scan=8456	54.536	3	3712.7085	3712.7085	K	-	98	133
PSM	EKLNLSCIHSPVVNELMR	953	sp|Q9Y2X3|NOP58_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	7-UNIMOD:4	ms_run[2]:scan=8840	57.053	2	2138.0976	2138.0976	K	G	100	118
PSM	ESGSLSPEHGPVVVHCSAGIGR	954	sp|P18031|PTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	16-UNIMOD:4	ms_run[2]:scan=4558	30.254	3	2231.0753	2231.0753	R	S	200	222
PSM	FGECSNKECPFLHIDPESK	955	sp|O95639-3|CPSF4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	4-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=6752	43.719	3	2293.0144	2293.0144	K	I	102	121
PSM	FGGEHVPNSPFQVTALAGDQPSVQPPLR	956	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	28-UNIMOD:267	ms_run[2]:scan=9690	62.601	3	2954.4914	2954.4914	R	S	1718	1746
PSM	FKEANNFLWPFK	957	sp|P18124|RL7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=10719	69.477	2	1551.8277	1551.8277	R	L	201	213
PSM	FYQNNKDFIDSLGLLHEQNMAK	958	sp|Q7L2H7-2|EIF3M_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	6-UNIMOD:188,22-UNIMOD:188	ms_run[2]:scan=9849	63.645	2	2636.3096	2636.3096	K	M	123	145
PSM	GFGFVTFDDHDPVDKIVLQK	959	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10440	67.586	3	2276.1477	2276.1477	R	Y	142	162
PSM	GGVHLTKDPNVVGQLAK	960	sp|Q96I99|SUCB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	7-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=5099	33.519	3	1744.0034	1744.0034	K	Q	102	119
PSM	GHSEKEVADAIR	961	sp|Q9BRK5-4|CAB45_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=1940	14.151	2	1310.6579	1310.6579	K	L	171	183
PSM	GLVCAPESLHTVHAALISVEK	962	sp|P57772-2|SELB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	4-UNIMOD:4	ms_run[2]:scan=8442	54.446	2	2230.178	2230.1780	R	I	274	295
PSM	GVPHPEDDHSQVEGPESLR	963	sp|Q6P996-3|PDXD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	19-UNIMOD:267	ms_run[2]:scan=4051	27.218	3	2093.9642	2093.9642	K	-	679	698
PSM	GYPHLCSICDLPVHSNK	964	sp|P43243|MATR3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	6-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=6423	41.672	2	1995.9295	1995.9295	K	E	288	305
PSM	HKLDVTSVEDYK	965	sp|P48643-2|TCPE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=4353	29.044	2	1444.7601	1444.7601	K	A	171	183
PSM	HKSETDTSLIR	966	sp|P40227|TCPZ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=1654	12.534	2	1285.6626	1285.6626	K	G	198	209
PSM	HLNEIDLFHCIDPNDSK	967	sp|Q15185-3|TEBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:4	ms_run[2]:scan=8582	55.34	2	2065.9527	2065.9527	K	H	49	66
PSM	HNSILQLDPSIPGVFR	968	sp|Q9Y487|VPP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10356	67	3	1791.9632	1791.9632	R	G	511	527
PSM	HPDASVNFSEFSKK	969	sp|P09429|HMGB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4937	32.539	3	1591.7631	1591.7631	K	C	31	45
PSM	HQILEQAVEDYAETVHQLSK	970	sp|Q01082-3|SPTB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	20-UNIMOD:188	ms_run[2]:scan=11081	71.92	3	2343.1802	2343.1802	K	T	1621	1641
PSM	HQLLEADISAHEDR	971	sp|Q13813-2|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	14-UNIMOD:267	ms_run[2]:scan=4245	28.391	2	1642.7939	1642.7939	K	L	1705	1719
PSM	HSPEDPEKYSCFALFVK	972	sp|P78527-2|PRKDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	8-UNIMOD:188,11-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=8264	53.32	2	2065.0018	2065.0018	K	F	693	710
PSM	HTTEAAAGALQNITAGDRR	973	sp|Q9Y446|PKP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	18-UNIMOD:267,19-UNIMOD:267	ms_run[2]:scan=4715	31.17	2	1971.9989	1971.9989	R	W	623	642
PSM	HVAEVLEYTKDEQLESLFQR	974	sp|P05198|IF2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:188,20-UNIMOD:267	ms_run[2]:scan=9756	63.034	2	2449.246	2445.2579	R	T	114	134
PSM	IFHTVTTTDDPVIRK	975	sp|O15371-2|EIF3D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4476	29.769	2	1741.9363	1741.9363	R	L	174	189
PSM	IGEEQSPEDAEDGPPELLFIHGGHTAK	976	sp|Q09028-4|RBBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8149	52.582	3	2872.3515	2872.3515	K	I	315	342
PSM	IGGSTDTGKHIK	977	sp|P46977-2|STT3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	9-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=742	7.3041	2	1224.6865	1224.6865	R	E	510	522
PSM	IGGVQQDTILAEGLHFR	978	sp|Q99623-2|PHB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9329	60.209	3	1852.9795	1852.9795	R	I	55	72
PSM	ILEVHVDKGMK	979	sp|O60884|DNJA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3725	25.231	2	1267.6958	1267.6958	K	H	216	227
PSM	ILHENTQTDKALYNR	980	sp|Q6UB35|C1TM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=2853	19.625	3	1814.9275	1814.9275	R	L	507	522
PSM	INSYGYGDHYIHIK	981	sp|Q96EY1-3|DNJA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5448	35.627	2	1678.8104	1678.8104	R	I	243	257
PSM	KHPDADSLYVEEVDVGEIAPR	982	sp|Q12904|AIMP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7850	50.585	3	2338.1441	2338.1441	R	T	167	188
PSM	KISSDLDGHPVPK	983	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=2506	17.545	3	1391.7409	1391.7409	R	Q	102	115
PSM	KLDEAVAEAHLGK	984	sp|P23526-2|SAHH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=3843	25.955	3	1391.7811	1391.7811	K	L	361	374
PSM	KPLPDHVSIVEPK	985	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4345	28.995	2	1457.8242	1457.8242	K	D	202	215
PSM	KPLVLCGDLNVAHEEIDLR	986	sp|P27695|APEX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:188,6-UNIMOD:4,19-UNIMOD:267	ms_run[2]:scan=8425	54.34	2	2206.1751	2202.1869	R	N	203	222
PSM	KVAPQNDSFGTQLPPMHQQQSR	987	sp|Q96AE4|FUBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4919	32.427	3	2493.2183	2493.2183	K	S	77	99
PSM	KVIQYLAYVASSHK	988	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6571	42.603	3	1605.8879	1605.8879	K	S	186	200
PSM	KVIQYLAYVASSHK	989	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=6572	42.607	3	1617.9281	1617.9281	K	S	186	200
PSM	KVYFHTDAAQAVGK	990	sp|Q9Y697-2|NFS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=3442	23.393	2	1545.8342	1545.8342	R	I	166	180
PSM	LDHYAIIKFPLTTESAMK	991	sp|P62750|RL23A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	8-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=8989	58.003	3	2089.1321	2089.1321	K	K	71	89
PSM	LGAMDIDTHKK	992	sp|Q15061|WDR43_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=2386	16.824	2	1227.6282	1227.6282	R	G	442	453
PSM	LGGIPDALPTVAAPRPVCQR	993	sp|Q9BRP1|PDD2L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	15-UNIMOD:267,18-UNIMOD:4,20-UNIMOD:267	ms_run[2]:scan=7941	51.146	2	2107.1475	2107.1475	K	C	32	52
PSM	LSPKHPESNTAGMDIFAK	994	sp|Q9Y696|CLIC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	4-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=5497	35.937	2	1954.0021	1954.0021	K	F	107	125
PSM	LTIHGDLYYEGKEFETR	995	sp|Q13435|SF3B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6874	44.498	3	2070.0058	2070.0058	K	L	584	601
PSM	MHLAGKTEQAK	996	sp|Q13442|HAP28_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	6-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=886	8.1273	2	1224.6687	1224.6687	K	A	127	138
PSM	MHNQIPQVTSDGKR	997	sp|Q92499-3|DDX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:35	ms_run[2]:scan=1817	13.449	2	1625.7944	1625.7944	R	L	259	273
PSM	MHNQIPQVTSDGKR	998	sp|Q92499-3|DDX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=2315	16.424	2	1609.7995	1609.7995	R	L	259	273
PSM	MKHYEVEILDAK	999	sp|Q9NZ01|TECR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:35,2-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=4690	31.025	2	1502.7842	1502.7842	-	T	1	13
PSM	MKPLVVFVLGGPGAGK	1000	sp|P30085-2|KCY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=10019	64.775	2	1580.9515	1580.9515	-	G	1	17
PSM	MKQVEELYHSLLELGEK	1001	sp|Q13813-2|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=11074	71.873	2	2045.0503	2045.0503	R	R	1066	1083
PSM	NIDDGTSDRPYSHALVAGIDR	1002	sp|P61353|RL27_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5876	38.283	4	2271.088	2271.0880	K	Y	28	49
PSM	NLLHVTDTGVGMTREELVK	1003	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:35	ms_run[2]:scan=6341	41.139	2	2127.0994	2127.0994	K	N	143	162
PSM	NTGHKIETDLPQIR	1004	sp|Q29RF7|PDS5A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4526	30.061	2	1620.8584	1620.8584	R	S	704	718
PSM	NVTKDHIMEIFSTYGK	1005	sp|Q15287-3|RNPS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	8-UNIMOD:35	ms_run[2]:scan=7036	45.515	2	1897.9244	1897.9244	R	I	134	150
PSM	NVTKDHIMEIFSTYGK	1006	sp|Q15287-3|RNPS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	4-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=8674	55.945	3	1893.9697	1893.9697	R	I	134	150
PSM	NYGFVHIEDKTAAEDAIR	1007	sp|Q9BWF3-3|RBM4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6503	42.179	3	2047.9963	2047.9963	K	N	36	54
PSM	QATINIGTIGHVAHGK	1008	sp|Q2VIR3-2|IF2GL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5276	34.582	2	1615.8794	1615.8794	R	S	39	55
PSM	QLFHPEQLITGKEDAANNYAR	1009	sp|P68366-2|TBA4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7198	46.51	2	2414.1979	2414.1979	R	G	70	91
PSM	RDQALTEEHAR	1010	sp|P12814-2|ACTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:267,11-UNIMOD:267	ms_run[2]:scan=853	7.9375	3	1344.6649	1344.6649	R	Q	614	625
PSM	RGDLPFVVPR	1011	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:267,10-UNIMOD:267	ms_run[2]:scan=6569	42.594	2	1174.6726	1174.6726	R	R	1923	1933
PSM	RGQTCVVHYTGMLEDGK	1012	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	5-UNIMOD:4	ms_run[2]:scan=4975	32.761	3	1949.9088	1949.9088	K	K	19	36
PSM	RPILTIITLEDSSGNLLGR	1013	sp|P04637-8|P53_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:267,19-UNIMOD:267	ms_run[2]:scan=11256	73.223	3	2087.1853	2087.1853	R	N	117	136
PSM	SAGLPSHSSVISQHSK	1014	sp|P82909|RT36_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=2228	15.923	2	1620.822	1620.8220	R	G	42	58
PSM	SFGHFPGPEFLDVEK	1015	sp|Q8IWW6-3|RHG12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9721	62.809	3	1704.8148	1704.8148	R	T	176	191
PSM	SGEHDFGAAFDGDGDRNMILGK	1016	sp|P36871-3|PGM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	18-UNIMOD:35	ms_run[2]:scan=6638	43.014	3	2324.0128	2324.0128	K	H	81	103
PSM	SHFEQWGTLTDCVVMRDPNTK	1017	sp|P09651-3|ROA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:4	ms_run[2]:scan=8172	52.729	3	2520.1526	2520.1526	R	R	32	53
PSM	SHIDKANFNNEK	1018	sp|P07311|ACYP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=1165	9.7124	2	1415.6793	1415.6793	K	V	74	86
PSM	SLDMDSIIAEVK	1019	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10446	67.619	2	1319.6643	1319.6643	R	A	253	265
PSM	SPTLYGISHDDLKGDPLLDQR	1020	sp|O75643|U520_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8310	53.614	3	2339.1757	2339.1757	R	R	932	953
PSM	STHEFLHEVPAASEEIFK	1021	sp|Q9H269|VPS16_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7811	50.351	3	2070.0058	2070.0058	R	I	322	340
PSM	STKHWELTAEGEEIAR	1022	sp|Q9Y285-2|SYFA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5295	34.698	3	1855.9064	1855.9064	R	E	57	73
PSM	TEAEIAHIALETLEGHQR	1023	sp|O75955|FLOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	18-UNIMOD:267	ms_run[2]:scan=10037	64.891	3	2027.0311	2027.0311	K	A	92	110
PSM	TGTITTFEHAHNMR	1024	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3788	25.611	2	1614.7573	1614.7573	K	V	482	496
PSM	TGVHHYSGNNIELGTACGK	1025	sp|P62888|RL30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	17-UNIMOD:4	ms_run[2]:scan=2993	20.459	3	2013.9327	2013.9327	K	Y	69	88
PSM	THINIVVIGHVDSGK	1026	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	15-UNIMOD:188	ms_run[2]:scan=5636	36.785	3	1593.8934	1593.8934	K	S	6	21
PSM	THINIVVIGHVDSGK	1027	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6362	41.286	2	1587.8733	1587.8733	K	S	6	21
PSM	THINIVVIGHVDSGK	1028	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6449	41.839	3	1587.8733	1587.8733	K	S	6	21
PSM	THLPLALLPQTLLDQK	1029	sp|P50226|ST1A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	16-UNIMOD:188	ms_run[2]:scan=11378	74.072	2	1806.071	1806.0710	K	V	107	123
PSM	THLSLSHNPEQK	1030	sp|P11586|C1TC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:188	ms_run[2]:scan=1678	12.663	2	1395.7202	1395.7202	K	G	867	879
PSM	THPSGRDPETPIIVVK	1031	sp|P09327|VILI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4173	27.963	2	1744.9472	1744.9472	K	Q	684	700
PSM	TKALLADAQLMLDHLK	1032	sp|Q92614-5|MY18A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10881	70.584	3	1779.9917	1779.9917	R	N	1203	1219
PSM	TKGVDEVTIVNILTNR	1033	sp|P07355-2|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:188,16-UNIMOD:267	ms_run[2]:scan=10258	66.341	2	1787.0124	1783.0242	K	S	66	82
PSM	TSGHVDKFADFMVK	1034	sp|P41250|GARS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	7-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=6060	39.4	3	1592.806	1592.8060	K	D	191	205
PSM	TTGIVMDSGDGVTHTVPIYEGYALPHAILR	1035	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	6-UNIMOD:35,30-UNIMOD:267	ms_run[2]:scan=9798	63.31	3	3208.6102	3208.6102	R	L	148	178
PSM	TVLEHYALEDDPLAAFKQR	1036	sp|Q3ZCQ8-3|TIM50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9536	61.596	3	2215.1273	2215.1273	R	Q	183	202
PSM	VCANHWITTTMNLKPLSGSDR	1037	sp|P0DJD0|RGPD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:4	ms_run[2]:scan=8409	54.237	3	2400.1678	2400.1678	K	A	1092	1113
PSM	VCEALEHGHVEWSSR	1038	sp|Q8N543-2|OGFD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:4	ms_run[2]:scan=4510	29.968	2	1794.8108	1794.8108	K	G	167	182
PSM	VDIDAPDVDVHGPDWHLK	1039	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7777	50.132	2	2026.9749	2026.9749	K	M	731	749
PSM	VDINAPDVDVHGPDWHLK	1040	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	18-UNIMOD:188	ms_run[2]:scan=7597	49.018	3	2032.011	2032.0110	K	M	3584	3602
PSM	VHELNEEIGKLLAK	1041	sp|Q9Y383-3|LC7L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=7671	49.477	3	1603.9336	1603.9336	R	V	123	137
PSM	VIHDNFGIVEGLMTTVHAITATQK	1042	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:35,24-UNIMOD:188	ms_run[2]:scan=11651	76.102	3	2616.3677	2616.3677	K	T	163	187
PSM	VILHLKEDQTEYLEER	1043	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	6-UNIMOD:188,16-UNIMOD:267	ms_run[2]:scan=6090	39.558	2	2030.0655	2026.0774	K	R	186	202
PSM	VILHLKEDQTEYLEER	1044	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	6-UNIMOD:188,16-UNIMOD:267	ms_run[2]:scan=6251	40.557	2	2030.0655	2026.0774	K	R	186	202
PSM	VLEEVCASPQGPGALFVQSHLEDLKK	1045	sp|Q5JTH9-2|RRP12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	6-UNIMOD:4,25-UNIMOD:188,26-UNIMOD:188	ms_run[2]:scan=9508	61.415	3	2862.4988	2862.4988	R	T	694	720
PSM	VQQLLHICSEHFDSK	1046	sp|Q13200-2|PSMD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	8-UNIMOD:4	ms_run[2]:scan=5749	37.493	2	1839.8938	1839.8938	K	E	450	465
PSM	VREEVPLELVEAHVK	1047	sp|Q92922|SMRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7675	49.498	2	1745.9676	1745.9676	R	K	725	740
PSM	VTAPDVDLHLKAPK	1048	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=5561	36.324	2	1514.8859	1514.8859	K	I	4916	4930
PSM	YASICQQNGIVPIVEPEILPDGDHDLKR	1049	sp|P04075-2|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	5-UNIMOD:4	ms_run[2]:scan=9551	61.695	2	3175.5972	3175.5972	R	C	228	256
PSM	YHNVGLSKCEIK	1050	sp|Q14103-3|HNRPD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	8-UNIMOD:188,9-UNIMOD:4,12-UNIMOD:188	ms_run[2]:scan=2438	17.144	2	1458.7692	1458.7692	K	V	244	256
PSM	YHQIGSGKCEIK	1051	sp|O14979-3|HNRDL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	8-UNIMOD:188,9-UNIMOD:4,12-UNIMOD:188	ms_run[2]:scan=1425	11.197	2	1430.7379	1430.7379	R	V	176	188
PSM	YNIEKDIAAHIK	1052	sp|P63167|DYL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	5-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=6539	42.404	2	1425.8019	1425.8019	K	K	32	44
PSM	EDSQRPGAHLTVK	1053	sp|P09651|ROA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:27	ms_run[1]:scan=1503	11.638488333333333	3	1418.7260	1418.7261	R	K	93	106
PSM	IISKIENHEGVR	1054	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	4-UNIMOD:188,12-UNIMOD:267	ms_run[1]:scan=2220	15.876479999999999	2	1410.784094	1409.796161	K	R	267	279
PSM	TGTITTFEHAHNMR	1055	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	13-UNIMOD:35	ms_run[1]:scan=2448	17.201445	2	1630.752251	1630.752189	K	V	482	496
PSM	KYSDPGPVYDCLVWHDGEVWR	1056	sp|P29144|TPP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	11-UNIMOD:4	ms_run[1]:scan=9792	63.26858333333334	3	2578.179674	2577.174694	K	A	187	208
PSM	QLLHNFPPDQLTSSGAPFWSGPKR	1057	sp|P22314|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:28	ms_run[1]:scan=11352	73.88736666666667	3	2662.3142	2662.3282	R	C	724	748
PSM	ICANHYITPMMELKPNAGSDR	1058	sp|P43487|RANG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	2-UNIMOD:4,10-UNIMOD:35	ms_run[1]:scan=5714	37.27292666666666	3	2434.129783	2433.123921	K	A	98	119
PSM	QSQHDKIDASELSFPFHESILK	1059	sp|P42166|LAP2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:28,6-UNIMOD:188,22-UNIMOD:188	ms_run[1]:scan=9941	64.26008	4	2550.2766	2550.2788	K	V	479	501
PSM	QSQHDKIDASELSFPFHESILK	1060	sp|P42166|LAP2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:28	ms_run[1]:scan=9906	64.03160166666667	3	2538.2398	2538.2385	K	V	479	501
PSM	QATINIGTIGHVAHGK	1061	sp|Q2VIR3|IF2GL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:28,16-UNIMOD:188	ms_run[1]:scan=6739	43.642226666666666	2	1604.8728	1604.8725	R	S	39	55
PSM	IIDKNGIHDLDNISFPK	1062	sp|P49721|PSB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	4-UNIMOD:188,17-UNIMOD:188	ms_run[1]:scan=8147	52.56511333333333	3	1952.049139	1950.061335	R	Q	182	199
PSM	ACFGGLFANLIRPGDAK	1063	sp|Q9NR09|BIRC6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	2-UNIMOD:4,12-UNIMOD:267,17-UNIMOD:188	ms_run[1]:scan=11126	72.237375	2	1822.944244	1821.953072	R	A	2891	2908
PSM	LENGELEHIRPK	1064	sp|Q15102|PA1B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	10-UNIMOD:267,12-UNIMOD:188	ms_run[1]:scan=3880	26.182115	2	1450.775780	1449.791075	R	I	84	96
PSM	MREIVHIQAGQCGNQIGAK	1065	sp|Q13885|TBB2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:35,12-UNIMOD:4	ms_run[1]:scan=4062	27.284473333333334	3	2127.040348	2125.052077	-	F	1	20
PSM	GYIWNYGAIPQTWEDPGHNDKHTGCCGDNDPIDVCEIGSK	1066	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	25-UNIMOD:4,26-UNIMOD:4,35-UNIMOD:4	ms_run[1]:scan=10068	65.09517666666667	5	4575.959272	4574.959048	K	V	89	129
PSM	AHAAIRENPVYEK	1067	sp|P46777|RL5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=1831	13.531	2	1496.7736	1496.7736	K	K	243	256
PSM	AHQITDESLESTRR	1068	sp|O00161-2|SNP23_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=2323	16.47	2	1641.8071	1641.8071	R	I	13	27
PSM	ALDCSSSIRQPSLHMSAAAASR	1069	sp|O94776-2|MTA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	4-UNIMOD:4	ms_run[2]:scan=5120	33.645	3	2315.111	2315.1110	R	D	33	55
PSM	ALEHFTDLYDIKR	1070	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6985	45.201	2	1619.8308	1619.8308	R	A	626	639
PSM	ANQHKEQQLGLK	1071	sp|Q9UBW8|CSN7A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=1266	10.295	2	1392.7474	1392.7474	R	Q	195	207
PSM	ASITPGTILIILTGR	1072	sp|Q02878|RL6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	15-UNIMOD:267	ms_run[2]:scan=13100	91.565	2	1534.9322	1534.9322	R	H	142	157
PSM	AVGLISHVLEQNQEGDAAYRK	1073	sp|Q13825-2|AUHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6836	44.254	3	2297.1764	2297.1764	K	A	221	242
PSM	DVHNIYGLYVHMATADGLR	1074	sp|Q14697|GANAB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10455	67.679	3	2144.0473	2144.0473	R	Q	570	589
PSM	ENKLFEHYYQELK	1075	sp|Q08J23-2|NSUN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	3-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=7376	47.63	2	1751.8921	1751.8921	K	I	44	57
PSM	EVGEHLVSIKK	1076	sp|O75369-6|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=2743	18.915	2	1237.703	1237.7030	R	N	1946	1957
PSM	EYGSCSHHYQQLLQSLEQGAQEESR	1077	sp|Q15149-3|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	5-UNIMOD:4,25-UNIMOD:267	ms_run[2]:scan=8933	57.652	4	2973.3187	2973.3187	R	C	980	1005
PSM	FASSEKHSYGK	1078	sp|P49589-3|SYCC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=763	7.4256	2	1239.5884	1239.5884	K	L	358	369
PSM	FDPYEHEALFHTPVEGK	1079	sp|Q9HAV7|GRPE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7023	45.436	2	2014.9425	2014.9425	K	E	170	187
PSM	FFEHFIEGGR	1080	sp|Q96FW1|OTUB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:267	ms_run[2]:scan=7123	46.056	2	1247.5963	1247.5963	K	T	189	199
PSM	FHVEEEGKGK	1081	sp|P00558-2|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=1064	9.1267	2	1158.5669	1158.5669	R	D	96	106
PSM	FHVEEEGKGK	1082	sp|P00558-2|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	8-UNIMOD:188	ms_run[2]:scan=1086	9.2506	2	1164.5871	1164.5871	R	D	96	106
PSM	FLRLEDFLDNQR	1083	sp|Q16513-4|PKN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10456	67.686	3	1564.7998	1564.7998	K	H	291	303
PSM	FLRLEDFLDNQR	1084	sp|Q16513-4|PKN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	3-UNIMOD:267,12-UNIMOD:267	ms_run[2]:scan=10460	67.714	3	1584.8163	1584.8163	K	H	291	303
PSM	FSGWYDADLSPAGHEEAKR	1085	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6582	42.664	3	2134.9708	2134.9708	R	G	22	41
PSM	GFCFLEYEDHKTAAQAR	1086	sp|O60506-5|HNRPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	3-UNIMOD:4,11-UNIMOD:188,17-UNIMOD:267	ms_run[2]:scan=6710	43.463	2	2057.96	2053.9719	R	R	135	152
PSM	GHPDLQGQPAEEIFESVGDRELR	1087	sp|P49257|LMAN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9340	60.28	2	2578.2412	2578.2412	K	Q	310	333
PSM	GIHQSTIDLKNELK	1088	sp|Q14258|TRI25_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=4892	32.266	3	1606.9081	1606.9081	K	Q	336	350
PSM	GMGSLDAMDKHLSSQNR	1089	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:188,17-UNIMOD:267	ms_run[2]:scan=4901	32.318	2	1861.8746	1857.8864	R	Y	413	430
PSM	GVMINKDVTHPR	1090	sp|P49368-2|TCPG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=2369	16.729	2	1365.7187	1365.7187	R	M	179	191
PSM	HAAVLVETIKK	1091	sp|O75122-2|CLAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=2495	17.473	2	1207.7289	1207.7289	R	G	257	268
PSM	HDGITVAVHK	1092	sp|O43504|LTOR5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:188	ms_run[2]:scan=1700	12.784	2	1081.5976	1081.5976	K	M	79	89
PSM	HIPGAAFFDIDQCSDR	1093	sp|P25325|THTM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=8634	55.682	3	1857.8344	1857.8344	R	T	53	69
PSM	HIVENAVQKELR	1094	sp|O00410-2|IPO5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=3519	23.928	3	1434.7943	1434.7943	K	L	480	492
PSM	HKELQQQLVDAK	1095	sp|Q9NUQ3-2|TXLNG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=2359	16.675	2	1447.8186	1447.8186	K	L	164	176
PSM	HKTTGQVVAMK	1096	sp|P06493-2|CDK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=1057	9.0855	2	1198.6492	1198.6492	R	K	23	34
PSM	HPDSSVNFAEFSKK	1097	sp|P26583|HMGB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4706	31.118	3	1591.7631	1591.7631	K	C	31	45
PSM	HQLLEADISAHEDR	1098	sp|Q13813-2|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4256	28.455	2	1632.7856	1632.7856	K	L	1705	1719
PSM	HTLQQHQETPK	1099	sp|Q7Z417-2|NUFP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=619	6.6039	2	1345.6739	1345.6739	K	K	79	90
PSM	HTVDDGLDIRK	1100	sp|Q86VP6|CAND1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=2528	17.66	2	1267.6521	1267.6521	K	A	1073	1084
PSM	HVVLGAIENKVESK	1101	sp|P41227-2|NAA10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4598	30.479	3	1521.8515	1521.8515	R	G	155	169
PSM	IHEAIIQSPPIDYFDVFKESK	1102	sp|Q9H993|ARMT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	18-UNIMOD:188,21-UNIMOD:188	ms_run[2]:scan=10940	70.981	3	2487.3088	2487.3088	R	E	124	145
PSM	ILDLGITGPEGHVLSRPEEVEAEAVNR	1103	sp|Q16555-2|DPYL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8950	57.757	3	2899.5039	2899.5039	R	A	176	203
PSM	IQDLEHHLGLALNEVQAAK	1104	sp|Q9Y3P9|RBGP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8435	54.401	3	2098.1171	2098.1171	K	K	1028	1047
PSM	ISAEDGLKHEYFR	1105	sp|Q9UQ88-8|CD11A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5222	34.252	2	1563.7682	1563.7682	R	E	84	97
PSM	ISQEHLADHFDSR	1106	sp|P19174-2|PLCG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=3575	24.299	2	1553.7223	1553.7223	R	E	1263	1276
PSM	KFYGPEGPYGVFAGR	1107	sp|O00264|PGRC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7629	49.218	3	1643.8096	1643.8096	R	D	105	120
PSM	KHEAIETDIAAYEER	1108	sp|Q01082-3|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5352	35.051	3	1773.8533	1773.8533	K	V	450	465
PSM	KHGLEVIYMIEPIDEYCVQQLK	1109	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:188,17-UNIMOD:4,22-UNIMOD:188	ms_run[2]:scan=10832	70.245	4	2716.4007	2716.4007	R	E	513	535
PSM	KIPNPDFFEDLEPFR	1110	sp|P27824-3|CALX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11659	76.166	3	1862.9203	1862.9203	R	M	293	308
PSM	KNCHLNENIEK	1111	sp|Q13907|IDI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	3-UNIMOD:4	ms_run[2]:scan=1130	9.5106	2	1397.6721	1397.6721	K	G	37	48
PSM	KPLPDHVSIVEPK	1112	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=4348	29.012	2	1469.8645	1469.8645	K	D	202	215
PSM	KQELEEICHDLEAR	1113	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	8-UNIMOD:4	ms_run[2]:scan=6458	41.897	3	1768.8414	1768.8414	K	V	910	924
PSM	KSNFSLEDFQHSK	1114	sp|P56937-3|DHB7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5222	34.252	2	1565.7474	1565.7474	R	G	176	189
PSM	KTHSEEFTNSLK	1115	sp|Q9H788-2|SH24A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=2177	15.628	2	1431.7397	1431.7397	R	T	70	82
PSM	KVTSVVFHPSQDLVFSASPDATIR	1116	sp|Q9UMS4|PRP19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:188,24-UNIMOD:267	ms_run[2]:scan=8525	54.972	2	2616.3882	2612.4001	K	I	266	290
PSM	KYEDICPSTHNMDVPNIK	1117	sp|Q9GZV4|IF5A2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	6-UNIMOD:4	ms_run[2]:scan=5673	37.014	3	2159.998	2159.9980	K	R	68	86
PSM	LDKSQIHDIVLVGGSTR	1118	sp|P11142-2|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	3-UNIMOD:188,17-UNIMOD:267	ms_run[2]:scan=6079	39.498	2	1853.0342	1849.0460	K	I	326	343
PSM	LGAMDIDTHKK	1119	sp|Q15061|WDR43_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=2384	16.813	2	1239.6684	1239.6684	R	G	442	453
PSM	LGGHGPSFPLK	1120	sp|P13010|XRCC5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:188	ms_run[2]:scan=4749	31.374	2	1114.6231	1114.6231	R	G	185	196
PSM	LHGLDEEAEQKLFSEK	1121	sp|P33991|MCM4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6740	43.647	3	1871.9265	1871.9265	R	R	429	445
PSM	LIQNNHYAMEDVATRR	1122	sp|Q13813-2|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4300	28.728	2	1929.9479	1929.9479	K	D	533	549
PSM	LLKNHDEESLECLCR	1123	sp|O43432-4|IF4G3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=4771	31.508	2	1914.8928	1914.8928	K	L	637	652
PSM	LNDGHFMPVLGFGTYAPPEVPR	1124	sp|P42330|AK1C3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	7-UNIMOD:35	ms_run[2]:scan=9962	64.397	3	2429.1838	2429.1838	K	S	10	32
PSM	LQNEILKDLSDGIHVVK	1125	sp|Q07065|CKAP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9936	64.226	2	1920.068	1920.0680	K	D	207	224
PSM	LSASLLHSHDTETR	1126	sp|Q9HCU5|PREB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	14-UNIMOD:267	ms_run[2]:scan=2980	20.379	2	1575.7881	1575.7881	R	A	57	71
PSM	MIPCDFLIPVQTQHPIR	1127	sp|P06744|G6PI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:35,4-UNIMOD:4	ms_run[2]:scan=9177	59.205	2	2080.0598	2080.0598	K	K	401	418
PSM	MKHYEVEILDAK	1128	sp|Q9NZ01|TECR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5228	34.289	2	1474.749	1474.7490	-	T	1	13
PSM	MLITILGTVKPNANR	1129	sp|P17931|LEG3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:35	ms_run[2]:scan=7499	48.387	2	1655.9393	1655.9393	R	I	130	145
PSM	MLNIHPSLLPSFK	1130	sp|P22102|PUR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:35,13-UNIMOD:188	ms_run[2]:scan=8847	57.1	2	1517.8371	1517.8372	K	G	911	924
PSM	MLNIHPSLLPSFK	1131	sp|P22102|PUR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:188	ms_run[2]:scan=9543	61.641	2	1501.8422	1501.8422	K	G	911	924
PSM	MVLAGVGVEHEHLVDCAR	1132	sp|Q10713|MPPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:35,16-UNIMOD:4,18-UNIMOD:267	ms_run[2]:scan=5466	35.74	3	2016.9749	2016.9749	R	K	251	269
PSM	NKITLQDVVSHSK	1133	sp|P46940|IQGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4696	31.063	3	1467.8045	1467.8045	K	K	923	936
PSM	NPDTQWITKPVHK	1134	sp|P61313|RL15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	9-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=4224	28.267	2	1574.8608	1574.8608	R	H	145	158
PSM	NSLKEANHDGDFGITLAELR	1135	sp|P20020-5|AT2B1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8221	53.043	2	2199.092	2199.0920	K	A	16	36
PSM	NVNVFKFIIPQIVK	1136	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	6-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=12122	79.853	2	1670.0322	1670.0322	R	Y	114	128
PSM	QELSHALYQHDAACR	1137	sp|Q9UMS4|PRP19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	14-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=3000	20.498	2	1807.8299	1807.8299	R	V	101	116
PSM	QQHVIETLIGKK	1138	sp|P48643-2|TCPE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4571	30.325	2	1392.8089	1392.8089	K	Q	410	422
PSM	QSVENDIHGLRK	1139	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=2717	18.775	2	1394.7266	1394.7266	R	V	176	188
PSM	RGDLPFVVPR	1140	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6570	42.598	2	1154.656	1154.6560	R	R	1923	1933
PSM	SCLLHQFTEKK	1141	sp|P61106|RAB14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:4,10-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=4121	27.649	2	1401.7477	1401.7477	K	F	25	36
PSM	SCLLHQFTEKK	1142	sp|P61106|RAB14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:4	ms_run[2]:scan=4123	27.658	2	1389.7075	1389.7075	K	F	25	36
PSM	SDKWIDIHNPATNEVIGR	1143	sp|Q02252-2|MMSA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7149	46.216	3	2064.0389	2064.0389	K	V	53	71
PSM	SHLMSLYSACSSEVPHGPVDQK	1144	sp|O95816-2|BAG2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:4	ms_run[2]:scan=6349	41.194	3	2428.1151	2428.1151	K	F	100	122
PSM	STANKYQVFFFGTHETAFLGPK	1145	sp|P51858-2|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	5-UNIMOD:188,22-UNIMOD:188	ms_run[2]:scan=10136	65.538	3	2501.2782	2501.2782	K	D	33	55
PSM	SVQPQSHKPQPTR	1146	sp|Q6PKG0-3|LARP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=600	6.503	2	1488.7797	1488.7797	K	K	109	122
PSM	TALHFASCNGNDQIVQLLLDHGADPNQR	1147	sp|Q6NXT1|ANR54_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	8-UNIMOD:4,28-UNIMOD:267	ms_run[2]:scan=10847	70.342	3	3113.4976	3113.4976	R	D	145	173
PSM	TDLCDHALHISHDEL	1148	sp|Q9Y2B0|CNPY2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	4-UNIMOD:4	ms_run[2]:scan=6278	40.727	2	1774.7944	1774.7944	R	-	168	183
PSM	TDRYTIHSQLEHLQSK	1149	sp|Q9BWJ5|SF3B5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:1	ms_run[2]:scan=5642	36.822	4	1996.9967	1996.9967	M	Y	2	18
PSM	TGVHHYSGNNIELGTACGK	1150	sp|P62888|RL30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	17-UNIMOD:4,19-UNIMOD:188	ms_run[2]:scan=2940	20.14	3	2019.9528	2019.9528	K	Y	69	88
PSM	TGVHHYSGNNIELGTACGK	1151	sp|P62888|RL30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	17-UNIMOD:4,19-UNIMOD:188	ms_run[2]:scan=3137	21.305	3	2019.9528	2019.9528	K	Y	69	88
PSM	THINIVVIGHVDSGK	1152	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	15-UNIMOD:188	ms_run[2]:scan=6525	42.319	2	1593.8934	1593.8934	K	S	6	21
PSM	THLPLALLPQTLLDQK	1153	sp|P50226|ST1A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11384	74.114	2	1800.0509	1800.0509	K	V	107	123
PSM	TLTELILDAQEHVKNPYK	1154	sp|P17480-2|UBF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	14-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=10277	66.466	3	2123.1665	2123.1665	R	G	84	102
PSM	TPELNLDQFHDKTPYTIMFGPDK	1155	sp|P27824-3|CALX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:188,18-UNIMOD:35,23-UNIMOD:188	ms_run[2]:scan=9426	60.878	3	2734.3351	2734.3351	K	C	63	86
PSM	TPELNLDQFHDKTPYTIMFGPDK	1156	sp|P27824-3|CALX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:188,18-UNIMOD:35,23-UNIMOD:188	ms_run[2]:scan=9430	60.903	2	2734.3351	2734.3351	K	C	63	86
PSM	TPELNLDQFHDKTPYTIMFGPDK	1157	sp|P27824-3|CALX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10607	68.728	4	2706.3	2706.3000	K	C	63	86
PSM	TRAEAEAAAVHGAR	1158	sp|Q5T8P6-5|RBM26_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:267,14-UNIMOD:267	ms_run[2]:scan=1174	9.767	3	1428.7337	1428.7337	K	F	461	475
PSM	TTGIVMDSGDGVTHTVPIYEGYALPHAILR	1159	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10269	66.413	4	3182.607	3182.6070	R	L	148	178
PSM	TTGIVMDSGDGVTHTVPIYEGYALPHAILR	1160	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10315	66.702	3	3182.607	3182.6070	R	L	148	178
PSM	TTMRPQSFYDGSHSCAR	1161	sp|Q13126-7|MTAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	15-UNIMOD:4	ms_run[2]:scan=3729	25.253	2	1999.8629	1999.8629	R	G	117	134
PSM	TVEYLHAQGVVHR	1162	sp|P51812|KS6A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:267	ms_run[2]:scan=3744	25.348	2	1517.7978	1517.7978	K	D	526	539
PSM	VAFDPEQKPLHGVLK	1163	sp|Q14684-2|RRP1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5722	37.323	2	1676.925	1676.9250	R	T	695	710
PSM	VAVNDAHLLQYNHR	1164	sp|P17931|LEG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	14-UNIMOD:267	ms_run[2]:scan=4636	30.702	3	1658.8517	1658.8517	K	V	211	225
PSM	VCANHWITTTMNLKPLSGSDR	1165	sp|P0DJD0|RGPD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:4	ms_run[2]:scan=8397	54.165	4	2400.1678	2400.1678	K	A	1092	1113
PSM	VFLENVIRDAVTYTEHAK	1166	sp|P62805|H4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=12079	79.473	3	2104.0953	2104.0953	K	R	61	79
PSM	VFLENVIRDAVTYTEHAK	1167	sp|P62805|H4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=12181	80.474	3	2104.0953	2104.0953	K	R	61	79
PSM	VIISAPSADAPMFVMGVNHEKYDNSLK	1168	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	15-UNIMOD:35	ms_run[2]:scan=8292	53.498	2	2948.4412	2948.4412	R	I	119	146
PSM	VLVAQHDVYKGLLPEELTPLILATQK	1169	sp|P13804-2|ETFA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:188,26-UNIMOD:188	ms_run[2]:scan=11850	77.609	3	2899.6825	2899.6825	K	Q	27	53
PSM	VNKDSLTDLYVQHAIPLPQR	1170	sp|Q9BVC5-2|ASHWN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8405	54.215	3	2306.2383	2306.2383	R	D	82	102
PSM	VNVGAGSHPNKVK	1171	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=842	7.8773	2	1305.7153	1305.7153	R	V	761	774
PSM	VTILCDKFSGHPK	1172	sp|A6NDY0-2|EPAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	5-UNIMOD:4	ms_run[2]:scan=4393	29.289	2	1500.7759	1500.7759	R	G	176	189
PSM	VYAILTHGIFSGPAISR	1173	sp|P60891-2|PRPS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9802	63.335	3	1800.9887	1800.9887	R	I	177	194
PSM	YGDGGSTFQSTTGHCVHMR	1174	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	15-UNIMOD:4,19-UNIMOD:267	ms_run[2]:scan=3760	25.444	3	2106.8875	2106.8875	R	G	276	295
PSM	YGDSEFTVQSTTGHCVHMR	1175	sp|P52597|HNRPF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	15-UNIMOD:4,18-UNIMOD:35	ms_run[2]:scan=3953	26.628	2	2226.9423	2226.9423	R	G	276	295
PSM	YGDSEFTVQSTTGHCVHMR	1176	sp|P52597|HNRPF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	15-UNIMOD:4,19-UNIMOD:267	ms_run[2]:scan=4912	32.382	3	2220.9556	2220.9556	R	G	276	295
PSM	YHTINGHNCEVK	1177	sp|P51991-2|ROA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	9-UNIMOD:4,12-UNIMOD:188	ms_run[2]:scan=1119	9.4493	2	1476.6875	1476.6875	K	K	166	178
PSM	HGEKVEECQR	1178	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	8-UNIMOD:4	ms_run[1]:scan=516	6.0259849999999995	2	1270.568714	1270.572434	R	F	1398	1408
PSM	SGPFGQIFRPDNFVFGQSGAGNNWAK	1179	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	9-UNIMOD:267,26-UNIMOD:188	ms_run[1]:scan=11757	76.94023833333333	3	2814.341583	2813.364495	R	G	78	104
PSM	NGQTREHALLAYTLGVK	1180	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	5-UNIMOD:267,17-UNIMOD:188	ms_run[1]:scan=7636	49.262391666666666	2	1887.019666	1886.034493	K	Q	130	147
PSM	HYGGLTGLNKAETAAK	1181	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	10-UNIMOD:188,16-UNIMOD:188	ms_run[1]:scan=3376	22.92635	3	1641.884632	1641.887728	R	H	91	107
PSM	KNHEEEISTLR	1182	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:188,11-UNIMOD:267	ms_run[1]:scan=1884	13.836711666666666	2	1371.716278	1370.712491	K	G	216	227
PSM	SRLEQEIATYR	1183	sp|P08727|K1C19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=5438	35.565693333333336	2	1364.705688	1364.704828	K	S	371	382
PSM	QSVENDIHGLRK	1184	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28	ms_run[1]:scan=4490	29.85225	2	1377.6996	1377.6996	R	V	176	188
PSM	SHTEEDCTEELFDFLHAR	1185	sp|P07919|QCR6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	7-UNIMOD:4	ms_run[1]:scan=10526	68.15219	3	2234.957796	2234.953862	R	D	61	79
PSM	TRAEAEAAAVHGAR	1186	sp|Q5T8P6|RBM26_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1173	9.761448333333334	3	1409.722835	1408.717124	K	F	934	948
PSM	QDLPNAMNAAEITDKLGLHSLR	1187	sp|P84077|ARF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28,15-UNIMOD:188,22-UNIMOD:267	ms_run[1]:scan=11130	72.26658166666667	3	2405.2232	2405.2342	K	H	128	150
PSM	ISAEDGLKHEYFR	1188	sp|Q9UQ88|CD11A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	8-UNIMOD:188,13-UNIMOD:267	ms_run[1]:scan=5240	34.360305	2	1579.790598	1579.796555	R	E	700	713
PSM	QIENIVDKTFFHQENVR	1189	sp|Q9H089|LSG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28	ms_run[1]:scan=11103	72.07153666666667	3	2099.0312	2099.0432	K	A	587	604
PSM	AVGLISHVLEQNQEGDAAYRK	1190	sp|Q13825|AUHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	20-UNIMOD:267,21-UNIMOD:188	ms_run[1]:scan=6828	44.20339	3	2314.206211	2313.204806	K	A	250	271
PSM	VAVLDGKHTGPITCLQFNPK	1191	sp|Q6UXN9|WDR82_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	14-UNIMOD:4	ms_run[1]:scan=7220	46.640611666666665	2	2194.166512	2194.156859	K	F	274	294
PSM	AERVHELNEEIGK	1192	sp|Q9Y383-3|LC7L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2581	17.976	3	1522.774	1522.7740	K	L	120	133
PSM	AGEVFIHKDK	1193	sp|Q15233-2|NONO_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=1514	11.704	2	1142.6084	1142.6084	K	G	11	21
PSM	AHQKELAAQLNEEAK	1194	sp|Q9Y5B9|SP16H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2450	17.212	3	1678.8638	1678.8638	R	R	476	491
PSM	AIKELGDHVTNLR	1195	sp|P02794|FRIH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=4142	27.773	2	1464.8049	1464.8049	K	K	145	158
PSM	AIMTYVSSFYHAFSGAQKAETAANR	1196	sp|P12814-2|ACTN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11365	73.986	3	2720.3017	2720.3017	K	I	237	262
PSM	ALEHFTDLYDIKR	1197	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6981	45.175	3	1619.8308	1619.8308	R	A	626	639
PSM	ALERLEGVEGVAHIIDPK	1198	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8485	54.716	2	1945.0633	1945.0633	K	A	2240	2258
PSM	DLEGLSQRHEEK	1199	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2183	15.663	2	1439.7005	1439.7005	K	V	1393	1405
PSM	ELFSPLHALNFGIGGDTTR	1200	sp|P68402-3|PA1B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11373	74.042	3	2044.0378	2044.0378	R	H	61	80
PSM	EVGEHLVSIKK	1201	sp|O75369-6|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=2735	18.872	2	1249.7433	1249.7433	R	N	1946	1957
PSM	FFEHFIEGGR	1202	sp|Q96FW1|OTUB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7125	46.067	2	1237.588	1237.5880	K	T	189	199
PSM	FHMDSETHDPIDLQTK	1203	sp|Q9Y2L1-2|RRP44_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	16-UNIMOD:188	ms_run[2]:scan=5649	36.865	3	1918.8827	1918.8827	R	E	609	625
PSM	FHVEEEGKGK	1204	sp|P00558-2|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	8-UNIMOD:188,10-UNIMOD:188	ms_run[2]:scan=1065	9.1308	2	1170.6072	1170.6072	R	D	96	106
PSM	FNNWGGSLSLGHPFGATGCR	1205	sp|P55084-2|ECHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	19-UNIMOD:4,20-UNIMOD:267	ms_run[2]:scan=8978	57.936	3	2143.9886	2143.9886	K	L	395	415
PSM	GEHPGLSIGDVAKK	1206	sp|P09429|HMGB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=3781	25.568	3	1406.7518	1406.7518	K	L	115	129
PSM	GHYTEGAELVDSVLDVVRK	1207	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	18-UNIMOD:267,19-UNIMOD:188	ms_run[2]:scan=11178	72.634	2	2102.0979	2098.1097	K	E	104	123
PSM	GPSPRPPATAYDAPASAFGSSLLGSGGSAFAPPLR	1208	sp|Q8WUF5|IASPP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	5-UNIMOD:267,35-UNIMOD:267	ms_run[2]:scan=11022	71.526	3	3346.6849	3346.6849	R	A	201	236
PSM	GQHLSDAFAQVNPLKK	1209	sp|P30711|GSTT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6725	43.558	2	1751.9319	1751.9319	K	V	38	54
PSM	GVDEVTIVNILTNR	1210	sp|P07355-2|ANXA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	14-UNIMOD:267	ms_run[2]:scan=11455	74.669	2	1551.8496	1551.8496	K	S	68	82
PSM	GVLKVFLENVIR	1211	sp|P62805|H4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11331	73.743	3	1385.8395	1385.8395	R	D	57	69
PSM	HAVGNNEFGTVDHER	1212	sp|Q9P0J1|PDP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	15-UNIMOD:267	ms_run[2]:scan=2374	16.758	3	1690.7687	1690.7687	R	L	485	500
PSM	HCLLTCEECKIK	1213	sp|Q56VL3|OCAD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:4,6-UNIMOD:4,9-UNIMOD:4,10-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=3496	23.77	3	1601.7767	1601.7767	R	H	129	141
PSM	HDKPVNAESQNSVGVFTR	1214	sp|Q9NWM0-2|SMOX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=3864	26.085	2	1983.9763	1983.9763	R	E	156	174
PSM	HDVKFPLDSTGSELK	1215	sp|O14562|UBFD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	4-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=5706	37.222	3	1683.8871	1683.8871	K	Q	97	112
PSM	HGLIPNLLGEGIYAR	1216	sp|P35573-2|GDE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10142	65.579	2	1621.894	1621.8940	R	Y	1116	1131
PSM	HIPGAAFFDIDQCSDR	1217	sp|P25325|THTM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	13-UNIMOD:4	ms_run[2]:scan=8619	55.587	3	1847.8261	1847.8261	R	T	53	69
PSM	HKEQNNDSQLK	1218	sp|O95347-2|SMC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=536	6.1449	2	1351.6883	1351.6883	K	I	899	910
PSM	HNSILQLDPSIPGVFR	1219	sp|Q9Y487|VPP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	16-UNIMOD:267	ms_run[2]:scan=10355	66.994	3	1801.9714	1801.9714	R	G	511	527
PSM	HSDELTSLLGYFPNKK	1220	sp|Q92878-3|RAD50_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9444	60.996	3	1847.9418	1847.9418	R	Q	420	436
PSM	HVHPTTAPDVTSSLPEEK	1221	sp|Q6WCQ1-3|MPRIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	18-UNIMOD:188	ms_run[2]:scan=4061	27.279	3	1949.979	1949.9790	K	N	443	461
PSM	IAQPGDHVSVTGIFLPILR	1222	sp|P33993-2|MCM7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11844	77.567	2	2032.1469	2032.1469	R	T	264	283
PSM	IKSDHPGISITDLSK	1223	sp|Q08945|SSRP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5127	33.687	3	1609.8675	1609.8675	K	K	565	580
PSM	ILRPALLPGEEIVCEGLR	1224	sp|Q86WG5-3|MTMRD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	14-UNIMOD:4	ms_run[2]:scan=10158	65.685	3	2034.1296	2034.1296	K	V	873	891
PSM	IQKEALGGQALYPHVLVK	1225	sp|Q9BUJ2-3|HNRL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	3-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=6599	42.766	3	1975.1657	1975.1657	R	N	244	262
PSM	ISSIQSIVPALEIANAHR	1226	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	18-UNIMOD:267	ms_run[2]:scan=10283	66.503	2	1928.0719	1928.0719	K	K	251	269
PSM	KDSEDNPQTLLFSATCPHWVFNVAK	1227	sp|Q9NR30-2|DDX21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	16-UNIMOD:4	ms_run[2]:scan=11301	73.537	3	2903.3912	2903.3912	K	K	295	320
PSM	KEGGLGPLNIPLLADVTR	1228	sp|P32119|PRDX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11860	77.68	2	1862.0625	1862.0625	R	R	92	110
PSM	KISSDLDGHPVPK	1229	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=2473	17.344	3	1403.7811	1403.7811	R	Q	102	115
PSM	KLAVNMVPFPR	1230	sp|P04350|TBB4A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7457	48.124	2	1270.722	1270.7220	R	L	252	263
PSM	KLFIGGLSFETTDESLR	1231	sp|P09651-3|ROA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9963	64.403	3	1911.9942	1911.9942	R	S	15	32
PSM	KSFLHEQEENVVK	1232	sp|Q13576|IQGA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=3580	24.329	2	1597.8503	1597.8503	R	I	684	697
PSM	KVSQPIEGHAASFAQFK	1233	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5189	34.057	3	1843.9581	1843.9581	R	M	189	206
PSM	KVTHAVVTVPAYFNDAQR	1234	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5956	38.755	3	2015.0589	2015.0589	K	Q	164	182
PSM	LALQLHPDRNPDDPQAQEK	1235	sp|Q9UBS4|DJB11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=4553	30.226	3	2184.0923	2184.0923	K	F	48	67
PSM	LDKAQIHDLVLVGGSTR	1236	sp|P0DMV8-2|HS71A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	3-UNIMOD:188,17-UNIMOD:267	ms_run[2]:scan=6580	42.654	2	1837.0392	1833.0511	K	I	271	288
PSM	LEHAYKPVQFEGSLGK	1237	sp|Q86TB9-2|PATL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5106	33.556	3	1801.9363	1801.9363	K	L	326	342
PSM	LHNMIVDLDNVVKK	1238	sp|Q16891-3|MIC60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7541	48.652	2	1636.8971	1636.8971	K	V	299	313
PSM	LHYCVSCAIHSK	1239	sp|Q5JNZ5|RS26L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	4-UNIMOD:4,7-UNIMOD:4,12-UNIMOD:188	ms_run[2]:scan=3272	22.143	2	1479.7058	1479.7058	K	V	71	83
PSM	LKQDTYGDIYNFPIHAFDK	1240	sp|Q9BXY0|MAK16_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9582	61.903	3	2284.1164	2284.1164	R	A	170	189
PSM	LKVPPAINQFTQALDR	1241	sp|P62424|RL7A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10271	66.425	3	1810.0101	1810.0101	R	Q	74	90
PSM	LPNNHIGISFIPR	1242	sp|O75369-6|FLNB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	13-UNIMOD:267	ms_run[2]:scan=7727	49.815	3	1486.8284	1486.8284	R	E	1933	1946
PSM	LRGWEAFLNAPEANR	1243	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9108	58.767	3	1742.8853	1742.8853	R	G	366	381
PSM	LSPKHPESNTAGMDIFAK	1244	sp|Q9Y696|CLIC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	4-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=5495	35.925	3	1954.0021	1954.0021	K	F	107	125
PSM	LTPLILKPFGNSISR	1245	sp|Q14739|LBR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9386	60.598	2	1654.977	1654.9770	K	Y	117	132
PSM	LVKGHAYSVTGAK	1246	sp|P07384|CAN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=1377	10.918	2	1329.7405	1329.7405	K	Q	268	281
PSM	MITEHTSNDPYCFVEFYEHR	1247	sp|Q01085|TIAR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:35,12-UNIMOD:4,20-UNIMOD:267	ms_run[2]:scan=8769	56.579	3	2600.0976	2600.0976	K	D	40	60
PSM	MLNIHPSLLPSFK	1248	sp|P22102|PUR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:35	ms_run[2]:scan=8874	57.273	2	1511.817	1511.8170	K	G	911	924
PSM	NDSHVLIELHK	1249	sp|Q15642-5|CIP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:188	ms_run[2]:scan=4105	27.556	2	1309.7086	1309.7086	K	S	263	274
PSM	NHEGDEDDSHVR	1250	sp|Q9UNE7-2|CHIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:267	ms_run[2]:scan=531	6.1133	2	1418.5686	1418.5686	R	A	111	123
PSM	NKITLQDVVSHSK	1251	sp|P46940|IQGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=4695	31.059	3	1479.8448	1479.8448	K	K	923	936
PSM	NLVEQHIQDIVVHYTFNK	1252	sp|P04843|RPN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	18-UNIMOD:188	ms_run[2]:scan=10658	69.07	3	2202.1529	2202.1529	K	V	415	433
PSM	NNRQPYAVSELAGHQTSAESWGTGR	1253	sp|P36578|RL4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	3-UNIMOD:267,25-UNIMOD:267	ms_run[2]:scan=6006	39.073	4	2735.2915	2735.2915	K	A	47	72
PSM	QIDSVNHINLFFTELKEEDVTK	1254	sp|O95163|ELP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10763	69.775	3	2618.3228	2618.3228	K	T	773	795
PSM	RSIQFVDWCPTGFK	1255	sp|P68366-2|TBA4A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	9-UNIMOD:4	ms_run[2]:scan=9204	59.377	2	1739.8454	1739.8454	K	V	324	338
PSM	SGTVIHSDRFDTYR	1256	sp|Q8WUJ3-2|CEMIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=3914	26.392	2	1652.7907	1652.7907	K	S	198	212
PSM	SHFEQWGTLTDCVVMRDPNTK	1257	sp|P09651-3|ROA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:4,16-UNIMOD:267,21-UNIMOD:188	ms_run[2]:scan=8208	52.963	3	2536.181	2532.1928	R	R	32	53
PSM	SKGLAPDLPEDLYHLIK	1258	sp|P62277|RS13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10687	69.267	3	1908.0357	1908.0357	K	K	77	94
PSM	SLETEHKALTSEIALLQSR	1259	sp|P04843|RPN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	7-UNIMOD:188,19-UNIMOD:267	ms_run[2]:scan=8732	56.322	2	2141.1663	2137.1782	K	L	518	537
PSM	SLQEEHVAVAQLREEAER	1260	sp|Q15149-3|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	13-UNIMOD:267,18-UNIMOD:267	ms_run[2]:scan=5768	37.611	3	2113.0667	2113.0667	R	R	1618	1636
PSM	SPAPPLLHVAALGQK	1261	sp|Q8N163-2|CCAR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7248	46.809	3	1497.8667	1497.8667	K	Q	124	139
PSM	SPAPPLLHVAALGQK	1262	sp|Q8N163-2|CCAR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	15-UNIMOD:188	ms_run[2]:scan=7253	46.842	3	1503.8869	1503.8869	K	Q	124	139
PSM	SQLGAHHTTPVGDGAAGTR	1263	sp|Q5BJD5-3|TM41B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=1505	11.65	3	1831.8925	1831.8925	R	G	10	29
PSM	SVKQDHPLPGK	1264	sp|Q5XXA6|ANO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	3-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=930	8.3763	2	1216.6967	1216.6967	R	G	94	105
PSM	THIDTVINALKTER	1265	sp|O95782-2|AP2A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6706	43.436	3	1609.8788	1609.8788	K	D	368	382
PSM	TKDLPVTEAVFSALVTGHAR	1266	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10791	69.965	3	2111.1375	2111.1375	K	A	225	245
PSM	TKIYHPNIDEK	1267	sp|P68036-2|UB2L3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2336	16.548	2	1356.7038	1356.7038	K	G	40	51
PSM	TMLDFPQHVSSDKEVR	1268	sp|Q9BYT8|NEUL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5635	36.779	2	1887.9149	1887.9149	R	A	104	120
PSM	TREGNDLYHEMIESGVINLK	1269	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:267,20-UNIMOD:188	ms_run[2]:scan=9730	62.866	3	2333.1656	2329.1775	R	D	240	260
PSM	TREGNDLYHEMIESGVINLK	1270	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:267,20-UNIMOD:188	ms_run[2]:scan=9731	62.871	2	2333.1656	2329.1775	R	D	240	260
PSM	TTGIVMDSGDGVTHTVPIYEGYALPHAILR	1271	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	30-UNIMOD:267	ms_run[2]:scan=10267	66.401	3	3192.6153	3192.6153	R	L	148	178
PSM	TTHYTPLACGSNPLKR	1272	sp|O60832-2|DKC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	9-UNIMOD:4	ms_run[2]:scan=4382	29.221	3	1814.9098	1814.9098	R	E	66	82
PSM	TVFAEHISDECKR	1273	sp|P39023|RL3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:4	ms_run[2]:scan=3243	21.956	2	1590.746	1590.7460	K	R	104	117
PSM	VAVNDAHLLQYNHR	1274	sp|P17931|LEG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=4643	30.742	2	1648.8434	1648.8434	K	V	211	225
PSM	VMHETVKDLAPK	1275	sp|P52789|HXK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2935	20.11	2	1366.7279	1366.7279	K	C	874	886
PSM	VNVGAGSHPNKVK	1276	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=839	7.863	2	1317.7556	1317.7556	R	V	761	774
PSM	VREEVPLELVEAHVK	1277	sp|Q92922|SMRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7667	49.451	3	1745.9676	1745.9676	R	K	725	740
PSM	VTAIHIDPATHR	1278	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2909	19.955	2	1329.7153	1329.7153	R	Q	1052	1064
PSM	VTQDELKEVFEDAAEIR	1279	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10988	71.298	3	1990.9848	1990.9848	K	L	404	421
PSM	YAEIVHLTLPDGTKR	1280	sp|P21281|VATB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	14-UNIMOD:188,15-UNIMOD:267	ms_run[2]:scan=6947	44.96	2	1727.9541	1723.9660	R	S	68	83
PSM	YHQIGSGKCEIK	1281	sp|O14979-3|HNRDL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	9-UNIMOD:4	ms_run[2]:scan=1437	11.262	3	1418.6976	1418.6976	R	V	176	188
PSM	YIKEYVTCHTCR	1282	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	8-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=2656	18.431	3	1628.7439	1628.7439	R	S	274	286
PSM	YNRDFESHITSYK	1283	sp|Q99613-2|EIF3C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=4296	28.701	2	1658.7689	1658.7689	K	Q	138	151
PSM	HGEKVEECQR	1284	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	4-UNIMOD:188,8-UNIMOD:4,10-UNIMOD:267	ms_run[1]:scan=515	6.02159	2	1286.596989	1286.600832	R	F	1398	1408
PSM	KHGLEVIYMIEPIDEYCVQQLK	1285	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:188,9-UNIMOD:35,17-UNIMOD:4,22-UNIMOD:188	ms_run[1]:scan=9680	62.53581833333333	2	2732.393415	2732.395619	R	E	513	535
PSM	TEWLDGKHVVFGK	1286	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	7-UNIMOD:188,13-UNIMOD:188	ms_run[1]:scan=6173	40.087853333333335	2	1526.827717	1526.828422	K	V	119	132
PSM	IISKIENHEGVR	1287	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=2222	15.886751666666667	2	1394.756256	1393.767763	K	R	267	279
PSM	HKLDVTSVEDYK	1288	sp|P48643|TCPE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	2-UNIMOD:188,12-UNIMOD:188	ms_run[1]:scan=4371	29.153606666666665	3	1444.766236	1444.760067	K	A	264	276
PSM	QQHVIETLIGKK	1289	sp|P48643|TCPE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28	ms_run[1]:scan=7420	47.90316666666667	2	1375.7835	1375.7818	K	Q	503	515
PSM	GRASSHSSQTQGGGSVTK	1290	sp|P02545|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=450	5.62812	3	1730.823906	1730.829588	R	K	400	418
PSM	VLKQVHPDTGISSK	1291	sp|Q96A08|H2B1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:188,14-UNIMOD:188	ms_run[1]:scan=1929	14.088533333333334	3	1519.874897	1519.876100	K	A	46	60
PSM	FASSEKHSYGK	1292	sp|P49589|SYCC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	6-UNIMOD:188,11-UNIMOD:188	ms_run[1]:scan=764	7.431095	2	1251.623968	1251.628659	K	L	275	286
PSM	AIRDGVIEASINHEK	1293	sp|O43242|PSMD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=4228	28.292113333333337	3	1652.873701	1650.868933	K	G	441	456
PSM	QLLHNFPPDQLTSSGAPFWSGPKR	1294	sp|P22314|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28,23-UNIMOD:188,24-UNIMOD:267	ms_run[1]:scan=10910	70.77637333333332	3	2678.3472	2678.3571	R	C	724	748
PSM	KAAGHPGDPESQQR	1295	sp|Q9Y490|TLN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:188,14-UNIMOD:267	ms_run[1]:scan=539	6.161381666666666	2	1492.731340	1492.735351	K	L	1171	1185
PSM	QSVENDIHGLRK	1296	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28	ms_run[1]:scan=2756	18.990368333333333	2	1377.6985	1377.6996	R	V	176	188
PSM	KPAAGLSAAPVPTAPAAGAPLMDFGNDFVPPAPR	1297	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=11232	73.03852666666667	3	3271.657173	3270.685954	R	G	58	92
PSM	NTKHEISEMNR	1298	sp|P13647|K2C5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:188,9-UNIMOD:35,11-UNIMOD:267	ms_run[1]:scan=601	6.508581666666666	2	1389.658961	1389.664160	R	M	381	392
PSM	HLNEIDLFHCIDPNDSK	1299	sp|Q15185|TEBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	10-UNIMOD:4	ms_run[1]:scan=8818	56.91062666666667	2	2066.938606	2065.952740	K	H	49	66
PSM	AHQITDESLESTRR	1300	sp|O00161|SNP23_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	13-UNIMOD:267,14-UNIMOD:267	ms_run[1]:scan=2330	16.510456666666666	2	1662.830448	1661.823599	R	I	13	27
PSM	RFEEALQTIFNR	1301	sp|O94832|MYO1D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:267,12-UNIMOD:267	ms_run[1]:scan=2968	20.307975	2	1542.824371	1542.805764	R	W	771	783
PSM	MGPASCGGRSLHLPQLR	1302	sp|A2RUQ5|CQ102_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	6-UNIMOD:4,9-UNIMOD:267	ms_run[1]:scan=5059	33.27565666666666	2	1846.951127	1845.932960	R	F	16	33
PSM	ADELNNKHTIFGK	1303	sp|Q6UX04-2|CWC27_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=3727	25.241	2	1485.7576	1485.7576	R	V	120	133
PSM	AHQTGIHATEELKEFFAK	1304	sp|Q6IBS0|TWF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:1,13-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=8869	57.243	4	2110.0886	2110.0886	M	A	2	20
PSM	AHSIQIMKVEEIAASK	1305	sp|Q02543|RL18A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	7-UNIMOD:35,8-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=5330	34.912	3	1781.9748	1781.9748	R	C	121	137
PSM	AMDDGVKELLTVGQEHWK	1306	sp|Q9Y5X1|SNX9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	7-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=10237	66.202	3	2067.0498	2067.0498	K	R	408	426
PSM	ARFEELNADLFR	1307	sp|P11142-2|HSP7C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:267,12-UNIMOD:267	ms_run[2]:scan=8436	54.406	2	1499.7636	1499.7636	R	G	300	312
PSM	ASIHEAWTDGKEAMLR	1308	sp|P12814-2|ACTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:188,16-UNIMOD:267	ms_run[2]:scan=6095	39.589	2	1829.9065	1825.9184	K	Q	403	419
PSM	ASQKPQPNFPSPEYMIFDHEFTK	1309	sp|O60763|USO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10060	65.042	3	2737.2846	2737.2846	R	L	593	616
PSM	AVGHPFVIQLGR	1310	sp|O14980|XPO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7063	45.678	2	1292.7353	1292.7353	K	I	701	713
PSM	CDSADLRHDIDR	1311	sp|Q9NYF8-3|BCLF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:4,7-UNIMOD:267,12-UNIMOD:267	ms_run[2]:scan=2917	20.001	2	1491.6639	1491.6639	R	R	686	698
PSM	DCDHADEQKCYSCGEFGHIQK	1312	sp|P62633-7|CNBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:4,10-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=3837	25.915	3	2583.0213	2583.0213	R	D	93	114
PSM	DGGNPFAEPSELDNPFQDPAVIQHRPSR	1313	sp|O14828|SCAM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9476	61.207	3	3089.4591	3089.4591	R	Q	6	34
PSM	DHPALNYNIVSGPPSHK	1314	sp|O15269-2|SPTC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5345	35.006	3	1844.9169	1844.9169	K	T	76	93
PSM	DLLHPSPEEEKR	1315	sp|P42677|RS27_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=3076	20.942	2	1448.726	1448.7260	K	K	6	18
PSM	DNIQGITKPAIR	1316	sp|P62805|H4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4385	29.239	2	1324.7463	1324.7463	R	R	25	37
PSM	EGAKHFSGLEEAVYR	1317	sp|P50990|TCPQ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5072	33.361	3	1691.8267	1691.8267	K	N	17	32
PSM	ELCQQIHAECKR	1318	sp|Q86XP3-2|DDX42_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=1842	13.594	2	1570.7344	1570.7344	R	F	218	230
PSM	ESGSLSPEHGPVVVHCSAGIGR	1319	sp|P18031|PTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	16-UNIMOD:4,22-UNIMOD:267	ms_run[2]:scan=4579	30.372	3	2241.0836	2241.0836	R	S	200	222
PSM	EVDIGIPDATGRLEILQIHTK	1320	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:267,21-UNIMOD:188	ms_run[2]:scan=10131	65.508	2	2333.2926	2329.3044	R	N	366	387
PSM	FFHPEEWADLFQAAGAK	1321	sp|P04066|FUCO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	17-UNIMOD:188	ms_run[2]:scan=11682	76.339	3	1968.9466	1968.9466	R	Y	114	131
PSM	FFTVKLPVALDPGAK	1322	sp|P04843|RPN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	5-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=10421	67.459	2	1613.9584	1613.9584	R	I	112	127
PSM	FKIPGSPPESMGR	1323	sp|P50395-2|GDIB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5766	37.601	2	1401.7075	1401.7075	R	G	56	69
PSM	FLQEHGSDSFLAEHK	1324	sp|Q00688|FKBP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5030	33.094	3	1743.8216	1743.8216	K	L	28	43
PSM	FLREWVESMGGK	1325	sp|Q8NFI4|F10A5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:267,12-UNIMOD:188	ms_run[2]:scan=8229	53.092	2	1453.7359	1449.7477	R	V	30	42
PSM	FRPVPGSALQIFELCAQEQR	1326	sp|Q8N6R0-2|EFNMT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	15-UNIMOD:4	ms_run[2]:scan=10769	69.817	3	2345.195	2345.1950	K	K	126	146
PSM	FVIHCNSPVWGADKCEELLEK	1327	sp|O75367-2|H2AY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	5-UNIMOD:4,14-UNIMOD:188,15-UNIMOD:4,21-UNIMOD:188	ms_run[2]:scan=7869	50.698	4	2542.2387	2542.2387	K	T	269	290
PSM	GAGTNEDALIEILTTR	1328	sp|P12429|ANXA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11706	76.518	2	1672.8632	1672.8632	K	T	105	121
PSM	GFGFVTFDDHDPVDKIVLQK	1329	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	15-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=10441	67.591	3	2288.188	2288.1880	R	Y	142	162
PSM	GHAGNPRDPTDEGIFISK	1330	sp|Q14160-2|SCRIB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4603	30.505	3	1909.9282	1909.9282	R	V	1040	1058
PSM	GHYTEGAELVDSVLDVVR	1331	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	18-UNIMOD:267	ms_run[2]:scan=11896	77.967	3	1967.9828	1967.9828	K	K	104	122
PSM	GHYTIGKEIIDPVLDR	1332	sp|P68366-2|TBA4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7360	47.528	3	1824.9734	1824.9734	R	I	91	107
PSM	GIPVVEHKVEK	1333	sp|P11388|TOP2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	8-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=2204	15.784	2	1245.7484	1245.7484	K	M	124	135
PSM	GKNVVHQLSVTLEDLYNGATR	1334	sp|P31689-2|DNJA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11417	74.358	3	2313.2077	2313.2077	R	K	104	125
PSM	GLFIIDDKGILR	1335	sp|Q06830|PRDX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9844	63.614	2	1358.7922	1358.7922	R	Q	129	141
PSM	GVIVDKDFSHPQMPK	1336	sp|P48643-2|TCPE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5394	35.306	2	1696.8607	1696.8607	K	K	134	149
PSM	HCLLTCEECKIK	1337	sp|Q56VL3|OCAD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:4,6-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=3489	23.72	3	1589.7364	1589.7364	R	H	129	141
PSM	HDGSEPCVDVLFGDGHR	1338	sp|Q96EL3|RM53_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	7-UNIMOD:4	ms_run[2]:scan=6899	44.662	3	1895.8221	1895.8221	R	L	57	74
PSM	HEKEDGAISTIVLR	1339	sp|P50990|TCPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5136	33.742	3	1566.8366	1566.8366	K	G	365	379
PSM	HGSLGFLPR	1340	sp|P39023|RL3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5421	35.464	2	982.53485	982.5348	R	K	11	20
PSM	HKSDVEIPATVTAFSFEDDTVPLSPLK	1341	sp|Q9UEY8-2|ADDG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11014	71.471	3	2942.4913	2942.4913	R	Y	400	427
PSM	HLCQQLQAEQAAAEKR	1342	sp|Q14980-4|NUMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:4,15-UNIMOD:188,16-UNIMOD:267	ms_run[2]:scan=3586	24.365	2	1895.9607	1891.9725	K	H	1365	1381
PSM	HLSPYATLTVGDSSHK	1343	sp|Q9BSJ8|ESYT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4626	30.644	2	1711.8529	1711.8529	K	T	818	834
PSM	HSFTEDHYVEFSK	1344	sp|Q9Y4B6-3|DCAF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	13-UNIMOD:188	ms_run[2]:scan=4887	32.233	3	1630.7359	1630.7359	K	H	725	738
PSM	HSQAVEELAEQLEQTKR	1345	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	16-UNIMOD:188,17-UNIMOD:267	ms_run[2]:scan=7212	46.594	3	2011.0305	2007.0424	K	V	1194	1211
PSM	HVDLLEVAQETDGFSGSDLKEMCR	1346	sp|Q8NBU5|ATAD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	20-UNIMOD:188,23-UNIMOD:4,24-UNIMOD:267	ms_run[2]:scan=9838	63.574	3	2751.2815	2747.2933	R	D	281	305
PSM	HVINFDLPSDIEEYVHR	1347	sp|O00571-2|DDX3X_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10662	69.094	3	2082.0171	2082.0171	K	I	496	513
PSM	HVNTNPLCDLTPIFKDYEK	1348	sp|Q9UKX7-2|NUP50_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	8-UNIMOD:4	ms_run[2]:scan=10318	66.72	3	2303.1256	2303.1256	K	Y	146	165
PSM	HVVLGAIENKVESK	1349	sp|P41227-2|NAA10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=4597	30.475	3	1533.8917	1533.8917	R	G	155	169
PSM	IDRLTDEGAVHVNDR	1350	sp|O95487-2|SC24B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=3631	24.642	2	1708.8493	1708.8493	R	I	1089	1104
PSM	IDTHNIIVNQLVFPDPEKPCK	1351	sp|O43681|ASNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	20-UNIMOD:4	ms_run[2]:scan=9174	59.187	3	2476.2784	2476.2784	K	M	270	291
PSM	IGEEQSPEDAEDGPPELLFIHGGHTAK	1352	sp|Q09028-4|RBBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	27-UNIMOD:188	ms_run[2]:scan=8137	52.496	2	2878.3717	2878.3717	K	I	315	342
PSM	IHFPLATYAPVISAEK	1353	sp|P68366-2|TBA4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	16-UNIMOD:188	ms_run[2]:scan=9693	62.625	3	1761.9761	1761.9761	R	A	250	266
PSM	IIHEDGYSEEECRQYR	1354	sp|P04899-6|GNAI2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:4	ms_run[2]:scan=3071	20.91	2	2082.9065	2082.9065	K	A	3	19
PSM	IKSEHPGLSIGDTAK	1355	sp|P26583|HMGB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2737	18.881	3	1551.8257	1551.8257	K	K	113	128
PSM	IKSEHPGLSIGDTAK	1356	sp|P26583|HMGB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=2739	18.891	3	1563.8659	1563.8659	K	K	113	128
PSM	ILDWHVANTDKK	1357	sp|P37837|TALDO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4624	30.634	3	1438.7569	1438.7569	R	S	193	205
PSM	ISELGSQLSDEAVEDGLFHEFKR	1358	sp|Q96T37-4|RBM15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10484	67.874	4	2605.266	2605.2660	K	F	130	153
PSM	IVLHPDTEHSK	1359	sp|Q9NW13-2|RBM28_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:188	ms_run[2]:scan=1444	11.303	2	1280.682	1280.6820	R	G	225	236
PSM	KDAHSNLLAK	1360	sp|O75323|NIPS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=1190	9.8615	2	1095.6037	1095.6037	R	K	58	68
PSM	KFEQGFITDPVVLSPSHTVGDVLEAK	1361	sp|P20839|IMDH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10205	65.994	4	2812.4647	2812.4647	K	M	109	135
PSM	KHGLEVIYMIEPIDEYCVQQLK	1362	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:35,17-UNIMOD:4	ms_run[2]:scan=9687	62.582	3	2720.3554	2720.3554	R	E	513	535
PSM	KICSHSAPEQQAR	1363	sp|O75683|SURF6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:4	ms_run[2]:scan=666	6.8661	2	1510.7311	1510.7311	K	T	17	30
PSM	KQELEEILHDLESR	1364	sp|P35580|MYH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10346	66.929	3	1737.8897	1737.8897	K	V	917	931
PSM	KVMSQNFTNCHTK	1365	sp|Q13283-2|G3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:188,10-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=1563	12.005	3	1605.7794	1605.7794	R	I	64	77
PSM	KVSQPIEGHAASFAQFK	1366	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=5183	34.019	3	1855.9983	1855.9983	R	M	189	206
PSM	LCFLDKVEPHATIAEIK	1367	sp|Q9NZ01|TECR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:4,6-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=8241	53.172	3	1995.0902	1995.0902	K	N	17	34
PSM	LGFHLPLEVAYQR	1368	sp|Q15149-3|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	13-UNIMOD:267	ms_run[2]:scan=9875	63.815	3	1551.8437	1551.8437	R	G	3837	3850
PSM	LGHAEQKDEMVPR	1369	sp|Q9P258|RCC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=1725	12.926	3	1508.7406	1508.7406	R	L	362	375
PSM	LHGLDEEAEQKLFSEK	1370	sp|P33991|MCM4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=6737	43.632	3	1883.9668	1883.9668	R	R	429	445
PSM	LHQAKEQYEALQEETR	1371	sp|Q9UPN3-4|MACF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	5-UNIMOD:188,16-UNIMOD:267	ms_run[2]:scan=3544	24.096	2	1987.9934	1984.0053	K	V	1636	1652
PSM	LHTLEEEKEELAQYQK	1372	sp|Q9UQE7|SMC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	8-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=5751	37.505	3	1999.0301	1999.0301	R	W	200	216
PSM	LLETTDRPDGHQNNLR	1373	sp|Q14974-2|IMB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	7-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=2663	18.474	2	1897.9509	1897.9509	K	S	365	381
PSM	LLETTDRPDGHQNNLR	1374	sp|Q14974-2|IMB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2664	18.478	3	1877.9344	1877.9344	K	S	365	381
PSM	LLETTDRPDGHQNNLR	1375	sp|Q14974-2|IMB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2665	18.483	2	1877.9344	1877.9344	K	S	365	381
PSM	LNDGHFMPVLGFGTYAPPEVPR	1376	sp|P42330|AK1C3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10991	71.322	3	2413.1889	2413.1889	K	S	10	32
PSM	LPKDDVHAK	1377	sp|P78527-2|PRKDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:188,9-UNIMOD:188	ms_run[2]:scan=806	7.6746	2	1033.5959	1033.5959	R	E	1884	1893
PSM	LPKDDVHAK	1378	sp|P78527-2|PRKDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:188,9-UNIMOD:188	ms_run[2]:scan=812	7.7112	2	1033.5959	1033.5959	R	E	1884	1893
PSM	LTGIKHELQANCYEEVK	1379	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	5-UNIMOD:188,12-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=4682	30.975	2	2043.0498	2043.0498	K	D	128	145
PSM	LVNNGEKLEFLHK	1380	sp|Q15393|SF3B3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	7-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=5084	33.427	2	1551.8812	1551.8812	K	T	930	943
PSM	MGAGLGHGMDR	1381	sp|P52272-2|HNRPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:35,11-UNIMOD:267	ms_run[2]:scan=1494	11.581	2	1126.4887	1126.4887	R	V	380	391
PSM	MGRGPGPLQER	1382	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:35,3-UNIMOD:267,11-UNIMOD:267	ms_run[2]:scan=1562	11.999	2	1232.6199	1232.6199	R	S	253	264
PSM	MGRGPGPLQER	1383	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:267,11-UNIMOD:267	ms_run[2]:scan=2167	15.576	2	1216.625	1216.6250	R	S	253	264
PSM	MGRGPGPLQER	1384	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2171	15.594	2	1196.6084	1196.6084	R	S	253	264
PSM	MKQVEELYHSLLELGEK	1385	sp|Q13813-2|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11073	71.867	3	2045.0503	2045.0503	R	R	1066	1083
PSM	NLLHVTDTGVGMTREELVK	1386	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7201	46.532	3	2111.1045	2111.1045	K	N	143	162
PSM	NNRQPYAVSELAGHQTSAESWGTGR	1387	sp|P36578|RL4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6014	39.124	4	2715.275	2715.2750	K	A	47	72
PSM	NYLNQHIEHVQK	1388	sp|P28715|ERCC5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2944	20.164	2	1521.7688	1521.7688	K	E	241	253
PSM	QEYDESGPSIVHRK	1389	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2367	16.72	2	1643.7903	1643.7903	K	C	360	374
PSM	QKHSQAVEELAEQLEQTK	1390	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7176	46.38	3	2095.0546	2095.0546	R	R	1192	1210
PSM	QSVENDIHGLRK	1391	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2711	18.741	2	1394.7266	1394.7266	R	V	176	188
PSM	RGQTCVVHYTGMLEDGK	1392	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:267,5-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=4977	32.771	2	1965.9372	1961.9490	K	K	19	36
PSM	RMEELHNQEMQK	1393	sp|P23246-2|SFPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:35	ms_run[2]:scan=948	8.4774	2	1587.7134	1587.7134	R	R	548	560
PSM	RVEHNQSYSQAGITETEWTSGSSK	1394	sp|P42167|LAP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4773	31.524	4	2681.2318	2681.2318	R	G	216	240
PSM	RYESHPVCADLQAK	1395	sp|Q9NX63|MIC19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	8-UNIMOD:4	ms_run[2]:scan=2328	16.499	3	1672.7991	1672.7991	K	I	176	190
PSM	SAGLPSHSSVISQHSK	1396	sp|P82909|RT36_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	16-UNIMOD:188	ms_run[2]:scan=2223	15.892	2	1626.8421	1626.8421	R	G	42	58
PSM	SHEAEVLKQLAEK	1397	sp|P16949|STMN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4953	32.629	3	1480.7886	1480.7886	K	R	63	76
PSM	SLSFPILNPALSQPSQPSSPLPGSHGR	1398	sp|Q8ND24-2|RN214_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10379	67.165	2	2770.4402	2770.4402	R	N	328	355
PSM	SQGGVQPIPSQGGKLEIAGTVVGHWAGSR	1399	sp|Q9NZB2|F120A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=8654	55.811	3	2872.4944	2872.4944	K	R	933	962
PSM	STKHWELTAEGEEIAR	1400	sp|Q9Y285-2|SYFA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:188,16-UNIMOD:267	ms_run[2]:scan=5293	34.686	2	1871.9348	1867.9467	R	E	57	73
PSM	SWHDVQVSSAYKK	1401	sp|O43399-6|TPD54_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=3734	25.286	3	1545.7978	1545.7978	R	T	73	86
PSM	TADGIVSHLKK	1402	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2524	17.643	2	1167.6612	1167.6612	R	Q	120	131
PSM	TADGIVSHLKK	1403	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=2526	17.651	2	1179.7014	1179.7014	R	Q	120	131
PSM	TDRYTIHSQLEHLQSK	1404	sp|Q9BWJ5|SF3B5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:1	ms_run[2]:scan=5630	36.751	3	1996.9967	1996.9967	M	Y	2	18
PSM	TGPNLHGLFGR	1405	sp|P99999|CYC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6806	44.068	2	1167.6149	1167.6149	K	K	29	40
PSM	TKGVDEVTIVNILTNR	1406	sp|P07355-2|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10263	66.372	3	1770.984	1770.9840	K	S	66	82
PSM	TPELNLDQFHDKTPYTIMFGPDK	1407	sp|P27824-3|CALX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:188,18-UNIMOD:35,23-UNIMOD:188	ms_run[2]:scan=9414	60.797	4	2734.3351	2734.3351	K	C	63	86
PSM	TREEECHFYAGGQVYPGEASR	1408	sp|Q13162|PRDX4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	6-UNIMOD:4	ms_run[2]:scan=4813	31.774	4	2442.0659	2442.0659	R	V	46	67
PSM	VAEFHTELERLPAK	1409	sp|P48556|PSMD8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5480	35.83	2	1638.873	1638.8730	R	D	205	219
PSM	VAVNDAHLLQYNHR	1410	sp|P17931|LEG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4641	30.732	3	1648.8434	1648.8434	K	V	211	225
PSM	VCEVCSAYLGLHDNDRR	1411	sp|Q9Y383-3|LC7L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:4,5-UNIMOD:4	ms_run[2]:scan=5171	33.95	2	2062.9313	2062.9313	R	L	186	203
PSM	VIHLSNLPHSGYSDSAVLK	1412	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	19-UNIMOD:188	ms_run[2]:scan=6471	41.98	3	2042.0892	2042.0892	R	L	497	516
PSM	VLGKDHPDVAK	1413	sp|Q07866-8|KLC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=1134	9.5327	2	1177.6455	1177.6455	K	Q	330	341
PSM	VLKQVHPDTGISSK	1414	sp|Q99880|H2B1L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=1924	14.056	2	1507.8358	1507.8358	K	A	45	59
PSM	VLSKEFHLNESGDPSSK	1415	sp|Q01105|SET_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	4-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=4260	28.477	2	1884.962	1884.9620	K	S	151	168
PSM	VNMEDLREQTHTR	1416	sp|Q9NVA2|SEP11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	7-UNIMOD:267,13-UNIMOD:267	ms_run[2]:scan=3907	26.349	3	1647.7902	1647.7902	R	H	280	293
PSM	VQKHQAFEAELSANQSR	1417	sp|Q13813-2|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=3121	21.205	3	1941.9657	1941.9657	K	I	611	628
PSM	VSFELFADKVPK	1418	sp|P62937|PPIA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=8775	56.62	2	1390.7899	1390.7899	R	T	20	32
PSM	VTILCDKFSGHPK	1419	sp|A6NDY0-2|EPAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	5-UNIMOD:4,7-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=4398	29.321	2	1512.8161	1512.8161	R	G	176	189
PSM	VTVAGGVHISGLHTESAPR	1420	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	19-UNIMOD:267	ms_run[2]:scan=5103	33.54	3	1897.0045	1897.0045	R	R	1086	1105
PSM	YCCEHLLDHITNNQDFK	1421	sp|P35813-2|PPM1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:4,3-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=6901	44.674	3	2211.9773	2211.9773	K	G	70	87
PSM	YFDGSGGNNHAVEHYR	1422	sp|P45974-2|UBP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2657	18.436	2	1821.7819	1821.7819	R	E	223	239
PSM	YGDFNKEVHK	1423	sp|P26038|MOES_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=1818	13.455	2	1235.5935	1235.5935	K	S	134	144
PSM	YSDFVVHEIGKDGR	1424	sp|Q96PZ0|PUS7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:188,14-UNIMOD:267	ms_run[2]:scan=5100	33.524	2	1636.818	1632.8299	R	I	134	148
PSM	YSHLQPGDHLTDITLK	1425	sp|Q15046|SYK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6024	39.183	4	1836.937	1836.9370	K	V	112	128
PSM	HGEKVEECQR	1426	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:188,8-UNIMOD:4,10-UNIMOD:267	ms_run[1]:scan=520	6.0476383333333334	3	1286.595391	1286.600832	R	F	1398	1408
PSM	QLFHPEQLITGKEDAANNYAR	1427	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=7481	48.275106666666666	3	2415.178861	2414.197872	R	G	85	106
PSM	GFGFVTFDDHD	1428	sp|P22626|ROA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0		ms_run[1]:scan=9598	62.006946666666664	2	1255.5131	1255.5140	R	P	154	165
PSM	YHTINGHNAEVR	1429	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1752	13.081981666666666	2	1410.668642	1409.680010	K	K	174	186
PSM	LSASLLHSHDTETR	1430	sp|Q9HCU5|PREB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	14-UNIMOD:267	ms_run[1]:scan=2995	20.468831666666667	2	1575.791314	1575.788053	R	A	57	71
PSM	YHTINGHNCEVK	1431	sp|P51991|ROA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	9-UNIMOD:4	ms_run[1]:scan=1391	10.998978333333334	2	1471.654707	1470.667397	K	K	188	200
PSM	QLLHNFPPDQLTSSGAPFWSGPKR	1432	sp|P22314|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:28,23-UNIMOD:188,24-UNIMOD:267	ms_run[1]:scan=11437	74.532675	3	2679.3472	2678.3572	R	C	724	748
PSM	ALEATTEHIRQELAVFCSPEPPAK	1433	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	17-UNIMOD:4	ms_run[1]:scan=9701	62.674596666666666	3	2693.365045	2693.348301	R	T	2145	2169
PSM	TGVHHYSGNNIELGTACGK	1434	sp|P62888|RL30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	17-UNIMOD:4	ms_run[1]:scan=3383	22.968011666666666	2	2013.927293	2013.932673	K	Y	69	88
PSM	QSQHDKIDASELSFPFHESILK	1435	sp|P42166|LAP2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:28	ms_run[1]:scan=9910	64.05625666666667	4	2538.2368	2538.2385	K	V	479	501
PSM	QVVNFGPGPAKLPHSVLLEIQK	1436	sp|Q9Y617|SERC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:28	ms_run[1]:scan=10565	68.42789499999999	2	2353.3138	2353.3153	R	E	6	28
PSM	LPGKWPFSLSEQQLDAR	1437	sp|Q96L92|SNX27_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=9690	62.601098333333326	2	1972.025176	1971.021411	R	R	219	236
PSM	NLHIPTMENGPELILR	1438	sp|O15382|BCAT2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=9973	64.467625	3	1846.978007	1845.977104	R	F	356	372
PSM	NTKHEISEMNR	1439	sp|P13647|K2C5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	11-UNIMOD:267	ms_run[1]:scan=1079	9.20712	2	1367.652660	1367.649116	R	M	381	392
PSM	NTKHEISEMNR	1440	sp|P13647|K2C5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:188,11-UNIMOD:267	ms_run[1]:scan=1052	9.058611666666668	2	1373.671502	1373.669245	R	M	381	392
PSM	LGGGSEDAKEIMQHR	1441	sp|P31749|AKT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	9-UNIMOD:188,15-UNIMOD:267	ms_run[1]:scan=3743	25.342551666666665	2	1642.794253	1642.806802	R	F	392	407
PSM	SLSFPILNPALSQPSQPSSPLPGSHGR	1442	sp|Q8ND24|RN214_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	27-UNIMOD:267	ms_run[1]:scan=10367	67.07954333333333	2	2780.448045	2780.448497	R	N	483	510
PSM	QDGPMPKPHSVSLNDTETR	1443	sp|Q9P0L0|VAPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:28	ms_run[1]:scan=5038	33.14488166666666	3	2090.9705	2090.9686	K	K	155	174
PSM	IKGGIHTADTK	1444	sp|O00442|RTCA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=778	7.515941666666667	2	1140.653545	1139.629872	K	T	84	95
PSM	CLAFHDISPQAPTHFLVIPK	1445	sp|P49773|HINT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:385,1-UNIMOD:4,20-UNIMOD:188	ms_run[1]:scan=11479	74.84525333333333	2	2279.1752	2279.1862	R	K	38	58
PSM	CVHCVPLEPFDEDYLNHLEPPVK	1446	sp|Q8TAT6|NPL4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:385,1-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=11351	73.88118333333334	3	2789.2702	2789.2822	K	H	138	161
PSM	LENGELEHIRPK	1447	sp|Q15102|PA1B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=3881	26.187763333333333	2	1434.747854	1433.762677	R	I	84	96
PSM	ENGGYTGCPFPAKLDLQQGQNLLQGLSK	1448	sp|Q9HCE1|MOV10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	8-UNIMOD:4	ms_run[1]:scan=4373	29.164031666666666	3	3032.544830	3032.502570	K	L	940	968
PSM	RLSQYPNENLHSAVTK	1449	sp|A3KMH1|VWA8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:267,16-UNIMOD:188	ms_run[1]:scan=3529	23.99383166666667	2	1871.982131	1871.982458	R	A	668	684
PSM	TPDKMGFDEVFMINLR	1450	sp|Q8NBJ5|GT251_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	5-UNIMOD:35,12-UNIMOD:35	ms_run[1]:scan=6826	44.1912	2	1943.923953	1943.912121	K	R	334	350
PSM	IHLRDYVIEDDVNMAIR	1451	sp|P49736|MCM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	14-UNIMOD:35	ms_run[1]:scan=6470	41.97493166666666	3	2087.085237	2087.046974	R	V	780	797
PSM	NHIENQDECVLNVISHAR	1452	sp|Q9BZE1|RM37_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	9-UNIMOD:4,18-UNIMOD:267	ms_run[1]:scan=7239	46.756861666666666	2	2157.036168	2157.026068	R	L	145	163
PSM	QLFHPEQLITGKEDAANNYAR	1453	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	12-UNIMOD:188,21-UNIMOD:267	ms_run[1]:scan=7306	47.171165	3	2431.210304	2430.226270	R	G	85	106
PSM	ASQKPQPNFPSPEYMIFDHEFTK	1454	sp|O60763|USO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=10116	65.40733666666667	2	2737.290375	2737.284638	R	L	593	616