MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000208 -- new
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220618\20220618002634800212^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\111222_HL16.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220618\20220618002634800212^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\111222_HL16.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Acetyl (Protein N-term),Label:13C(6) (K),Label:13C(6)15N(4) (R),Oxidation (M)
MTD	software[1]-setting	maxMissedCleavages=1
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=40
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Label:13C(6) (K),Label:13C(6)15N(4) (R),Acetyl (Protein N-term)
MTD	software[2]-setting	TOL(-)=20
MTD	software[2]-setting	TOL(+)=20
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=1000
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=1
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Acetyl (Protein N-term),Label:13C(6) (K),Label:13C(6)15N(4) (R),Oxidation (M)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=1
MTD	software[3]-setting	peptide_mass_tolerance=20
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:1, Acetyl,]
MTD	variable_mod[1]-site	N-term
MTD	variable_mod[1]-position	Protein N-term
MTD	variable_mod[2]	[UNIMOD, UNIMOD:188, Label:13C(6),]
MTD	variable_mod[2]-site	K
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:267, Label:13C(6)15N(4),]
MTD	variable_mod[3]-site	R
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[4]-site	M
MTD	variable_mod[4]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|Q96DI7|SNR40_HUMAN	U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens OX=9606 GN=SNRNP40 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	51.0	null	20-UNIMOD:28,21-UNIMOD:267,51-UNIMOD:267	0.09	51.0	2	1	0
PRT	sp|Q92621|NU205_HUMAN	Nuclear pore complex protein Nup205 OS=Homo sapiens OX=9606 GN=NUP205 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	49.0	null	1150-UNIMOD:188,1164-UNIMOD:267	0.01	49.0	3	1	0
PRT	sp|O75369-7|FLNB_HUMAN	Isoform 7 of Filamin-B OS=Homo sapiens OX=9606 GN=FLNB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null	888-UNIMOD:188,897-UNIMOD:188,2108-UNIMOD:267,2109-UNIMOD:267,397-UNIMOD:267,2180-UNIMOD:188,2153-UNIMOD:4,2162-UNIMOD:188,2166-UNIMOD:267	0.04	48.0	11	5	1
PRT	sp|P11586|C1TC_HUMAN	C-1-tetrahydrofolate synthase, cytoplasmic OS=Homo sapiens OX=9606 GN=MTHFD1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	48.0	null	785-UNIMOD:4,195-UNIMOD:4,793-UNIMOD:188,804-UNIMOD:267,198-UNIMOD:188	0.05	48.0	8	2	0
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	48.0	null	250-UNIMOD:188,268-UNIMOD:267	0.04	48.0	6	2	1
PRT	sp|P30876|RPB2_HUMAN	DNA-directed RNA polymerase II subunit RPB2 OS=Homo sapiens OX=9606 GN=POLR2B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	847-UNIMOD:188,859-UNIMOD:267	0.02	47.0	3	1	0
PRT	sp|Q16891-3|MIC60_HUMAN	Isoform 3 of MICOS complex subunit MIC60 OS=Homo sapiens OX=9606 GN=IMMT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	515-UNIMOD:267,532-UNIMOD:267,311-UNIMOD:188,312-UNIMOD:188	0.05	47.0	6	2	0
PRT	sp|P68371|TBB4B_HUMAN	Tubulin beta-4B chain OS=Homo sapiens OX=9606 GN=TUBB4B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	12-UNIMOD:4,121-UNIMOD:267,122-UNIMOD:188	0.09	47.0	10	4	0
PRT	sp|Q13616|CUL1_HUMAN	Cullin-1 OS=Homo sapiens OX=9606 GN=CUL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	473-UNIMOD:267,491-UNIMOD:188	0.03	47.0	3	1	0
PRT	sp|Q13885|TBB2A_HUMAN	Tubulin beta-2A chain OS=Homo sapiens OX=9606 GN=TUBB2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	47.0	null	2-UNIMOD:267,12-UNIMOD:4,19-UNIMOD:188,1-UNIMOD:35,1-UNIMOD:1	0.11	47.0	16	3	1
PRT	sp|Q05519-2|SRS11_HUMAN	Isoform 2 of Serine/arginine-rich splicing factor 11 OS=Homo sapiens OX=9606 GN=SRSF11	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	103-UNIMOD:267	0.05	46.0	3	1	0
PRT	sp|Q9BWD1|THIC_HUMAN	Acetyl-CoA acetyltransferase, cytosolic OS=Homo sapiens OX=9606 GN=ACAT2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	44-UNIMOD:267,65-UNIMOD:4,71-UNIMOD:267,360-UNIMOD:4,200-UNIMOD:188,210-UNIMOD:267	0.19	46.0	5	3	1
PRT	sp|P42330|AK1C3_HUMAN	Aldo-keto reductase family 1 member C3 OS=Homo sapiens OX=9606 GN=AKR1C3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.13	45.0	3	2	1
PRT	sp|P06737-2|PYGL_HUMAN	Isoform 2 of Glycogen phosphorylase, liver form OS=Homo sapiens OX=9606 GN=PYGL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	412-UNIMOD:4,424-UNIMOD:188	0.02	45.0	2	1	0
PRT	sp|Q7Z6Z7-2|HUWE1_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens OX=9606 GN=HUWE1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	182-UNIMOD:4,183-UNIMOD:4,2538-UNIMOD:267,173-UNIMOD:188,184-UNIMOD:267	0.01	45.0	6	2	0
PRT	sp|Q9BQA1|MEP50_HUMAN	Methylosome protein 50 OS=Homo sapiens OX=9606 GN=WDR77 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	172-UNIMOD:4,186-UNIMOD:4,179-UNIMOD:188,191-UNIMOD:267	0.08	44.0	3	1	0
PRT	sp|P46937-5|YAP1_HUMAN	Isoform 5 of Transcriptional coactivator YAP1 OS=Homo sapiens OX=9606 GN=YAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	161-UNIMOD:267	0.12	44.0	4	2	1
PRT	sp|O95456-2|PSMG1_HUMAN	Isoform 2 of Proteasome assembly chaperone 1 OS=Homo sapiens OX=9606 GN=PSMG1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.08	44.0	2	1	0
PRT	sp|P30519-2|HMOX2_HUMAN	Isoform 2 of Heme oxygenase 2 OS=Homo sapiens OX=9606 GN=HMOX2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	127-UNIMOD:267	0.07	44.0	4	1	0
PRT	sp|Q13813-2|SPTN1_HUMAN	Isoform 2 of Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	1066-UNIMOD:35,1067-UNIMOD:188,1082-UNIMOD:188,1610-UNIMOD:267,839-UNIMOD:267,871-UNIMOD:188,876-UNIMOD:188,931-UNIMOD:188,950-UNIMOD:267	0.03	44.0	17	5	0
PRT	sp|P06396-2|GELS_HUMAN	Isoform 2 of Gelsolin OS=Homo sapiens OX=9606 GN=GSN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	346-UNIMOD:267,368-UNIMOD:267	0.04	44.0	1	1	1
PRT	sp|P68400|CSK21_HUMAN	Casein kinase II subunit alpha OS=Homo sapiens OX=9606 GN=CSNK2A1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	303-UNIMOD:188	0.05	43.0	3	1	0
PRT	sp|Q96CS3|FAF2_HUMAN	FAS-associated factor 2 OS=Homo sapiens OX=9606 GN=FAF2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	50-UNIMOD:267	0.04	43.0	3	1	0
PRT	sp|P00441|SODC_HUMAN	Superoxide dismutase [Cu-Zn] OS=Homo sapiens OX=9606 GN=SOD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	112-UNIMOD:4	0.24	43.0	1	1	1
PRT	sp|O15067|PUR4_HUMAN	Phosphoribosylformylglycinamidine synthase OS=Homo sapiens OX=9606 GN=PFAS PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	318-UNIMOD:4,330-UNIMOD:267	0.02	43.0	4	1	0
PRT	sp|Q9UDT6-2|CLIP2_HUMAN	Isoform 2 of CAP-Gly domain-containing linker protein 2 OS=Homo sapiens OX=9606 GN=CLIP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.02	43.0	1	1	1
PRT	sp|P22087|FBRL_HUMAN	rRNA 2'-O-methyltransferase fibrillarin OS=Homo sapiens OX=9606 GN=FBL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	158-UNIMOD:188,162-UNIMOD:188	0.06	43.0	3	1	0
PRT	sp|Q96EP5-2|DAZP1_HUMAN	Isoform 2 of DAZ-associated protein 1 OS=Homo sapiens OX=9606 GN=DAZAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	124-UNIMOD:4	0.05	43.0	1	1	0
PRT	sp|P36941|TNR3_HUMAN	Tumor necrosis factor receptor superfamily member 3 OS=Homo sapiens OX=9606 GN=LTBR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	null	418-UNIMOD:4	0.04	43.0	1	1	0
PRT	sp|P34897-3|GLYM_HUMAN	Isoform 3 of Serine hydroxymethyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=SHMT2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	241-UNIMOD:188,160-UNIMOD:188	0.08	42.0	5	2	0
PRT	sp|P61201|CSN2_HUMAN	COP9 signalosome complex subunit 2 OS=Homo sapiens OX=9606 GN=COPS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.05	42.0	1	1	1
PRT	sp|Q96RP9|EFGM_HUMAN	Elongation factor G, mitochondrial OS=Homo sapiens OX=9606 GN=GFM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	594-UNIMOD:4,596-UNIMOD:188,603-UNIMOD:188,628-UNIMOD:267	0.05	42.0	6	2	0
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	1851-UNIMOD:188,1866-UNIMOD:188,825-UNIMOD:267,1255-UNIMOD:267,2413-UNIMOD:267,2421-UNIMOD:267,1063-UNIMOD:267	0.04	42.0	12	5	2
PRT	sp|Q15293-2|RCN1_HUMAN	Isoform 2 of Reticulocalbin-1 OS=Homo sapiens OX=9606 GN=RCN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	235-UNIMOD:267	0.06	42.0	4	1	0
PRT	sp|Q8IU81|I2BP1_HUMAN	Interferon regulatory factor 2-binding protein 1 OS=Homo sapiens OX=9606 GN=IRF2BP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.04	42.0	1	1	1
PRT	sp|P34932|HSP74_HUMAN	Heat shock 70 kDa protein 4 OS=Homo sapiens OX=9606 GN=HSPA4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	235-UNIMOD:188,245-UNIMOD:4,250-UNIMOD:188	0.02	42.0	4	1	0
PRT	sp|O75533|SF3B1_HUMAN	Splicing factor 3B subunit 1 OS=Homo sapiens OX=9606 GN=SF3B1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	42.0	null		0.05	42.0	6	3	1
PRT	sp|O95861-3|BPNT1_HUMAN	Isoform 3 of 3'(2'),5'-bisphosphate nucleotidase 1 OS=Homo sapiens OX=9606 GN=BPNT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	194-UNIMOD:4,190-UNIMOD:188,206-UNIMOD:188	0.07	42.0	3	1	0
PRT	sp|P17612-2|KAPCA_HUMAN	Isoform 2 of cAMP-dependent protein kinase catalytic subunit alpha OS=Homo sapiens OX=9606 GN=PRKACA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.05	42.0	2	1	0
PRT	sp|O43684-2|BUB3_HUMAN	Isoform 2 of Mitotic checkpoint protein BUB3 OS=Homo sapiens OX=9606 GN=BUB3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	81-UNIMOD:35,100-UNIMOD:267	0.06	42.0	4	1	0
PRT	sp|P78371-2|TCPB_HUMAN	Isoform 2 of T-complex protein 1 subunit beta OS=Homo sapiens OX=9606 GN=CCT2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	348-UNIMOD:4,144-UNIMOD:188,156-UNIMOD:188,355-UNIMOD:188,358-UNIMOD:267	0.07	42.0	5	2	0
PRT	sp|P62847-2|RS24_HUMAN	Isoform 2 of 40S ribosomal protein S24 OS=Homo sapiens OX=9606 GN=RPS24	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	68-UNIMOD:188,83-UNIMOD:188,21-UNIMOD:188,32-UNIMOD:188	0.28	42.0	6	2	0
PRT	sp|Q13200|PSMD2_HUMAN	26S proteasome non-ATPase regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PSMD2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	879-UNIMOD:267,688-UNIMOD:267,703-UNIMOD:267,168-UNIMOD:188,178-UNIMOD:188	0.08	42.0	7	4	1
PRT	sp|Q71U36|TBA1A_HUMAN	Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	null	85-UNIMOD:28,96-UNIMOD:188,105-UNIMOD:267	0.05	42.0	5	1	0
PRT	sp|Q15365|PCBP1_HUMAN	Poly(rC)-binding protein 1 OS=Homo sapiens OX=9606 GN=PCBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	42.0	null	244-UNIMOD:28,268-UNIMOD:188	0.07	42.0	7	1	0
PRT	sp|P60842-2|IF4A1_HUMAN	Isoform 2 of Eukaryotic initiation factor 4A-I OS=Homo sapiens OX=9606 GN=EIF4A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	146-UNIMOD:188,161-UNIMOD:267	0.06	41.0	3	1	0
PRT	sp|O75083|WDR1_HUMAN	WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=WDR1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	256-UNIMOD:188,259-UNIMOD:188,90-UNIMOD:188,95-UNIMOD:188	0.07	41.0	5	2	0
PRT	sp|Q13151|ROA0_HUMAN	Heterogeneous nuclear ribonucleoprotein A0 OS=Homo sapiens OX=9606 GN=HNRNPA0 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	154-UNIMOD:188,159-UNIMOD:188	0.07	41.0	3	1	0
PRT	sp|P56537|IF6_HUMAN	Eukaryotic translation initiation factor 6 OS=Homo sapiens OX=9606 GN=EIF6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	41.0	null	85-UNIMOD:267	0.08	41.0	9	1	0
PRT	sp|P50454|SERPH_HUMAN	Serpin H1 OS=Homo sapiens OX=9606 GN=SERPINH1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	332-UNIMOD:188,334-UNIMOD:188	0.04	41.0	4	1	0
PRT	sp|P62258-2|1433E_HUMAN	Isoform SV of 14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	96-UNIMOD:188,101-UNIMOD:188	0.08	41.0	4	1	0
PRT	sp|O76003|GLRX3_HUMAN	Glutaredoxin-3 OS=Homo sapiens OX=9606 GN=GLRX3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	188-UNIMOD:267,192-UNIMOD:188	0.07	41.0	3	1	0
PRT	sp|P49915-2|GUAA_HUMAN	Isoform 2 of GMP synthase [glutamine-hydrolyzing] OS=Homo sapiens OX=9606 GN=GMPS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	84-UNIMOD:188,101-UNIMOD:188	0.03	41.0	1	1	1
PRT	sp|Q9Y446|PKP3_HUMAN	Plakophilin-3 OS=Homo sapiens OX=9606 GN=PKP3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.02	41.0	2	1	0
PRT	sp|Q92900-2|RENT1_HUMAN	Isoform 2 of Regulator of nonsense transcripts 1 OS=Homo sapiens OX=9606 GN=UPF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	123-UNIMOD:4,126-UNIMOD:4,133-UNIMOD:4,137-UNIMOD:4,141-UNIMOD:188,142-UNIMOD:188	0.06	41.0	4	3	2
PRT	sp|Q9NZI8|IF2B1_HUMAN	Insulin-like growth factor 2 mRNA-binding protein 1 OS=Homo sapiens OX=9606 GN=IGF2BP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	150-UNIMOD:188	0.06	41.0	4	2	0
PRT	sp|P06576|ATPB_HUMAN	ATP synthase subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.04	41.0	2	1	0
PRT	sp|P43243|MATR3_HUMAN	Matrin-3 OS=Homo sapiens OX=9606 GN=MATR3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	515-UNIMOD:188	0.02	41.0	2	1	0
PRT	sp|Q9GZS3|WDR61_HUMAN	WD repeat-containing protein 61 OS=Homo sapiens OX=9606 GN=WDR61 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	41.0	null	266-UNIMOD:4,281-UNIMOD:188	0.06	41.0	4	1	0
PRT	sp|Q53GS9-2|SNUT2_HUMAN	Isoform 2 of U4/U6.U5 tri-snRNP-associated protein 2 OS=Homo sapiens OX=9606 GN=USP39	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	203-UNIMOD:4,205-UNIMOD:188	0.04	40.0	3	1	0
PRT	sp|O94826|TOM70_HUMAN	Mitochondrial import receptor subunit TOM70 OS=Homo sapiens OX=9606 GN=TOMM70 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	113-UNIMOD:267	0.04	40.0	3	1	0
PRT	sp|P32322-2|P5CR1_HUMAN	Isoform 2 of Pyrroline-5-carboxylate reductase 1, mitochondrial OS=Homo sapiens OX=9606 GN=PYCR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.08	40.0	2	1	0
PRT	sp|P40926|MDHM_HUMAN	Malate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=MDH2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.06	40.0	2	1	0
PRT	sp|P55060-4|XPO2_HUMAN	Isoform 4 of Exportin-2 OS=Homo sapiens OX=9606 GN=CSE1L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	371-UNIMOD:188,384-UNIMOD:188	0.02	40.0	2	1	0
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	639-UNIMOD:267,204-UNIMOD:188,219-UNIMOD:188	0.06	40.0	6	3	2
PRT	sp|Q969Z0-2|FAKD4_HUMAN	Isoform 2 of FAST kinase domain-containing protein 4 OS=Homo sapiens OX=9606 GN=TBRG4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	286-UNIMOD:188	0.04	40.0	3	1	0
PRT	sp|Q01082-3|SPTB2_HUMAN	Isoform 2 of Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	1848-UNIMOD:267,1479-UNIMOD:267,1491-UNIMOD:267	0.02	40.0	4	2	0
PRT	sp|O00151|PDLI1_HUMAN	PDZ and LIM domain protein 1 OS=Homo sapiens OX=9606 GN=PDLIM1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	104-UNIMOD:35,122-UNIMOD:267	0.06	40.0	1	1	1
PRT	sp|P30050-2|RL12_HUMAN	Isoform 2 of 60S ribosomal protein L12 OS=Homo sapiens OX=9606 GN=RPL12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.14	40.0	1	1	1
PRT	sp|P04406-2|G3P_HUMAN	Isoform 2 of Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	133-UNIMOD:35,144-UNIMOD:188	0.20	40.0	6	3	1
PRT	sp|Q9NQ29-2|LUC7L_HUMAN	Isoform 2 of Putative RNA-binding protein Luc7-like 1 OS=Homo sapiens OX=9606 GN=LUC7L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	43-UNIMOD:4,44-UNIMOD:4,53-UNIMOD:267	0.05	40.0	1	1	0
PRT	sp|Q00610-2|CLH1_HUMAN	Isoform 2 of Clathrin heavy chain 1 OS=Homo sapiens OX=9606 GN=CLTC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	617-UNIMOD:4,918-UNIMOD:4,912-UNIMOD:267,923-UNIMOD:267	0.03	40.0	5	3	2
PRT	sp|Q15046|SYK_HUMAN	Lysine--tRNA ligase OS=Homo sapiens OX=9606 GN=KARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	127-UNIMOD:188	0.03	40.0	3	1	0
PRT	sp|Q5VTE0|EF1A3_HUMAN	Putative elongation factor 1-alpha-like 3 OS=Homo sapiens OX=9606 GN=EEF1A1P5 PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	20-UNIMOD:188	0.11	40.0	31	3	1
PRT	sp|Q86SQ0|PHLB2_HUMAN	Pleckstrin homology-like domain family B member 2 OS=Homo sapiens OX=9606 GN=PHLDB2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	1136-UNIMOD:4,1144-UNIMOD:188	0.02	40.0	1	1	1
PRT	sp|Q9GZQ3|COMD5_HUMAN	COMM domain-containing protein 5 OS=Homo sapiens OX=9606 GN=COMMD5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	null	2-UNIMOD:1,21-UNIMOD:267	0.09	40.0	1	1	1
PRT	sp|P62906|RL10A_HUMAN	60S ribosomal protein L10a OS=Homo sapiens OX=9606 GN=RPL10A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	133-UNIMOD:188,147-UNIMOD:188,161-UNIMOD:188,164-UNIMOD:4,173-UNIMOD:188,144-UNIMOD:35,15-UNIMOD:267,23-UNIMOD:267	0.23	39.0	8	3	1
PRT	sp|P23246-2|SFPQ_HUMAN	Isoform Short of Splicing factor, proline- and glutamine-rich OS=Homo sapiens OX=9606 GN=SFPQ	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.03	39.0	3	1	0
PRT	sp|Q9UHD1-2|CHRD1_HUMAN	Isoform 2 of Cysteine and histidine-rich domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CHORDC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	82-UNIMOD:188,88-UNIMOD:188	0.05	39.0	2	1	0
PRT	sp|O75367-2|H2AY_HUMAN	Isoform 1 of Core histone macro-H2A.1 OS=Homo sapiens OX=9606 GN=MACROH2A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	273-UNIMOD:4,282-UNIMOD:188,283-UNIMOD:4,289-UNIMOD:188	0.06	39.0	4	1	0
PRT	sp|Q96MX6-2|WDR92_HUMAN	Isoform 2 of WD repeat-containing protein 92 OS=Homo sapiens OX=9606 GN=WDR92	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.10	39.0	2	1	0
PRT	sp|Q70UQ0-4|IKIP_HUMAN	Isoform 4 of Inhibitor of nuclear factor kappa-B kinase-interacting protein OS=Homo sapiens OX=9606 GN=IKBIP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.05	39.0	2	1	0
PRT	sp|O00571-2|DDX3X_HUMAN	Isoform 2 of ATP-dependent RNA helicase DDX3X OS=Homo sapiens OX=9606 GN=DDX3X	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	512-UNIMOD:267,452-UNIMOD:4	0.07	39.0	5	2	1
PRT	sp|O76071|CIAO1_HUMAN	Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Homo sapiens OX=9606 GN=CIAO1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	175-UNIMOD:188	0.06	39.0	2	1	0
PRT	sp|P12814-2|ACTN1_HUMAN	Isoform 2 of Alpha-actinin-1 OS=Homo sapiens OX=9606 GN=ACTN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	672-UNIMOD:267,660-UNIMOD:35,614-UNIMOD:267,624-UNIMOD:267,714-UNIMOD:267	0.06	39.0	12	4	1
PRT	sp|O00541-2|PESC_HUMAN	Isoform 2 of Pescadillo homolog OS=Homo sapiens OX=9606 GN=PES1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	375-UNIMOD:267,385-UNIMOD:267	0.03	39.0	2	1	0
PRT	sp|P07910-4|HNRPC_HUMAN	Isoform 4 of Heterogeneous nuclear ribonucleoproteins C1/C2 OS=Homo sapiens OX=9606 GN=HNRNPC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	46-UNIMOD:4	0.08	39.0	1	1	0
PRT	sp|Q9UQ80-2|PA2G4_HUMAN	Isoform 2 of Proliferation-associated protein 2G4 OS=Homo sapiens OX=9606 GN=PA2G4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	18-UNIMOD:188,31-UNIMOD:4,33-UNIMOD:4,39-UNIMOD:188,125-UNIMOD:4,137-UNIMOD:188,237-UNIMOD:35,242-UNIMOD:4	0.19	39.0	7	3	1
PRT	sp|Q9NZU5-2|LMCD1_HUMAN	Isoform 2 of LIM and cysteine-rich domains protein 1 OS=Homo sapiens OX=9606 GN=LMCD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	262-UNIMOD:4,265-UNIMOD:4	0.05	39.0	2	1	0
PRT	sp|P38919|IF4A3_HUMAN	Eukaryotic initiation factor 4A-III OS=Homo sapiens OX=9606 GN=EIF4A3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.04	39.0	2	1	0
PRT	sp|P30048-2|PRDX3_HUMAN	Isoform 2 of Thioredoxin-dependent peroxide reductase, mitochondrial OS=Homo sapiens OX=9606 GN=PRDX3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	131-UNIMOD:188,148-UNIMOD:188	0.08	39.0	3	1	0
PRT	sp|P30101|PDIA3_HUMAN	Protein disulfide-isomerase A3 OS=Homo sapiens OX=9606 GN=PDIA3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.05	39.0	2	1	0
PRT	sp|Q9Y383-3|LC7L2_HUMAN	Isoform 3 of Putative RNA-binding protein Luc7-like 2 OS=Homo sapiens OX=9606 GN=LUC7L2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	40-UNIMOD:4,41-UNIMOD:4,50-UNIMOD:267,132-UNIMOD:188,136-UNIMOD:188	0.08	39.0	6	2	0
PRT	sp|P62888|RL30_HUMAN	60S ribosomal protein L30 OS=Homo sapiens OX=9606 GN=RPL30 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	85-UNIMOD:4,87-UNIMOD:188	0.17	39.0	3	1	0
PRT	sp|P69905|HBA_HUMAN	Hemoglobin subunit alpha OS=Homo sapiens OX=9606 GN=HBA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.12	39.0	2	1	0
PRT	sp|Q3LXA3-2|TKFC_HUMAN	Isoform 2 of Triokinase/FMN cyclase OS=Homo sapiens OX=9606 GN=TKFC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.04	39.0	1	1	1
PRT	sp|P55795|HNRH2_HUMAN	Heterogeneous nuclear ribonucleoprotein H2 OS=Homo sapiens OX=9606 GN=HNRNPH2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	290-UNIMOD:4,294-UNIMOD:267	0.04	39.0	4	1	0
PRT	sp|Q14204|DYHC1_HUMAN	Cytoplasmic dynein 1 heavy chain 1 OS=Homo sapiens OX=9606 GN=DYNC1H1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	39.0	null	67-UNIMOD:188,81-UNIMOD:267,3191-UNIMOD:267,3206-UNIMOD:267	0.01	39.0	7	3	0
PRT	sp|Q9Y6M5|ZNT1_HUMAN	Zinc transporter 1 OS=Homo sapiens OX=9606 GN=SLC30A1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	39.0	null	381-UNIMOD:267	0.04	39.0	2	1	0
PRT	sp|P60981|DEST_HUMAN	Destrin OS=Homo sapiens OX=9606 GN=DSTN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	132-UNIMOD:188,135-UNIMOD:4,145-UNIMOD:267	0.12	39.0	7	1	0
PRT	sp|P24752|THIL_HUMAN	Acetyl-CoA acetyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=ACAT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	39.0	null	366-UNIMOD:35	0.07	39.0	3	1	0
PRT	sp|Q02543|RL18A_HUMAN	60S ribosomal protein L18a OS=Homo sapiens OX=9606 GN=RPL18A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	128-UNIMOD:188,136-UNIMOD:188	0.10	38.0	4	1	0
PRT	sp|Q13177|PAK2_HUMAN	Serine/threonine-protein kinase PAK 2 OS=Homo sapiens OX=9606 GN=PAK2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null	352-UNIMOD:4,367-UNIMOD:267	0.03	38.0	2	1	0
PRT	sp|Q92945|FUBP2_HUMAN	Far upstream element-binding protein 2 OS=Homo sapiens OX=9606 GN=KHSRP PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.05	38.0	2	1	0
PRT	sp|P39019|RS19_HUMAN	40S ribosomal protein S19 OS=Homo sapiens OX=9606 GN=RPS19 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	43-UNIMOD:188,56-UNIMOD:267	0.11	38.0	3	1	0
PRT	sp|Q9Y2L1-2|RRP44_HUMAN	Isoform 2 of Exosome complex exonuclease RRP44 OS=Homo sapiens OX=9606 GN=DIS3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	444-UNIMOD:4,446-UNIMOD:4,453-UNIMOD:4,462-UNIMOD:4,463-UNIMOD:267	0.02	38.0	4	1	0
PRT	sp|O94832|MYO1D_HUMAN	Unconventional myosin-Id OS=Homo sapiens OX=9606 GN=MYO1D PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	970-UNIMOD:4,975-UNIMOD:188,450-UNIMOD:188	0.04	38.0	3	2	1
PRT	sp|Q58FF8|H90B2_HUMAN	Putative heat shock protein HSP 90-beta 2 OS=Homo sapiens OX=9606 GN=HSP90AB2P PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null	141-UNIMOD:188,143-UNIMOD:267	0.05	38.0	7	1	0
PRT	sp|Q9ULV4|COR1C_HUMAN	Coronin-1C OS=Homo sapiens OX=9606 GN=CORO1C PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	23-UNIMOD:4	0.04	38.0	2	1	0
PRT	sp|Q14566|MCM6_HUMAN	DNA replication licensing factor MCM6 OS=Homo sapiens OX=9606 GN=MCM6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	796-UNIMOD:188	0.02	38.0	3	1	0
PRT	sp|P14618-3|KPYM_HUMAN	Isoform 3 of Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	264-UNIMOD:267,279-UNIMOD:267,384-UNIMOD:267,385-UNIMOD:267,263-UNIMOD:267	0.09	38.0	6	3	0
PRT	sp|Q02790|FKBP4_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Homo sapiens OX=9606 GN=FKBP4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	359-UNIMOD:267,373-UNIMOD:267	0.07	38.0	4	2	1
PRT	sp|P07900-2|HS90A_HUMAN	Isoform 2 of Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	635-UNIMOD:188,651-UNIMOD:4,656-UNIMOD:188,313-UNIMOD:188,323-UNIMOD:267	0.06	38.0	6	3	1
PRT	sp|P30520|PURA2_HUMAN	Adenylosuccinate synthetase isozyme 2 OS=Homo sapiens OX=9606 GN=ADSS2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	151-UNIMOD:267	0.04	37.0	2	1	0
PRT	sp|O94776|MTA2_HUMAN	Metastasis-associated protein MTA2 OS=Homo sapiens OX=9606 GN=MTA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	428-UNIMOD:267,443-UNIMOD:267	0.03	37.0	2	1	0
PRT	sp|Q9H0D6-2|XRN2_HUMAN	Isoform 2 of 5'-3' exoribonuclease 2 OS=Homo sapiens OX=9606 GN=XRN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	220-UNIMOD:4	0.03	37.0	1	1	1
PRT	sp|P62244|RS15A_HUMAN	40S ribosomal protein S15a OS=Homo sapiens OX=9606 GN=RPS15A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	57-UNIMOD:267	0.12	37.0	4	1	0
PRT	sp|Q9NQT8|KI13B_HUMAN	Kinesin-like protein KIF13B OS=Homo sapiens OX=9606 GN=KIF13B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	366-UNIMOD:267	0.01	37.0	2	1	0
PRT	sp|Q9C040|TRIM2_HUMAN	Tripartite motif-containing protein 2 OS=Homo sapiens OX=9606 GN=TRIM2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	235-UNIMOD:188,252-UNIMOD:188	0.03	37.0	1	1	1
PRT	sp|Q15436-2|SC23A_HUMAN	Isoform 2 of Protein transport protein Sec23A OS=Homo sapiens OX=9606 GN=SEC23A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	497-UNIMOD:267,116-UNIMOD:188,120-UNIMOD:188	0.08	37.0	5	3	2
PRT	sp|Q15185-3|TEBP_HUMAN	Isoform 3 of Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	58-UNIMOD:4,65-UNIMOD:188	0.14	37.0	5	1	0
PRT	sp|Q96HN2-2|SAHH3_HUMAN	Isoform 2 of Adenosylhomocysteinase 3 OS=Homo sapiens OX=9606 GN=AHCYL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.03	37.0	2	1	0
PRT	sp|Q9H089|LSG1_HUMAN	Large subunit GTPase 1 homolog OS=Homo sapiens OX=9606 GN=LSG1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	47-UNIMOD:267	0.03	37.0	1	1	1
PRT	sp|P05198|IF2A_HUMAN	Eukaryotic translation initiation factor 2 subunit 1 OS=Homo sapiens OX=9606 GN=EIF2S1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	123-UNIMOD:188,133-UNIMOD:267	0.07	37.0	2	1	0
PRT	sp|P49736|MCM2_HUMAN	DNA replication licensing factor MCM2 OS=Homo sapiens OX=9606 GN=MCM2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.02	37.0	1	1	1
PRT	sp|O95881|TXD12_HUMAN	Thioredoxin domain-containing protein 12 OS=Homo sapiens OX=9606 GN=TXNDC12 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	123-UNIMOD:188,138-UNIMOD:188	0.15	37.0	3	1	0
PRT	sp|P50990|TCPQ_HUMAN	T-complex protein 1 subunit theta OS=Homo sapiens OX=9606 GN=CCT8 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	224-UNIMOD:188,225-UNIMOD:188,148-UNIMOD:4,149-UNIMOD:4,138-UNIMOD:188,152-UNIMOD:188	0.07	37.0	6	2	0
PRT	sp|Q9Y653-2|AGRG1_HUMAN	Isoform 2 of Adhesion G-protein coupled receptor G1 OS=Homo sapiens OX=9606 GN=ADGRG1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.06	37.0	2	2	2
PRT	sp|Q7L8L6|FAKD5_HUMAN	FAST kinase domain-containing protein 5, mitochondrial OS=Homo sapiens OX=9606 GN=FASTKD5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	345-UNIMOD:4	0.02	37.0	2	1	0
PRT	sp|P47897|SYQ_HUMAN	Glutamine--tRNA ligase OS=Homo sapiens OX=9606 GN=QARS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	166-UNIMOD:188,180-UNIMOD:188	0.05	37.0	4	2	0
PRT	sp|P07195|LDHB_HUMAN	L-lactate dehydrogenase B chain OS=Homo sapiens OX=9606 GN=LDHB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.06	37.0	1	1	1
PRT	sp|Q99460-2|PSMD1_HUMAN	Isoform 2 of 26S proteasome non-ATPase regulatory subunit 1 OS=Homo sapiens OX=9606 GN=PSMD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	615-UNIMOD:267,616-UNIMOD:267	0.02	37.0	3	1	0
PRT	sp|O75569-3|PRKRA_HUMAN	Isoform 3 of Interferon-inducible double-stranded RNA-dependent protein kinase activator A OS=Homo sapiens OX=9606 GN=PRKRA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.06	37.0	2	1	0
PRT	sp|P11413|G6PD_HUMAN	Glucose-6-phosphate 1-dehydrogenase OS=Homo sapiens OX=9606 GN=G6PD PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	385-UNIMOD:4,386-UNIMOD:188,136-UNIMOD:267,182-UNIMOD:267,192-UNIMOD:267	0.14	37.0	10	4	1
PRT	sp|Q9Y399|RT02_HUMAN	28S ribosomal protein S2, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	277-UNIMOD:188	0.08	37.0	4	1	0
PRT	sp|P62979|RS27A_HUMAN	Ubiquitin-40S ribosomal protein S27a OS=Homo sapiens OX=9606 GN=RPS27A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	119-UNIMOD:267,121-UNIMOD:4,126-UNIMOD:4,138-UNIMOD:267	0.13	37.0	1	1	1
PRT	sp|P55084-2|ECHB_HUMAN	Isoform 2 of Trifunctional enzyme subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=HADHB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	53-UNIMOD:35	0.05	37.0	3	1	0
PRT	sp|P22061|PIMT_HUMAN	Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Homo sapiens OX=9606 GN=PCMT1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null	145-UNIMOD:35,174-UNIMOD:188,178-UNIMOD:267,18-UNIMOD:267	0.31	37.0	8	3	0
PRT	sp|Q9NYF8-2|BCLF1_HUMAN	Isoform 2 of Bcl-2-associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	535-UNIMOD:35	0.05	37.0	3	3	2
PRT	sp|Q96QV6|H2A1A_HUMAN	Histone H2A type 1-A OS=Homo sapiens OX=9606 GN=HIST1H2AA PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	89-UNIMOD:267,96-UNIMOD:188	0.11	37.0	2	1	0
PRT	sp|O00267|SPT5H_HUMAN	Transcription elongation factor SPT5 OS=Homo sapiens OX=9606 GN=SUPT5H PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null		0.02	37.0	1	1	0
PRT	sp|P07814|SYEP_HUMAN	Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens OX=9606 GN=EPRS1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	1250-UNIMOD:188	0.02	36.0	3	2	1
PRT	sp|Q9ULE6|PALD_HUMAN	Paladin OS=Homo sapiens OX=9606 GN=PALD1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.02	36.0	2	1	0
PRT	sp|Q9BQ52-2|RNZ2_HUMAN	Isoform 2 of Zinc phosphodiesterase ELAC protein 2 OS=Homo sapiens OX=9606 GN=ELAC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	280-UNIMOD:4,287-UNIMOD:267	0.04	36.0	6	1	0
PRT	sp|P62277|RS13_HUMAN	40S ribosomal protein S13 OS=Homo sapiens OX=9606 GN=RPS13 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	93-UNIMOD:188,94-UNIMOD:188,78-UNIMOD:188	0.13	36.0	6	2	0
PRT	sp|Q6RFH5-2|WDR74_HUMAN	Isoform 2 of WD repeat-containing protein 74 OS=Homo sapiens OX=9606 GN=WDR74	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	277-UNIMOD:4,287-UNIMOD:4	0.10	36.0	3	2	0
PRT	sp|Q14677|EPN4_HUMAN	Clathrin interactor 1 OS=Homo sapiens OX=9606 GN=CLINT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	274-UNIMOD:267	0.02	36.0	4	1	0
PRT	sp|O00754-2|MA2B1_HUMAN	Isoform 2 of Lysosomal alpha-mannosidase OS=Homo sapiens OX=9606 GN=MAN2B1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	856-UNIMOD:267	0.02	36.0	2	1	0
PRT	sp|Q7KZF4|SND1_HUMAN	Staphylococcal nuclease domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SND1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	769-UNIMOD:267,776-UNIMOD:267	0.02	36.0	2	1	0
PRT	sp|P26583|HMGB2_HUMAN	High mobility group protein B2 OS=Homo sapiens OX=9606 GN=HMGB2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	114-UNIMOD:188,127-UNIMOD:188,30-UNIMOD:188,43-UNIMOD:188	0.15	36.0	5	2	0
PRT	sp|Q9NPE3|NOP10_HUMAN	H/ACA ribonucleoprotein complex subunit 3 OS=Homo sapiens OX=9606 GN=NOP10 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	28-UNIMOD:4	0.27	36.0	2	1	0
PRT	sp|P48634-4|PRC2A_HUMAN	Isoform 4 of Protein PRRC2A OS=Homo sapiens OX=9606 GN=PRRC2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	157-UNIMOD:267	0.03	36.0	2	2	2
PRT	sp|P15170|ERF3A_HUMAN	Eukaryotic peptide chain release factor GTP-binding subunit ERF3A OS=Homo sapiens OX=9606 GN=GSPT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	381-UNIMOD:4,387-UNIMOD:4,254-UNIMOD:188,261-UNIMOD:4,270-UNIMOD:188,367-UNIMOD:188,391-UNIMOD:267	0.09	36.0	5	2	0
PRT	sp|Q06830|PRDX1_HUMAN	Peroxiredoxin-1 OS=Homo sapiens OX=9606 GN=PRDX1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	71-UNIMOD:4,83-UNIMOD:4,92-UNIMOD:188	0.13	36.0	4	1	0
PRT	sp|O75323|NIPS2_HUMAN	Protein NipSnap homolog 2 OS=Homo sapiens OX=9606 GN=NIPSNAP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	85-UNIMOD:4,82-UNIMOD:188,91-UNIMOD:188	0.06	36.0	3	1	0
PRT	sp|P35580|MYH10_HUMAN	Myosin-10 OS=Homo sapiens OX=9606 GN=MYH10 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	1424-UNIMOD:267,1440-UNIMOD:267	0.02	36.0	4	3	2
PRT	sp|Q96AG4|LRC59_HUMAN	Leucine-rich repeat-containing protein 59 OS=Homo sapiens OX=9606 GN=LRRC59 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	293-UNIMOD:267	0.05	36.0	1	1	1
PRT	sp|P62195-2|PRS8_HUMAN	Isoform 2 of 26S proteasome regulatory subunit 8 OS=Homo sapiens OX=9606 GN=PSMC5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	377-UNIMOD:35,162-UNIMOD:188,176-UNIMOD:188,201-UNIMOD:4,205-UNIMOD:267	0.13	36.0	12	3	0
PRT	sp|P39023|RL3_HUMAN	60S ribosomal protein L3 OS=Homo sapiens OX=9606 GN=RPL3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	103-UNIMOD:188,114-UNIMOD:4,115-UNIMOD:188	0.04	36.0	4	1	0
PRT	sp|Q9H410-4|DSN1_HUMAN	Isoform 4 of Kinetochore-associated protein DSN1 homolog OS=Homo sapiens OX=9606 GN=DSN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.06	36.0	1	1	1
PRT	sp|Q9H0B6-2|KLC2_HUMAN	Isoform 2 of Kinesin light chain 2 OS=Homo sapiens OX=9606 GN=KLC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.04	36.0	1	1	1
PRT	sp|Q9Y490|TLN1_HUMAN	Talin-1 OS=Homo sapiens OX=9606 GN=TLN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	178-UNIMOD:267,181-UNIMOD:267,194-UNIMOD:267	0.01	36.0	5	2	0
PRT	sp|Q15125|EBP_HUMAN	3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase OS=Homo sapiens OX=9606 GN=EBP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	2-UNIMOD:1,17-UNIMOD:267,221-UNIMOD:188	0.13	36.0	4	2	0
PRT	sp|Q96RN5|MED15_HUMAN	Mediator of RNA polymerase II transcription subunit 15 OS=Homo sapiens OX=9606 GN=MED15 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	240-UNIMOD:267	0.02	36.0	1	1	0
PRT	sp|P61247|RS3A_HUMAN	40S ribosomal protein S3a OS=Homo sapiens OX=9606 GN=RPS3A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	201-UNIMOD:4	0.06	35.0	1	1	1
PRT	sp|P22695|QCR2_HUMAN	Cytochrome b-c1 complex subunit 2, mitochondrial OS=Homo sapiens OX=9606 GN=UQCRC2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	70-UNIMOD:267,84-UNIMOD:267	0.04	35.0	3	1	0
PRT	sp|P41250|GARS_HUMAN	Glycine--tRNA ligase OS=Homo sapiens OX=9606 GN=GARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	360-UNIMOD:188,364-UNIMOD:188	0.03	35.0	2	1	0
PRT	sp|Q99805|TM9S2_HUMAN	Transmembrane 9 superfamily member 2 OS=Homo sapiens OX=9606 GN=TM9SF2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	174-UNIMOD:4,182-UNIMOD:4	0.03	35.0	1	1	1
PRT	sp|Q15691|MARE1_HUMAN	Microtubule-associated protein RP/EB family member 1 OS=Homo sapiens OX=9606 GN=MAPRE1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null	66-UNIMOD:188,76-UNIMOD:188	0.06	35.0	5	1	0
PRT	sp|Q9NTK5|OLA1_HUMAN	Obg-like ATPase 1 OS=Homo sapiens OX=9606 GN=OLA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	209-UNIMOD:188,216-UNIMOD:188	0.04	35.0	4	1	0
PRT	sp|Q7L014|DDX46_HUMAN	Probable ATP-dependent RNA helicase DDX46 OS=Homo sapiens OX=9606 GN=DDX46 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	1	1	1
PRT	sp|Q14258|TRI25_HUMAN	E3 ubiquitin/ISG15 ligase TRIM25 OS=Homo sapiens OX=9606 GN=TRIM25 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.03	35.0	1	1	1
PRT	sp|Q9Y6K9-3|NEMO_HUMAN	Isoform 3 of NF-kappa-B essential modulator OS=Homo sapiens OX=9606 GN=IKBKG	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	286-UNIMOD:267	0.08	35.0	2	1	0
PRT	sp|P38405-3|GNAL_HUMAN	Isoform 3 of Guanine nucleotide-binding protein G(olf) subunit alpha OS=Homo sapiens OX=9606 GN=GNAL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	139-UNIMOD:4,145-UNIMOD:4	0.10	35.0	1	1	1
PRT	sp|Q16576|RBBP7_HUMAN	Histone-binding protein RBBP7 OS=Homo sapiens OX=9606 GN=RBBP7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	375-UNIMOD:188	0.07	35.0	3	1	0
PRT	sp|P54819-6|KAD2_HUMAN	Isoform 6 of Adenylate kinase 2, mitochondrial OS=Homo sapiens OX=9606 GN=AK2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	138-UNIMOD:267,154-UNIMOD:267	0.10	35.0	2	1	0
PRT	sp|P31153-2|METK2_HUMAN	Isoform 2 of S-adenosylmethionine synthase isoform type-2 OS=Homo sapiens OX=9606 GN=MAT2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.07	35.0	2	1	0
PRT	sp|P33991|MCM4_HUMAN	DNA replication licensing factor MCM4 OS=Homo sapiens OX=9606 GN=MCM4 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	1	1	1
PRT	sp|Q9NTJ5-2|SAC1_HUMAN	Isoform 2 of Phosphatidylinositide phosphatase SAC1 OS=Homo sapiens OX=9606 GN=SACM1L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	362-UNIMOD:188,371-UNIMOD:188	0.04	35.0	2	1	0
PRT	sp|Q04637-6|IF4G1_HUMAN	Isoform E of Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	738-UNIMOD:4,740-UNIMOD:4,729-UNIMOD:188,741-UNIMOD:267	0.01	35.0	3	1	0
PRT	sp|Q15126|PMVK_HUMAN	Phosphomevalonate kinase OS=Homo sapiens OX=9606 GN=PMVK PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.10	35.0	1	1	1
PRT	sp|P53621|COPA_HUMAN	Coatomer subunit alpha OS=Homo sapiens OX=9606 GN=COPA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	41-UNIMOD:4,40-UNIMOD:35,522-UNIMOD:4	0.03	35.0	5	2	0
PRT	sp|Q16555-2|DPYL2_HUMAN	Isoform 2 of Dihydropyrimidinase-related protein 2 OS=Homo sapiens OX=9606 GN=DPYSL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.04	35.0	1	1	1
PRT	sp|P51970|NDUA8_HUMAN	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 OS=Homo sapiens OX=9606 GN=NDUFA8 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	147-UNIMOD:267,166-UNIMOD:267	0.13	35.0	1	1	1
PRT	sp|P68363-2|TBA1B_HUMAN	Isoform 2 of Tubulin alpha-1B chain OS=Homo sapiens OX=9606 GN=TUBA1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	278-UNIMOD:188,285-UNIMOD:188	0.18	35.0	6	3	1
PRT	sp|P62937|PPIA_HUMAN	Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	82-UNIMOD:188,91-UNIMOD:188,115-UNIMOD:4,125-UNIMOD:188,131-UNIMOD:188	0.34	35.0	5	3	1
PRT	sp|P18754|RCC1_HUMAN	Regulator of chromosome condensation OS=Homo sapiens OX=9606 GN=RCC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	308-UNIMOD:4,314-UNIMOD:188	0.05	35.0	2	1	0
PRT	sp|P62249|RS16_HUMAN	40S ribosomal protein S16 OS=Homo sapiens OX=9606 GN=RPS16 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	73-UNIMOD:188,85-UNIMOD:267	0.10	35.0	2	1	0
PRT	sp|P51572|BAP31_HUMAN	B-cell receptor-associated protein 31 OS=Homo sapiens OX=9606 GN=BCAP31 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	89-UNIMOD:35,95-UNIMOD:188	0.07	35.0	3	1	0
PRT	sp|P31943|HNRH1_HUMAN	Heterogeneous nuclear ribonucleoprotein H OS=Homo sapiens OX=9606 GN=HNRNPH1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	290-UNIMOD:4,294-UNIMOD:267	0.04	35.0	3	1	0
PRT	sp|P06733|ENOA_HUMAN	Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null		0.07	35.0	1	1	1
PRT	sp|P30048|PRDX3_HUMAN	Thioredoxin-dependent peroxide reductase, mitochondrial OS=Homo sapiens OX=9606 GN=PRDX3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null		0.07	35.0	2	1	0
PRT	sp|Q99536|VAT1_HUMAN	Synaptic vesicle membrane protein VAT-1 homolog OS=Homo sapiens OX=9606 GN=VAT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	35.0	null	67-UNIMOD:267,82-UNIMOD:267	0.05	35.0	2	1	0
PRT	sp|Q13011|ECH1_HUMAN	Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial OS=Homo sapiens OX=9606 GN=ECH1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	159-UNIMOD:4,171-UNIMOD:4,182-UNIMOD:4	0.09	34.0	1	1	1
PRT	sp|Q15061|WDR43_HUMAN	WD repeat-containing protein 43 OS=Homo sapiens OX=9606 GN=WDR43 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null	307-UNIMOD:4,308-UNIMOD:188	0.03	34.0	6	1	0
PRT	sp|Q6GMV3|PTRD1_HUMAN	Putative peptidyl-tRNA hydrolase PTRHD1 OS=Homo sapiens OX=9606 GN=PTRHD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	77-UNIMOD:267	0.11	34.0	3	1	0
PRT	sp|Q15075|EEA1_HUMAN	Early endosome antigen 1 OS=Homo sapiens OX=9606 GN=EEA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null		0.01	34.0	2	1	0
PRT	sp|Q14166|TTL12_HUMAN	Tubulin--tyrosine ligase-like protein 12 OS=Homo sapiens OX=9606 GN=TTLL12 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	126-UNIMOD:4,127-UNIMOD:267	0.04	34.0	4	1	0
PRT	sp|P31930|QCR1_HUMAN	Cytochrome b-c1 complex subunit 1, mitochondrial OS=Homo sapiens OX=9606 GN=UQCRC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null		0.04	34.0	2	1	0
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	1	1	1
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	258-UNIMOD:267,259-UNIMOD:267,290-UNIMOD:4	0.09	34.0	3	2	1
PRT	sp|P22626-2|ROA2_HUMAN	Isoform A2 of Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	156-UNIMOD:188,161-UNIMOD:188,173-UNIMOD:267	0.10	34.0	6	2	0
PRT	sp|P84085|ARF5_HUMAN	ADP-ribosylation factor 5 OS=Homo sapiens OX=9606 GN=ARF5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	97-UNIMOD:267,99-UNIMOD:267	0.12	34.0	3	1	0
PRT	sp|Q9BSJ8|ESYT1_HUMAN	Extended synaptotagmin-1 OS=Homo sapiens OX=9606 GN=ESYT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	34.0	null	662-UNIMOD:188,664-UNIMOD:267,693-UNIMOD:267,699-UNIMOD:267	0.09	34.0	7	4	2
PRT	sp|P09429|HMGB1_HUMAN	High mobility group protein B1 OS=Homo sapiens OX=9606 GN=HMGB1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	114-UNIMOD:188,127-UNIMOD:188,30-UNIMOD:188,43-UNIMOD:188	0.14	34.0	6	2	0
PRT	sp|P49591|SYSC_HUMAN	Serine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=SARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	1	1	1
PRT	sp|Q9NQC3-2|RTN4_HUMAN	Isoform B of Reticulon-4 OS=Homo sapiens OX=9606 GN=RTN4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	79-UNIMOD:35	0.09	34.0	3	1	0
PRT	sp|P34949|MPI_HUMAN	Mannose-6-phosphate isomerase OS=Homo sapiens OX=9606 GN=MPI PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	163-UNIMOD:188,180-UNIMOD:188	0.04	34.0	4	1	0
PRT	sp|P56945-4|BCAR1_HUMAN	Isoform 4 of Breast cancer anti-estrogen resistance protein 1 OS=Homo sapiens OX=9606 GN=BCAR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.04	34.0	1	1	1
PRT	sp|P29401|TKT_HUMAN	Transketolase OS=Homo sapiens OX=9606 GN=TKT PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	1	1	1
PRT	sp|Q15149-7|PLEC_HUMAN	Isoform 7 of Plectin OS=Homo sapiens OX=9606 GN=PLEC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	2563-UNIMOD:267,2574-UNIMOD:267,2791-UNIMOD:267	0.01	34.0	10	4	2
PRT	sp|O75607|NPM3_HUMAN	Nucleoplasmin-3 OS=Homo sapiens OX=9606 GN=NPM3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	102-UNIMOD:188	0.09	34.0	2	1	0
PRT	sp|Q15287-3|RNPS1_HUMAN	Isoform 3 of RNA-binding protein with serine-rich domain 1 OS=Homo sapiens OX=9606 GN=RNPS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	137-UNIMOD:188,149-UNIMOD:188	0.06	34.0	4	1	0
PRT	sp|P60903|S10AA_HUMAN	Protein S100-A10 OS=Homo sapiens OX=9606 GN=S100A10 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	18-UNIMOD:188	0.19	34.0	4	1	0
PRT	sp|Q86V81|THOC4_HUMAN	THO complex subunit 4 OS=Homo sapiens OX=9606 GN=ALYREF PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	34.0	null	82-UNIMOD:28,86-UNIMOD:188,107-UNIMOD:188	0.11	34.0	5	1	0
PRT	sp|P12956-2|XRCC6_HUMAN	Isoform 2 of X-ray repair cross-complementing protein 6 OS=Homo sapiens OX=9606 GN=XRCC6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.06	34.0	3	2	1
PRT	sp|P30533|AMRP_HUMAN	Alpha-2-macroglobulin receptor-associated protein OS=Homo sapiens OX=9606 GN=LRPAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.05	34.0	1	1	1
PRT	sp|P36542-2|ATPG_HUMAN	Isoform Heart of ATP synthase subunit gamma, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.05	34.0	1	1	1
PRT	sp|P35606-2|COPB2_HUMAN	Isoform 2 of Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	139-UNIMOD:188,157-UNIMOD:188	0.03	34.0	2	1	0
PRT	sp|Q09666|AHNK_HUMAN	Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	1381-UNIMOD:188,3601-UNIMOD:188,1509-UNIMOD:188,2030-UNIMOD:35,2047-UNIMOD:188,1205-UNIMOD:188,1208-UNIMOD:188	0.03	34.0	6	5	4
PRT	sp|Q92616|GCN1_HUMAN	eIF-2-alpha kinase activator GCN1 OS=Homo sapiens OX=9606 GN=GCN1 PE=1 SV=6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	965-UNIMOD:188,986-UNIMOD:188,259-UNIMOD:188,268-UNIMOD:188,2550-UNIMOD:188	0.02	34.0	7	3	0
PRT	sp|P07910|HNRPC_HUMAN	Heterogeneous nuclear ribonucleoproteins C1/C2 OS=Homo sapiens OX=9606 GN=HNRNPC PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	46-UNIMOD:4	0.07	34.0	1	1	0
PRT	sp|P46063|RECQ1_HUMAN	ATP-dependent DNA helicase Q1 OS=Homo sapiens OX=9606 GN=RECQL PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null		0.04	34.0	1	1	1
PRT	sp|Q15758|AAAT_HUMAN	Neutral amino acid transporter B(0) OS=Homo sapiens OX=9606 GN=SLC1A5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	525-UNIMOD:267,537-UNIMOD:188	0.03	34.0	2	1	0
PRT	sp|Q6FI81-3|CPIN1_HUMAN	Isoform 3 of Anamorsin OS=Homo sapiens OX=9606 GN=CIAPIN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.06	33.0	2	1	0
PRT	sp|Q13838|DX39B_HUMAN	Spliceosome RNA helicase DDX39B OS=Homo sapiens OX=9606 GN=DDX39B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null	198-UNIMOD:4,207-UNIMOD:35,200-UNIMOD:188,208-UNIMOD:267	0.04	33.0	5	1	0
PRT	sp|P56192|SYMC_HUMAN	Methionine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=MARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	3	2	1
PRT	sp|P12532|KCRU_HUMAN	Creatine kinase U-type, mitochondrial OS=Homo sapiens OX=9606 GN=CKMT1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	62-UNIMOD:4	0.04	33.0	1	1	1
PRT	sp|Q7Z478|DHX29_HUMAN	ATP-dependent RNA helicase DHX29 OS=Homo sapiens OX=9606 GN=DHX29 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.01	33.0	1	1	1
PRT	sp|Q14694|UBP10_HUMAN	Ubiquitin carboxyl-terminal hydrolase 10 OS=Homo sapiens OX=9606 GN=USP10 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	2	1	0
PRT	sp|P46940|IQGA1_HUMAN	Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens OX=9606 GN=IQGAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.01	33.0	1	1	1
PRT	sp|Q12906-5|ILF3_HUMAN	Isoform 5 of Interleukin enhancer-binding factor 3 OS=Homo sapiens OX=9606 GN=ILF3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	526-UNIMOD:188,535-UNIMOD:188	0.07	33.0	5	3	1
PRT	sp|O00244|ATOX1_HUMAN	Copper transport protein ATOX1 OS=Homo sapiens OX=9606 GN=ATOX1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	3-UNIMOD:188,12-UNIMOD:4,15-UNIMOD:4,21-UNIMOD:267	0.31	33.0	2	1	0
PRT	sp|P33897|ABCD1_HUMAN	ATP-binding cassette sub-family D member 1 OS=Homo sapiens OX=9606 GN=ABCD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	717-UNIMOD:4	0.05	33.0	1	1	1
PRT	sp|O60506-4|HNRPQ_HUMAN	Isoform 4 of Heterogeneous nuclear ribonucleoprotein Q OS=Homo sapiens OX=9606 GN=SYNCRIP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	237-UNIMOD:4	0.03	33.0	1	1	0
PRT	sp|Q9UPT5-2|EXOC7_HUMAN	Isoform 2 of Exocyst complex component 7 OS=Homo sapiens OX=9606 GN=EXOC7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	1	1	1
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	32-UNIMOD:188,494-UNIMOD:35,495-UNIMOD:267	0.03	33.0	7	2	0
PRT	sp|Q9BST9-3|RTKN_HUMAN	Isoform 3 of Rhotekin OS=Homo sapiens OX=9606 GN=RTKN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	247-UNIMOD:4,248-UNIMOD:4,249-UNIMOD:267	0.05	33.0	3	1	0
PRT	sp|Q14690|RRP5_HUMAN	Protein RRP5 homolog OS=Homo sapiens OX=9606 GN=PDCD11 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.01	33.0	2	1	0
PRT	sp|P61964|WDR5_HUMAN	WD repeat-containing protein 5 OS=Homo sapiens OX=9606 GN=WDR5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	181-UNIMOD:267	0.05	33.0	2	1	0
PRT	sp|P21333-2|FLNA_HUMAN	Isoform 2 of Filamin-A OS=Homo sapiens OX=9606 GN=FLNA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	1372-UNIMOD:188,1375-UNIMOD:188,2065-UNIMOD:267,2325-UNIMOD:267,2326-UNIMOD:267,444-UNIMOD:4,467-UNIMOD:267,2409-UNIMOD:188	0.05	33.0	7	6	5
PRT	sp|P35813-2|PPM1A_HUMAN	Isoform Alpha-2 of Protein phosphatase 1A OS=Homo sapiens OX=9606 GN=PPM1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	71-UNIMOD:4,72-UNIMOD:4	0.09	33.0	2	1	0
PRT	sp|P45974-2|UBP5_HUMAN	Isoform Short of Ubiquitin carboxyl-terminal hydrolase 5 OS=Homo sapiens OX=9606 GN=USP5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	1	1	1
PRT	sp|P61158|ARP3_HUMAN	Actin-related protein 3 OS=Homo sapiens OX=9606 GN=ACTR3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	102-UNIMOD:267,123-UNIMOD:267	0.06	33.0	2	1	0
PRT	sp|Q96F86|EDC3_HUMAN	Enhancer of mRNA-decapping protein 3 OS=Homo sapiens OX=9606 GN=EDC3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	1	1	1
PRT	sp|Q15029|U5S1_HUMAN	116 kDa U5 small nuclear ribonucleoprotein component OS=Homo sapiens OX=9606 GN=EFTUD2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	33.0	null	543-UNIMOD:267,561-UNIMOD:188	0.04	33.0	3	2	1
PRT	sp|P62736|ACTA_HUMAN	Actin, aortic smooth muscle OS=Homo sapiens OX=9606 GN=ACTA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	70-UNIMOD:188,86-UNIMOD:188	0.06	33.0	2	1	0
PRT	sp|P49748|ACADV_HUMAN	Very long-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ACADVL PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null		0.03	33.0	1	1	1
PRT	sp|O95831-6|AIFM1_HUMAN	Isoform 6 of Apoptosis-inducing factor 1, mitochondrial OS=Homo sapiens OX=9606 GN=AIFM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	61-UNIMOD:267	0.09	32.0	2	1	0
PRT	sp|Q13620-3|CUL4B_HUMAN	Isoform 3 of Cullin-4B OS=Homo sapiens OX=9606 GN=CUL4B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	80-UNIMOD:267,91-UNIMOD:188	0.03	32.0	3	1	0
PRT	sp|Q15404-2|RSU1_HUMAN	Isoform 2 of Ras suppressor protein 1 OS=Homo sapiens OX=9606 GN=RSU1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.08	32.0	1	1	1
PRT	sp|P00367-2|DHE3_HUMAN	Isoform 2 of Glutamate dehydrogenase 1, mitochondrial OS=Homo sapiens OX=9606 GN=GLUD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	185-UNIMOD:188,196-UNIMOD:188	0.05	32.0	3	1	0
PRT	sp|P62633-7|CNBP_HUMAN	Isoform 7 of Cellular nucleic acid-binding protein OS=Homo sapiens OX=9606 GN=CNBP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	80-UNIMOD:4,81-UNIMOD:4,84-UNIMOD:4	0.10	32.0	1	1	1
PRT	sp|P14735|IDE_HUMAN	Insulin-degrading enzyme OS=Homo sapiens OX=9606 GN=IDE PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|P35579|MYH9_HUMAN	Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	1028-UNIMOD:35,1923-UNIMOD:267,1932-UNIMOD:267	0.04	32.0	7	4	2
PRT	sp|P12081-4|HARS1_HUMAN	Isoform 4 of Histidine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=HARS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	1	1	1
PRT	sp|Q12873-2|CHD3_HUMAN	Isoform 2 of Chromodomain-helicase-DNA-binding protein 3 OS=Homo sapiens OX=9606 GN=CHD3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	1335-UNIMOD:267	0.01	32.0	2	1	0
PRT	sp|Q15758-3|AAAT_HUMAN	Isoform 3 of Neutral amino acid transporter B(0) OS=Homo sapiens OX=9606 GN=SLC1A5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.05	32.0	1	1	0
PRT	sp|Q7L5Y9-3|MAEA_HUMAN	Isoform 3 of E3 ubiquitin-protein transferase MAEA OS=Homo sapiens OX=9606 GN=MAEA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.05	32.0	2	1	0
PRT	sp|P82933|RT09_HUMAN	28S ribosomal protein S9, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS9 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	330-UNIMOD:4,325-UNIMOD:188,337-UNIMOD:267	0.04	32.0	2	1	0
PRT	sp|Q96RN5-3|MED15_HUMAN	Isoform 3 of Mediator of RNA polymerase II transcription subunit 15 OS=Homo sapiens OX=9606 GN=MED15	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	169-UNIMOD:267	0.03	32.0	3	1	0
PRT	sp|Q9Y266|NUDC_HUMAN	Nuclear migration protein nudC OS=Homo sapiens OX=9606 GN=NUDC PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	68-UNIMOD:188	0.05	32.0	2	1	0
PRT	sp|Q14444-2|CAPR1_HUMAN	Isoform 2 of Caprin-1 OS=Homo sapiens OX=9606 GN=CAPRIN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	2	1	0
PRT	sp|O43795-2|MYO1B_HUMAN	Isoform 2 of Unconventional myosin-Ib OS=Homo sapiens OX=9606 GN=MYO1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	483-UNIMOD:4,492-UNIMOD:267	0.01	32.0	2	1	0
PRT	sp|Q9UM00-1|TMCO1_HUMAN	Isoform 3 of Calcium load-activated calcium channel OS=Homo sapiens OX=9606 GN=TMCO1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	131-UNIMOD:267	0.09	32.0	2	1	0
PRT	sp|Q9NZ01-2|TECR_HUMAN	Isoform 2 of Very-long-chain enoyl-CoA reductase OS=Homo sapiens OX=9606 GN=TECR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	1-UNIMOD:35,2-UNIMOD:188,12-UNIMOD:188	0.08	32.0	3	1	0
PRT	sp|Q9UNS2-2|CSN3_HUMAN	Isoform 2 of COP9 signalosome complex subunit 3 OS=Homo sapiens OX=9606 GN=COPS3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|Q16630-3|CPSF6_HUMAN	Isoform 3 of Cleavage and polyadenylation specificity factor subunit 6 OS=Homo sapiens OX=9606 GN=CPSF6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	159-UNIMOD:4	0.03	32.0	2	1	0
PRT	sp|P98196|AT11A_HUMAN	Probable phospholipid-transporting ATPase IH OS=Homo sapiens OX=9606 GN=ATP11A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.01	32.0	2	1	0
PRT	sp|Q15233-2|NONO_HUMAN	Isoform 2 of Non-POU domain-containing octamer-binding protein OS=Homo sapiens OX=9606 GN=NONO	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|P09960-3|LKHA4_HUMAN	Isoform 3 of Leukotriene A-4 hydrolase OS=Homo sapiens OX=9606 GN=LTA4H	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	286-UNIMOD:188	0.05	32.0	4	1	0
PRT	sp|P51858-2|HDGF_HUMAN	Isoform 2 of Hepatoma-derived growth factor OS=Homo sapiens OX=9606 GN=HDGF	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	37-UNIMOD:188,54-UNIMOD:188	0.10	32.0	3	1	0
PRT	sp|P15311|EZRI_HUMAN	Ezrin OS=Homo sapiens OX=9606 GN=EZR PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	558-UNIMOD:35,559-UNIMOD:267	0.02	32.0	5	1	0
PRT	sp|O00232-2|PSD12_HUMAN	Isoform 2 of 26S proteasome non-ATPase regulatory subunit 12 OS=Homo sapiens OX=9606 GN=PSMD12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	428-UNIMOD:188	0.04	32.0	2	1	0
PRT	sp|O60749-2|SNX2_HUMAN	Isoform 2 of Sorting nexin-2 OS=Homo sapiens OX=9606 GN=SNX2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	1	1	1
PRT	sp|P15170-2|ERF3A_HUMAN	Isoform 2 of Eukaryotic peptide chain release factor GTP-binding subunit ERF3A OS=Homo sapiens OX=9606 GN=GSPT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	null	68-UNIMOD:28,74-UNIMOD:188,91-UNIMOD:267	0.04	32.0	2	1	0
PRT	sp|Q9NYF8|BCLF1_HUMAN	Bcl-2-associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	852-UNIMOD:267,861-UNIMOD:188	0.02	32.0	1	1	0
PRT	sp|P23246|SFPQ_HUMAN	Splicing factor, proline- and glutamine-rich OS=Homo sapiens OX=9606 GN=SFPQ PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	548-UNIMOD:267,559-UNIMOD:188	0.02	32.0	3	1	0
PRT	sp|Q6RFH5|WDR74_HUMAN	WD repeat-containing protein 74 OS=Homo sapiens OX=9606 GN=WDR74 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	277-UNIMOD:4,287-UNIMOD:4	0.05	32.0	1	1	0
PRT	sp|Q6FI81|CPIN1_HUMAN	Anamorsin OS=Homo sapiens OX=9606 GN=CIAPIN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	162-UNIMOD:188	0.06	32.0	1	1	0
PRT	sp|Q8WVC6|DCAKD_HUMAN	Dephospho-CoA kinase domain-containing protein OS=Homo sapiens OX=9606 GN=DCAKD PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null		0.06	32.0	1	1	1
PRT	sp|Q12955|ANK3_HUMAN	Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null		0.01	32.0	1	1	1
PRT	sp|Q9H6Y2|WDR55_HUMAN	WD repeat-containing protein 55 OS=Homo sapiens OX=9606 GN=WDR55 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	120-UNIMOD:267,121-UNIMOD:267	0.04	31.0	1	1	1
PRT	sp|Q9UL46|PSME2_HUMAN	Proteasome activator complex subunit 2 OS=Homo sapiens OX=9606 GN=PSME2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	194-UNIMOD:267,203-UNIMOD:267	0.07	31.0	4	1	0
PRT	sp|Q12849-5|GRSF1_HUMAN	Isoform 2 of G-rich sequence factor 1 OS=Homo sapiens OX=9606 GN=GRSF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.08	31.0	1	1	1
PRT	sp|Q14683|SMC1A_HUMAN	Structural maintenance of chromosomes protein 1A OS=Homo sapiens OX=9606 GN=SMC1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	637-UNIMOD:188,648-UNIMOD:188	0.02	31.0	3	2	1
PRT	sp|Q7L9B9|EEPD1_HUMAN	Endonuclease/exonuclease/phosphatase family domain-containing protein 1 OS=Homo sapiens OX=9606 GN=EEPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.04	31.0	2	1	0
PRT	sp|Q15276|RABE1_HUMAN	Rab GTPase-binding effector protein 1 OS=Homo sapiens OX=9606 GN=RABEP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	263-UNIMOD:4,270-UNIMOD:267	0.02	31.0	2	1	0
PRT	sp|P62191|PRS4_HUMAN	26S proteasome regulatory subunit 4 OS=Homo sapiens OX=9606 GN=PSMC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	58-UNIMOD:4	0.04	31.0	2	1	0
PRT	sp|Q8N6M0-2|OTU6B_HUMAN	Isoform 2 of Deubiquitinase OTUD6B OS=Homo sapiens OX=9606 GN=OTUD6B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.08	31.0	2	1	0
PRT	sp|P35237|SPB6_HUMAN	Serpin B6 OS=Homo sapiens OX=9606 GN=SERPINB6 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	141-UNIMOD:188,145-UNIMOD:188	0.04	31.0	2	1	0
PRT	sp|P40222|TXLNA_HUMAN	Alpha-taxilin OS=Homo sapiens OX=9606 GN=TXLNA PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	330-UNIMOD:188,340-UNIMOD:188	0.02	31.0	2	1	0
PRT	sp|O00487|PSDE_HUMAN	26S proteasome non-ATPase regulatory subunit 14 OS=Homo sapiens OX=9606 GN=PSMD14 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null	246-UNIMOD:188,253-UNIMOD:188	0.05	31.0	2	1	0
PRT	sp|P40939|ECHA_HUMAN	Trifunctional enzyme subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=HADHA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	605-UNIMOD:188,610-UNIMOD:267	0.02	31.0	3	1	0
PRT	sp|P09001|RM03_HUMAN	39S ribosomal protein L3, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	127-UNIMOD:4,131-UNIMOD:188	0.05	31.0	3	1	0
PRT	sp|P62136-3|PP1A_HUMAN	Isoform 3 of Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Homo sapiens OX=9606 GN=PPP1CA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	127-UNIMOD:4,128-UNIMOD:4	0.07	31.0	2	1	0
PRT	sp|Q96CB9-4|NSUN4_HUMAN	Isoform 4 of 5-methylcytosine rRNA methyltransferase NSUN4 OS=Homo sapiens OX=9606 GN=NSUN4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.05	31.0	1	1	1
PRT	sp|P62081|RS7_HUMAN	40S ribosomal protein S7 OS=Homo sapiens OX=9606 GN=RPS7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.20	31.0	2	2	2
PRT	sp|P30419-2|NMT1_HUMAN	Isoform Short of Glycylpeptide N-tetradecanoyltransferase 1 OS=Homo sapiens OX=9606 GN=NMT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.05	31.0	1	1	1
PRT	sp|P04844-2|RPN2_HUMAN	Isoform 2 of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Homo sapiens OX=9606 GN=RPN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.04	31.0	1	1	1
PRT	sp|Q68CZ2-2|TENS3_HUMAN	Isoform 2 of Tensin-3 OS=Homo sapiens OX=9606 GN=TNS3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	1175-UNIMOD:4,1141-UNIMOD:4,1011-UNIMOD:4,1025-UNIMOD:4,1036-UNIMOD:4	0.07	31.0	3	3	3
PRT	sp|Q12846-2|STX4_HUMAN	Isoform 2 of Syntaxin-4 OS=Homo sapiens OX=9606 GN=STX4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	122-UNIMOD:188,138-UNIMOD:188	0.06	31.0	2	1	0
PRT	sp|O14744-4|ANM5_HUMAN	Isoform 4 of Protein arginine N-methyltransferase 5 OS=Homo sapiens OX=9606 GN=PRMT5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	451-UNIMOD:4	0.05	31.0	1	1	1
PRT	sp|P35573-2|GDE_HUMAN	Isoform 5 of Glycogen debranching enzyme OS=Homo sapiens OX=9606 GN=AGL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	511-UNIMOD:4,731-UNIMOD:267,527-UNIMOD:267	0.02	31.0	4	2	1
PRT	sp|P46781|RS9_HUMAN	40S ribosomal protein S9 OS=Homo sapiens OX=9606 GN=RPS9 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.07	31.0	1	1	1
PRT	sp|O43670-3|ZN207_HUMAN	Isoform 3 of BUB3-interacting and GLEBS motif-containing protein ZNF207 OS=Homo sapiens OX=9606 GN=ZNF207	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	292-UNIMOD:267,293-UNIMOD:267	0.04	31.0	2	1	0
PRT	sp|Q9UBT2-2|SAE2_HUMAN	Isoform 2 of SUMO-activating enzyme subunit 2 OS=Homo sapiens OX=9606 GN=UBA2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	362-UNIMOD:188,371-UNIMOD:188	0.03	31.0	4	1	0
PRT	sp|Q92499|DDX1_HUMAN	ATP-dependent RNA helicase DDX1 OS=Homo sapiens OX=9606 GN=DDX1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	387-UNIMOD:35	0.02	31.0	1	1	1
PRT	sp|P05783|K1C18_HUMAN	Keratin, type I cytoskeletal 18 OS=Homo sapiens OX=9606 GN=KRT18 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	222-UNIMOD:188,241-UNIMOD:188	0.09	31.0	2	2	2
PRT	sp|Q13630|FCL_HUMAN	GDP-L-fucose synthase OS=Homo sapiens OX=9606 GN=TSTA3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null	107-UNIMOD:267	0.06	31.0	2	1	0
PRT	sp|Q08945|SSRP1_HUMAN	FACT complex subunit SSRP1 OS=Homo sapiens OX=9606 GN=SSRP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	549-UNIMOD:267,562-UNIMOD:267,340-UNIMOD:4,343-UNIMOD:4	0.05	31.0	2	2	2
PRT	sp|Q9BQC3-2|DPH2_HUMAN	Isoform 2 of 2-(3-amino-3-carboxypropyl)histidine synthase subunit 2 OS=Homo sapiens OX=9606 GN=DPH2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.12	31.0	1	1	1
PRT	sp|P30044-2|PRDX5_HUMAN	Isoform Cytoplasmic+peroxisomal of Peroxiredoxin-5, mitochondrial OS=Homo sapiens OX=9606 GN=PRDX5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	64-UNIMOD:188,66-UNIMOD:188	0.10	31.0	3	1	0
PRT	sp|O14979-3|HNRDL_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein D-like OS=Homo sapiens OX=9606 GN=HNRNPDL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	183-UNIMOD:188,184-UNIMOD:4,187-UNIMOD:188	0.05	31.0	1	1	0
PRT	sp|O95822|DCMC_HUMAN	Malonyl-CoA decarboxylase, mitochondrial OS=Homo sapiens OX=9606 GN=MLYCD PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.04	31.0	1	1	1
PRT	sp|O95425|SVIL_HUMAN	Supervillin OS=Homo sapiens OX=9606 GN=SVIL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	26-UNIMOD:4	0.01	31.0	1	1	1
PRT	sp|P17987|TCPA_HUMAN	T-complex protein 1 subunit alpha OS=Homo sapiens OX=9606 GN=TCP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	397-UNIMOD:4	0.05	30.0	2	2	2
PRT	sp|P43487-2|RANG_HUMAN	Isoform 2 of Ran-specific GTPase-activating protein OS=Homo sapiens OX=9606 GN=RANBP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	132-UNIMOD:4	0.12	30.0	1	1	1
PRT	sp|Q6ZNB6-2|NFXL1_HUMAN	Isoform 2 of NF-X1-type zinc finger protein NFXL1 OS=Homo sapiens OX=9606 GN=NFXL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	589-UNIMOD:4,593-UNIMOD:4,597-UNIMOD:4	0.02	30.0	1	1	1
PRT	sp|O75643|U520_HUMAN	U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens OX=9606 GN=SNRNP200 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	1592-UNIMOD:4,1595-UNIMOD:188,1603-UNIMOD:188	0.01	30.0	1	1	1
PRT	sp|Q9UKX7-2|NUP50_HUMAN	Isoform 2 of Nuclear pore complex protein Nup50 OS=Homo sapiens OX=9606 GN=NUP50	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	356-UNIMOD:188,362-UNIMOD:188	0.03	30.0	2	1	0
PRT	sp|Q08211|DHX9_HUMAN	ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	516-UNIMOD:267	0.04	30.0	7	3	2
PRT	sp|O43707|ACTN4_HUMAN	Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	633-UNIMOD:267,643-UNIMOD:188	0.03	30.0	3	2	1
PRT	sp|O14617-3|AP3D1_HUMAN	Isoform 3 of AP-3 complex subunit delta-1 OS=Homo sapiens OX=9606 GN=AP3D1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	487-UNIMOD:267,498-UNIMOD:267	0.01	30.0	4	1	0
PRT	sp|P09543-2|CN37_HUMAN	Isoform CNPI of 2',3'-cyclic-nucleotide 3'-phosphodiesterase OS=Homo sapiens OX=9606 GN=CNP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	184-UNIMOD:188,197-UNIMOD:188	0.04	30.0	3	1	0
PRT	sp|P23919-2|KTHY_HUMAN	Isoform 2 of Thymidylate kinase OS=Homo sapiens OX=9606 GN=DTYMK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	31-UNIMOD:4	0.07	30.0	1	1	1
PRT	sp|Q16881-7|TRXR1_HUMAN	Isoform 7 of Thioredoxin reductase 1, cytoplasmic OS=Homo sapiens OX=9606 GN=TXNRD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.04	30.0	1	1	1
PRT	sp|Q14203-5|DCTN1_HUMAN	Isoform 5 of Dynactin subunit 1 OS=Homo sapiens OX=9606 GN=DCTN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	976-UNIMOD:188	0.01	30.0	2	1	0
PRT	sp|P51665|PSMD7_HUMAN	26S proteasome non-ATPase regulatory subunit 7 OS=Homo sapiens OX=9606 GN=PSMD7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	103-UNIMOD:188,113-UNIMOD:188	0.04	30.0	2	1	0
PRT	sp|Q15369-2|ELOC_HUMAN	Isoform 2 of Elongin-C OS=Homo sapiens OX=9606 GN=ELOC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.15	30.0	1	1	1
PRT	sp|P29144|TPP2_HUMAN	Tripeptidyl-peptidase 2 OS=Homo sapiens OX=9606 GN=TPP2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	983-UNIMOD:188,999-UNIMOD:188,893-UNIMOD:267,902-UNIMOD:267	0.03	30.0	6	3	1
PRT	sp|Q9NWY4|HPF1_HUMAN	Histone PARylation factor 1 OS=Homo sapiens OX=9606 GN=HPF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	336-UNIMOD:267	0.04	30.0	2	1	0
PRT	sp|Q8WVV4-1|POF1B_HUMAN	Isoform 1 of Protein POF1B OS=Homo sapiens OX=9606 GN=POF1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	274-UNIMOD:4	0.06	30.0	2	2	2
PRT	sp|Q96HE7|ERO1A_HUMAN	ERO1-like protein alpha OS=Homo sapiens OX=9606 GN=ERO1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	368-UNIMOD:188,369-UNIMOD:188	0.04	30.0	2	1	0
PRT	sp|P49711-2|CTCF_HUMAN	Isoform 2 of Transcriptional repressor CTCF OS=Homo sapiens OX=9606 GN=CTCF	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	53-UNIMOD:4,56-UNIMOD:4	0.05	30.0	2	1	0
PRT	sp|O75874|IDHC_HUMAN	Isocitrate dehydrogenase [NADP] cytoplasmic OS=Homo sapiens OX=9606 GN=IDH1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	2	1	0
PRT	sp|Q15084-3|PDIA6_HUMAN	Isoform 3 of Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 GN=PDIA6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	288-UNIMOD:4,294-UNIMOD:4,310-UNIMOD:267	0.06	30.0	3	1	0
PRT	sp|P30740|ILEU_HUMAN	Leukocyte elastase inhibitor OS=Homo sapiens OX=9606 GN=SERPINB1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	30.0	null	69-UNIMOD:267	0.04	30.0	3	1	0
PRT	sp|Q9Y2D5|AKAP2_HUMAN	A-kinase anchor protein 2 OS=Homo sapiens OX=9606 GN=AKAP2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	263-UNIMOD:188,264-UNIMOD:188	0.02	30.0	1	1	1
PRT	sp|Q92979|NEP1_HUMAN	Ribosomal RNA small subunit methyltransferase NEP1 OS=Homo sapiens OX=9606 GN=EMG1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	160-UNIMOD:188,171-UNIMOD:4,173-UNIMOD:188	0.07	30.0	1	1	1
PRT	sp|Q15024|EXOS7_HUMAN	Exosome complex component RRP42 OS=Homo sapiens OX=9606 GN=EXOSC7 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	52-UNIMOD:188,63-UNIMOD:188	0.05	30.0	2	1	0
PRT	sp|Q8NFH4|NUP37_HUMAN	Nucleoporin Nup37 OS=Homo sapiens OX=9606 GN=NUP37 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	149-UNIMOD:4	0.10	30.0	1	1	1
PRT	sp|P51991-2|ROA3_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens OX=9606 GN=HNRNPA3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	174-UNIMOD:4,177-UNIMOD:188	0.04	30.0	2	1	0
PRT	sp|P68104|EF1A1_HUMAN	Elongation factor 1-alpha 1 OS=Homo sapiens OX=9606 GN=EEF1A1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	20-UNIMOD:188	0.03	30.0	4	1	0
PRT	sp|P36776|LONM_HUMAN	Lon protease homolog, mitochondrial OS=Homo sapiens OX=9606 GN=LONP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	559-UNIMOD:188,562-UNIMOD:267	0.02	30.0	1	1	1
PRT	sp|Q12931|TRAP1_HUMAN	Heat shock protein 75 kDa, mitochondrial OS=Homo sapiens OX=9606 GN=TRAP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	518-UNIMOD:188	0.02	30.0	1	1	1
PRT	sp|O75717|WDHD1_HUMAN	WD repeat and HMG-box DNA-binding protein 1 OS=Homo sapiens OX=9606 GN=WDHD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|O60306|AQR_HUMAN	RNA helicase aquarius OS=Homo sapiens OX=9606 GN=AQR PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	30.0	null	797-UNIMOD:267,811-UNIMOD:267	0.01	30.0	3	1	0
PRT	sp|O60784-3|TOM1_HUMAN	Isoform 3 of Target of Myb protein 1 OS=Homo sapiens OX=9606 GN=TOM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.06	29.0	2	1	0
PRT	sp|Q92804-2|RBP56_HUMAN	Isoform Short of TATA-binding protein-associated factor 2N OS=Homo sapiens OX=9606 GN=TAF15	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	1	1	1
PRT	sp|Q15019|SEPT2_HUMAN	Septin-2 OS=Homo sapiens OX=9606 GN=SEPTIN2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	174-UNIMOD:188,183-UNIMOD:188	0.10	29.0	3	2	1
PRT	sp|Q93009-3|UBP7_HUMAN	Isoform 3 of Ubiquitin carboxyl-terminal hydrolase 7 OS=Homo sapiens OX=9606 GN=USP7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	472-UNIMOD:4	0.02	29.0	2	1	0
PRT	sp|Q14134-2|TRI29_HUMAN	Isoform Beta of Tripartite motif-containing protein 29 OS=Homo sapiens OX=9606 GN=TRIM29	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	218-UNIMOD:267,223-UNIMOD:267	0.03	29.0	1	1	1
PRT	sp|P05455|LA_HUMAN	Lupus La protein OS=Homo sapiens OX=9606 GN=SSB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.05	29.0	1	1	1
PRT	sp|Q8N766-4|EMC1_HUMAN	Isoform 4 of ER membrane protein complex subunit 1 OS=Homo sapiens OX=9606 GN=EMC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	853-UNIMOD:188	0.02	29.0	2	1	0
PRT	sp|Q9BSD7|NTPCR_HUMAN	Cancer-related nucleoside-triphosphatase OS=Homo sapiens OX=9606 GN=NTPCR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	15-UNIMOD:188	0.07	29.0	1	1	1
PRT	sp|Q92664-2|TF3A_HUMAN	Isoform 2 of Transcription factor IIIA OS=Homo sapiens OX=9606 GN=GTF3A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	154-UNIMOD:4	0.04	29.0	1	1	1
PRT	sp|P46736-4|BRCC3_HUMAN	Isoform 4 of Lys-63-specific deubiquitinase BRCC36 OS=Homo sapiens OX=9606 GN=BRCC3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	147-UNIMOD:188	0.06	29.0	2	1	0
PRT	sp|Q8IYB8|SUV3_HUMAN	ATP-dependent RNA helicase SUPV3L1, mitochondrial OS=Homo sapiens OX=9606 GN=SUPV3L1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|Q969G9|NKD1_HUMAN	Protein naked cuticle homolog 1 OS=Homo sapiens OX=9606 GN=NKD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.04	29.0	2	1	0
PRT	sp|Q9Y2R5|RT17_HUMAN	28S ribosomal protein S17, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS17 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	58-UNIMOD:4	0.17	29.0	2	1	0
PRT	sp|Q9NTJ3-2|SMC4_HUMAN	Isoform 2 of Structural maintenance of chromosomes protein 4 OS=Homo sapiens OX=9606 GN=SMC4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	898-UNIMOD:188	0.01	29.0	1	1	1
PRT	sp|Q8WVM8-2|SCFD1_HUMAN	Isoform 2 of Sec1 family domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SCFD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	1	1	1
PRT	sp|Q15785|TOM34_HUMAN	Mitochondrial import receptor subunit TOM34 OS=Homo sapiens OX=9606 GN=TOMM34 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.05	29.0	1	1	1
PRT	sp|Q9Y3A2-2|UTP11_HUMAN	Isoform 2 of Probable U3 small nucleolar RNA-associated protein 11 OS=Homo sapiens OX=9606 GN=UTP11	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	120-UNIMOD:188,131-UNIMOD:188	0.09	29.0	2	1	0
PRT	sp|P62424|RL7A_HUMAN	60S ribosomal protein L7a OS=Homo sapiens OX=9606 GN=RPL7A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.06	29.0	1	1	1
PRT	sp|P49756-2|RBM25_HUMAN	Isoform 2 of RNA-binding protein 25 OS=Homo sapiens OX=9606 GN=RBM25	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	155-UNIMOD:188,156-UNIMOD:188	0.04	29.0	2	1	0
PRT	sp|P53597|SUCA_HUMAN	Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=SUCLG1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.07	29.0	2	1	0
PRT	sp|Q03252|LMNB2_HUMAN	Lamin-B2 OS=Homo sapiens OX=9606 GN=LMNB2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	1	1	1
PRT	sp|Q9BUF5|TBB6_HUMAN	Tubulin beta-6 chain OS=Homo sapiens OX=9606 GN=TUBB6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	1-UNIMOD:35,2-UNIMOD:267,12-UNIMOD:4,19-UNIMOD:188	0.04	29.0	1	1	1
PRT	sp|O43148|MCES_HUMAN	mRNA cap guanine-N7 methyltransferase OS=Homo sapiens OX=9606 GN=RNMT PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.05	29.0	1	1	1
PRT	sp|Q14194|DPYL1_HUMAN	Dihydropyrimidinase-related protein 1 OS=Homo sapiens OX=9606 GN=CRMP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.04	29.0	1	1	1
PRT	sp|Q9UJU6-5|DBNL_HUMAN	Isoform 5 of Drebrin-like protein OS=Homo sapiens OX=9606 GN=DBNL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	145-UNIMOD:267,155-UNIMOD:267	0.04	29.0	2	1	0
PRT	sp|Q9UMS4|PRP19_HUMAN	Pre-mRNA-processing factor 19 OS=Homo sapiens OX=9606 GN=PRPF19 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	29.0	null	230-UNIMOD:4,209-UNIMOD:28	0.06	29.0	2	1	0
PRT	sp|Q9BTE6|AASD1_HUMAN	Alanyl-tRNA editing protein Aarsd1 OS=Homo sapiens OX=9606 GN=AARSD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.06	29.0	2	1	0
PRT	sp|Q9UK59|DBR1_HUMAN	Lariat debranching enzyme OS=Homo sapiens OX=9606 GN=DBR1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	36-UNIMOD:4,37-UNIMOD:4,26-UNIMOD:267,44-UNIMOD:267	0.04	29.0	2	1	0
PRT	sp|Q9BTZ2-3|DHRS4_HUMAN	Isoform 3 of Dehydrogenase/reductase SDR family member 4 OS=Homo sapiens OX=9606 GN=DHRS4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	51-UNIMOD:267,64-UNIMOD:267	0.09	29.0	2	1	0
PRT	sp|Q96SY0-4|INT14_HUMAN	Isoform 4 of Integrator complex subunit 14 OS=Homo sapiens OX=9606 GN=INTS14	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.04	29.0	1	1	1
PRT	sp|P00167-2|CYB5_HUMAN	Isoform 2 of Cytochrome b5 OS=Homo sapiens OX=9606 GN=CYB5A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.51	29.0	2	2	2
PRT	sp|P13796|PLSL_HUMAN	Plastin-2 OS=Homo sapiens OX=9606 GN=LCP1 PE=1 SV=6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	2	1	0
PRT	sp|P42704|LPPRC_HUMAN	Leucine-rich PPR motif-containing protein, mitochondrial OS=Homo sapiens OX=9606 GN=LRPPRC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	2	2	2
PRT	sp|Q15417-3|CNN3_HUMAN	Isoform 3 of Calponin-3 OS=Homo sapiens OX=9606 GN=CNN3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.05	29.0	1	1	1
PRT	sp|Q9UHA4|LTOR3_HUMAN	Ragulator complex protein LAMTOR3 OS=Homo sapiens OX=9606 GN=LAMTOR3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	46-UNIMOD:267,62-UNIMOD:188	0.23	29.0	2	1	0
PRT	sp|P62805|H4_HUMAN	Histone H4 OS=Homo sapiens OX=9606 GN=H4C1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.22	29.0	4	2	0
PRT	sp|P09651-3|ROA1_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	175-UNIMOD:4,178-UNIMOD:267	0.12	29.0	4	2	0
PRT	sp|Q9H0A0-2|NAT10_HUMAN	Isoform 2 of RNA cytidine acetyltransferase OS=Homo sapiens OX=9606 GN=NAT10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	100-UNIMOD:267,110-UNIMOD:267	0.01	29.0	2	1	0
PRT	sp|Q15185|TEBP_HUMAN	Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	58-UNIMOD:4,65-UNIMOD:188	0.11	29.0	1	1	0
PRT	sp|Q15084|PDIA6_HUMAN	Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 GN=PDIA6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	291-UNIMOD:4,297-UNIMOD:4,313-UNIMOD:267	0.06	29.0	1	1	0
PRT	sp|O43395|PRPF3_HUMAN	U4/U6 small nuclear ribonucleoprotein Prp3 OS=Homo sapiens OX=9606 GN=PRPF3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	52-UNIMOD:188,61-UNIMOD:267	0.02	29.0	3	1	0
PRT	sp|O75844|FACE1_HUMAN	CAAX prenyl protease 1 homolog OS=Homo sapiens OX=9606 GN=ZMPSTE24 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	null	322-UNIMOD:28,324-UNIMOD:4,325-UNIMOD:188,341-UNIMOD:188	0.04	29.0	2	1	0
PRT	sp|P22626|ROA2_HUMAN	Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	185-UNIMOD:267	0.04	29.0	3	1	0
PRT	sp|P08559-3|ODPA_HUMAN	Isoform 3 of Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial OS=Homo sapiens OX=9606 GN=PDHA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	41-UNIMOD:4,45-UNIMOD:267,58-UNIMOD:267	0.05	28.0	1	1	0
PRT	sp|Q04912-7|RON_HUMAN	Isoform RON-5 of Macrophage-stimulating protein receptor OS=Homo sapiens OX=9606 GN=MST1R	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	1002-UNIMOD:267	0.01	28.0	1	1	1
PRT	sp|P63267|ACTH_HUMAN	Actin, gamma-enteric smooth muscle OS=Homo sapiens OX=9606 GN=ACTG2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	69-UNIMOD:188,83-UNIMOD:35,85-UNIMOD:188	0.06	28.0	3	1	0
PRT	sp|P07355-2|ANXA2_HUMAN	Isoform 2 of Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	151-UNIMOD:4,197-UNIMOD:267,214-UNIMOD:267,67-UNIMOD:188,81-UNIMOD:267	0.15	28.0	4	4	4
PRT	sp|Q96DM3|RMC1_HUMAN	Regulator of MON1-CCZ1 complex OS=Homo sapiens OX=9606 GN=RMC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	635-UNIMOD:4	0.03	28.0	1	1	1
PRT	sp|P07602|SAP_HUMAN	Prosaposin OS=Homo sapiens OX=9606 GN=PSAP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	48-UNIMOD:4,55-UNIMOD:188,59-UNIMOD:188	0.03	28.0	3	1	0
PRT	sp|O00267-2|SPT5H_HUMAN	Isoform 2 of Transcription elongation factor SPT5 OS=Homo sapiens OX=9606 GN=SUPT5H	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	809-UNIMOD:267	0.03	28.0	3	2	0
PRT	sp|A8MXV4|NUD19_HUMAN	Nucleoside diphosphate-linked moiety X motif 19 OS=Homo sapiens OX=9606 GN=NUDT19 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|P23284|PPIB_HUMAN	Peptidyl-prolyl cis-trans isomerase B OS=Homo sapiens OX=9606 GN=PPIB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	165-UNIMOD:188,171-UNIMOD:188	0.19	28.0	4	2	1
PRT	sp|P37837|TALDO_HUMAN	Transaldolase OS=Homo sapiens OX=9606 GN=TALDO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	203-UNIMOD:188,204-UNIMOD:188	0.04	28.0	2	1	0
PRT	sp|Q9HB07|MYG1_HUMAN	UPF0160 protein MYG1, mitochondrial OS=Homo sapiens OX=9606 GN=C12orf10 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	305-UNIMOD:4	0.04	28.0	2	1	0
PRT	sp|Q99714-2|HCD2_HUMAN	Isoform 2 of 3-hydroxyacyl-CoA dehydrogenase type-2 OS=Homo sapiens OX=9606 GN=HSD17B10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.05	28.0	1	1	1
PRT	sp|Q9P258|RCC2_HUMAN	Protein RCC2 OS=Homo sapiens OX=9606 GN=RCC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|P40925-2|MDHC_HUMAN	Isoform 2 of Malate dehydrogenase, cytoplasmic OS=Homo sapiens OX=9606 GN=MDH1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	90-UNIMOD:188,110-UNIMOD:188	0.12	28.0	3	1	0
PRT	sp|Q9H078-5|CLPB_HUMAN	Isoform 5 of Caseinolytic peptidase B protein homolog OS=Homo sapiens OX=9606 GN=CLPB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	143-UNIMOD:188,161-UNIMOD:267	0.04	28.0	1	1	1
PRT	sp|O00567|NOP56_HUMAN	Nucleolar protein 56 OS=Homo sapiens OX=9606 GN=NOP56 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	87-UNIMOD:188,88-UNIMOD:188	0.02	28.0	2	1	0
PRT	sp|O00273-2|DFFA_HUMAN	Isoform DFF35 of DNA fragmentation factor subunit alpha OS=Homo sapiens OX=9606 GN=DFFA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.06	28.0	1	1	1
PRT	sp|Q14247-3|SRC8_HUMAN	Isoform 3 of Src substrate cortactin OS=Homo sapiens OX=9606 GN=CTTN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|P46821|MAP1B_HUMAN	Microtubule-associated protein 1B OS=Homo sapiens OX=9606 GN=MAP1B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|Q92614-5|MY18A_HUMAN	Isoform 5 of Unconventional myosin-XVIIIa OS=Homo sapiens OX=9606 GN=MYO18A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	1004-UNIMOD:267,1018-UNIMOD:267	0.01	28.0	1	1	1
PRT	sp|Q5XXA6-3|ANO1_HUMAN	Isoform 3 of Anoctamin-1 OS=Homo sapiens OX=9606 GN=ANO1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	54-UNIMOD:267,65-UNIMOD:267	0.02	28.0	1	1	1
PRT	sp|Q9BV38|WDR18_HUMAN	WD repeat-containing protein 18 OS=Homo sapiens OX=9606 GN=WDR18 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|O43491-2|E41L2_HUMAN	Isoform 2 of Band 4.1-like protein 2 OS=Homo sapiens OX=9606 GN=EPB41L2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	601-UNIMOD:188,611-UNIMOD:188	0.02	28.0	1	1	1
PRT	sp|P13010|XRCC5_HUMAN	X-ray repair cross-complementing protein 5 OS=Homo sapiens OX=9606 GN=XRCC5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|Q9NYL9|TMOD3_HUMAN	Tropomodulin-3 OS=Homo sapiens OX=9606 GN=TMOD3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.05	28.0	1	1	1
PRT	sp|Q9GZT8|NIF3L_HUMAN	NIF3-like protein 1 OS=Homo sapiens OX=9606 GN=NIF3L1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.05	28.0	1	1	1
PRT	sp|Q99543|DNJC2_HUMAN	DnaJ homolog subfamily C member 2 OS=Homo sapiens OX=9606 GN=DNAJC2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|O60826|CCD22_HUMAN	Coiled-coil domain-containing protein 22 OS=Homo sapiens OX=9606 GN=CCDC22 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	215-UNIMOD:4,220-UNIMOD:267	0.03	28.0	1	1	1
PRT	sp|Q96DH6-3|MSI2H_HUMAN	Isoform 3 of RNA-binding protein Musashi homolog 2 OS=Homo sapiens OX=9606 GN=MSI2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	64-UNIMOD:4,74-UNIMOD:188	0.09	28.0	2	1	0
PRT	sp|Q9GZV4|IF5A2_HUMAN	Eukaryotic translation initiation factor 5A-2 OS=Homo sapiens OX=9606 GN=EIF5A2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	67-UNIMOD:188	0.08	28.0	1	1	1
PRT	sp|P04080|CYTB_HUMAN	Cystatin-B OS=Homo sapiens OX=9606 GN=CSTB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	68-UNIMOD:267	0.13	28.0	2	1	0
PRT	sp|Q99880|H2B1L_HUMAN	Histone H2B type 1-L OS=Homo sapiens OX=9606 GN=H2BC13 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	47-UNIMOD:188,58-UNIMOD:188	0.12	28.0	2	1	0
PRT	sp|P30085|KCY_HUMAN	UMP-CMP kinase OS=Homo sapiens OX=9606 GN=CMPK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null	39-UNIMOD:267,42-UNIMOD:267	0.09	28.0	3	1	0
PRT	sp|Q9Y383|LC7L2_HUMAN	Putative RNA-binding protein Luc7-like 2 OS=Homo sapiens OX=9606 GN=LUC7L2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	43-UNIMOD:4,44-UNIMOD:4,53-UNIMOD:267	0.04	28.0	1	1	0
PRT	sp|P34897|GLYM_HUMAN	Serine hydroxymethyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=SHMT2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null		0.04	28.0	1	1	0
PRT	sp|Q14847|LASP1_HUMAN	LIM and SH3 domain protein 1 OS=Homo sapiens OX=9606 GN=LASP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	28.0	null	20-UNIMOD:4	0.21	28.0	2	2	2
PRT	sp|P08559|ODPA_HUMAN	Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial OS=Homo sapiens OX=9606 GN=PDHA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	null	41-UNIMOD:385,41-UNIMOD:4,45-UNIMOD:267,58-UNIMOD:267	0.05	28.0	1	1	0
PRT	sp|Q9Y5M8|SRPRB_HUMAN	Signal recognition particle receptor subunit beta OS=Homo sapiens OX=9606 GN=SRPRB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	28.0	null		0.08	28.0	2	1	0
PRT	sp|Q8N1N4|K2C78_HUMAN	Keratin, type II cytoskeletal 78 OS=Homo sapiens OX=9606 GN=KRT78 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null		0.03	28.0	2	1	0
PRT	sp|Q9BQ04|RBM4B_HUMAN	RNA-binding protein 4B OS=Homo sapiens OX=9606 GN=RBM4B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	null	89-UNIMOD:4	0.05	28.0	2	1	0
PRT	sp|P26639|SYTC_HUMAN	Threonine--tRNA ligase 1, cytoplasmic OS=Homo sapiens OX=9606 GN=TARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	null	254-UNIMOD:385,254-UNIMOD:4,261-UNIMOD:4	0.02	28.0	1	1	1
PRT	sp|Q9BWF3|RBM4_HUMAN	RNA-binding protein 4 OS=Homo sapiens OX=9606 GN=RBM4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	89-UNIMOD:4	0.05	28.0	1	1	0
PRT	sp|Q8WTR7|ZN473_HUMAN	Zinc finger protein 473 OS=Homo sapiens OX=9606 GN=ZNF473 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	147-UNIMOD:4,148-UNIMOD:188	0.02	28.0	1	1	1
PRT	sp|O76031|CLPX_HUMAN	ATP-dependent Clp protease ATP-binding subunit clpX-like, mitochondrial OS=Homo sapiens OX=9606 GN=CLPX PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.04	27.0	1	1	1
PRT	sp|P50897-2|PPT1_HUMAN	Isoform 2 of Palmitoyl-protein thioesterase 1 OS=Homo sapiens OX=9606 GN=PPT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	49-UNIMOD:4,57-UNIMOD:4	0.07	27.0	1	1	1
PRT	sp|O60313-13|OPA1_HUMAN	Isoform 7 of Dynamin-like 120 kDa protein, mitochondrial OS=Homo sapiens OX=9606 GN=OPA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	912-UNIMOD:188,924-UNIMOD:188	0.02	27.0	1	1	1
PRT	sp|P17480-2|UBF1_HUMAN	Isoform UBF2 of Nucleolar transcription factor 1 OS=Homo sapiens OX=9606 GN=UBTF	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|Q9H9Y2|RPF1_HUMAN	Ribosome production factor 1 OS=Homo sapiens OX=9606 GN=RPF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.06	27.0	1	1	1
PRT	sp|Q9HC16|ABC3G_HUMAN	DNA dC->dU-editing enzyme APOBEC-3G OS=Homo sapiens OX=9606 GN=APOBEC3G PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	215-UNIMOD:267,221-UNIMOD:4,226-UNIMOD:267	0.04	27.0	1	1	1
PRT	sp|P28370-2|SMCA1_HUMAN	Isoform 2 of Probable global transcription activator SNF2L1 OS=Homo sapiens OX=9606 GN=SMARCA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	668-UNIMOD:188	0.01	27.0	2	1	0
PRT	sp|Q9Y5P6|GMPPB_HUMAN	Mannose-1-phosphate guanyltransferase beta OS=Homo sapiens OX=9606 GN=GMPPB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	137-UNIMOD:188	0.04	27.0	2	1	0
PRT	sp|P46977-2|STT3A_HUMAN	Isoform 2 of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A OS=Homo sapiens OX=9606 GN=STT3A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|P40227-2|TCPZ_HUMAN	Isoform 2 of T-complex protein 1 subunit zeta OS=Homo sapiens OX=9606 GN=CCT6A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|Q2M389|WASC4_HUMAN	WASH complex subunit 4 OS=Homo sapiens OX=9606 GN=WASHC4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|Q13206|DDX10_HUMAN	Probable ATP-dependent RNA helicase DDX10 OS=Homo sapiens OX=9606 GN=DDX10 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	649-UNIMOD:188,652-UNIMOD:188	0.01	27.0	2	1	0
PRT	sp|Q8TAT6|NPL4_HUMAN	Nuclear protein localization protein 4 homolog OS=Homo sapiens OX=9606 GN=NPLOC4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	236-UNIMOD:267	0.03	27.0	2	1	0
PRT	sp|Q96DA6-2|TIM14_HUMAN	Isoform 2 of Mitochondrial import inner membrane translocase subunit TIM14 OS=Homo sapiens OX=9606 GN=DNAJC19	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	68-UNIMOD:188,77-UNIMOD:188	0.21	27.0	1	1	1
PRT	sp|P55263-4|ADK_HUMAN	Isoform 4 of Adenosine kinase OS=Homo sapiens OX=9606 GN=ADK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	105-UNIMOD:4,108-UNIMOD:4	0.10	27.0	1	1	1
PRT	sp|P43246-2|MSH2_HUMAN	Isoform 2 of DNA mismatch repair protein Msh2 OS=Homo sapiens OX=9606 GN=MSH2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	753-UNIMOD:188,756-UNIMOD:4,772-UNIMOD:188	0.02	27.0	1	1	1
PRT	sp|O00764|PDXK_HUMAN	Pyridoxal kinase OS=Homo sapiens OX=9606 GN=PDXK PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	269-UNIMOD:267	0.07	27.0	3	2	1
PRT	sp|Q12905|ILF2_HUMAN	Interleukin enhancer-binding factor 2 OS=Homo sapiens OX=9606 GN=ILF2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	186-UNIMOD:188,196-UNIMOD:188	0.03	27.0	2	1	0
PRT	sp|Q14697|GANAB_HUMAN	Neutral alpha-glucosidase AB OS=Homo sapiens OX=9606 GN=GANAB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	462-UNIMOD:188,472-UNIMOD:188	0.01	27.0	4	1	0
PRT	sp|P52757|CHIO_HUMAN	Beta-chimaerin OS=Homo sapiens OX=9606 GN=CHN2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|Q9BWF3-3|RBM4_HUMAN	Isoform 3 of RNA-binding protein 4 OS=Homo sapiens OX=9606 GN=RBM4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	89-UNIMOD:4	0.12	27.0	1	1	0
PRT	sp|Q9UHY7-2|ENOPH_HUMAN	Isoform 2 of Enolase-phosphatase E1 OS=Homo sapiens OX=9606 GN=ENOPH1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	37-UNIMOD:188	0.30	27.0	3	2	0
PRT	sp|Q96P70|IPO9_HUMAN	Importin-9 OS=Homo sapiens OX=9606 GN=IPO9 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|P62241|RS8_HUMAN	40S ribosomal protein S8 OS=Homo sapiens OX=9606 GN=RPS8 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	100-UNIMOD:4,110-UNIMOD:267,123-UNIMOD:267	0.13	27.0	2	1	0
PRT	sp|P52888|THOP1_HUMAN	Thimet oligopeptidase OS=Homo sapiens OX=9606 GN=THOP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|Q12824-2|SNF5_HUMAN	Isoform B of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 OS=Homo sapiens OX=9606 GN=SMARCB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	138-UNIMOD:4,144-UNIMOD:267	0.07	27.0	1	1	1
PRT	sp|Q92522|H1X_HUMAN	Histone H1x OS=Homo sapiens OX=9606 GN=H1FX PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.08	27.0	1	1	1
PRT	sp|Q68CQ4|DIEXF_HUMAN	Digestive organ expansion factor homolog OS=Homo sapiens OX=9606 GN=DIEXF PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|P16144-4|ITB4_HUMAN	Isoform Beta-4D of Integrin beta-4 OS=Homo sapiens OX=9606 GN=ITGB4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	1438-UNIMOD:267	0.01	27.0	2	1	0
PRT	sp|Q13889-2|TF2H3_HUMAN	Isoform 2 of General transcription factor IIH subunit 3 OS=Homo sapiens OX=9606 GN=GTF2H3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.06	27.0	1	1	1
PRT	sp|Q02878|RL6_HUMAN	60S ribosomal protein L6 OS=Homo sapiens OX=9606 GN=RPL6 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	156-UNIMOD:267	0.10	27.0	2	2	2
PRT	sp|Q9Y221|NIP7_HUMAN	60S ribosome subunit biogenesis protein NIP7 homolog OS=Homo sapiens OX=9606 GN=NIP7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	100-UNIMOD:188,115-UNIMOD:188	0.23	27.0	2	2	2
PRT	sp|Q58FF7|H90B3_HUMAN	Putative heat shock protein HSP 90-beta-3 OS=Homo sapiens OX=9606 GN=HSP90AB3P PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.03	27.0	1	1	0
PRT	sp|Q13813|SPTN1_HUMAN	Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	1605-UNIMOD:267	0.01	27.0	1	1	0
PRT	sp|Q9NQ29|LUC7L_HUMAN	Putative RNA-binding protein Luc7-like 1 OS=Homo sapiens OX=9606 GN=LUC7L PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	43-UNIMOD:4,44-UNIMOD:4,53-UNIMOD:267	0.05	27.0	1	1	0
PRT	sp|Q9NZ01|TECR_HUMAN	Very-long-chain enoyl-CoA reductase OS=Homo sapiens OX=9606 GN=TECR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	1-UNIMOD:35,2-UNIMOD:188,12-UNIMOD:188	0.04	27.0	1	1	0
PRT	sp|Q8IZJ3|CPMD8_HUMAN	C3 and PZP-like alpha-2-macroglobulin domain-containing protein 8 OS=Homo sapiens OX=9606 GN=CPAMD8 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|O94804|STK10_HUMAN	Serine/threonine-protein kinase 10 OS=Homo sapiens OX=9606 GN=STK10 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	888-UNIMOD:4,898-UNIMOD:188	0.01	26.0	2	1	0
PRT	sp|Q6DD88|ATLA3_HUMAN	Atlastin-3 OS=Homo sapiens OX=9606 GN=ATL3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	250-UNIMOD:267	0.02	26.0	1	1	1
PRT	sp|O14828-2|SCAM3_HUMAN	Isoform 2 of Secretory carrier-associated membrane protein 3 OS=Homo sapiens OX=9606 GN=SCAMP3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.05	26.0	1	1	1
PRT	sp|P26368-2|U2AF2_HUMAN	Isoform 2 of Splicing factor U2AF 65 kDa subunit OS=Homo sapiens OX=9606 GN=U2AF2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|P62917|RL8_HUMAN	60S ribosomal protein L8 OS=Homo sapiens OX=9606 GN=RPL8 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.07	26.0	2	2	2
PRT	sp|Q15700-5|DLG2_HUMAN	Isoform 5 of Disks large homolog 2 OS=Homo sapiens OX=9606 GN=DLG2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	236-UNIMOD:4	0.04	26.0	1	1	1
PRT	sp|O00148-3|DX39A_HUMAN	Isoform 3 of ATP-dependent RNA helicase DDX39A OS=Homo sapiens OX=9606 GN=DDX39A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	197-UNIMOD:4	0.07	26.0	1	1	1
PRT	sp|O00233-2|PSMD9_HUMAN	Isoform p27-S of 26S proteasome non-ATPase regulatory subunit 9 OS=Homo sapiens OX=9606 GN=PSMD9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	81-UNIMOD:4,87-UNIMOD:188	0.06	26.0	3	1	0
PRT	sp|P56524-2|HDAC4_HUMAN	Isoform 2 of Histone deacetylase 4 OS=Homo sapiens OX=9606 GN=HDAC4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|Q9Y3A3-2|PHOCN_HUMAN	Isoform 2 of MOB-like protein phocein OS=Homo sapiens OX=9606 GN=MOB4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	102-UNIMOD:4	0.10	26.0	1	1	1
PRT	sp|Q75N03-2|HAKAI_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase Hakai OS=Homo sapiens OX=9606 GN=CBLL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	129-UNIMOD:4,132-UNIMOD:4	0.03	26.0	1	1	1
PRT	sp|P12270|TPR_HUMAN	Nucleoprotein TPR OS=Homo sapiens OX=9606 GN=TPR PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	1571-UNIMOD:188,1576-UNIMOD:188	0.01	26.0	2	1	0
PRT	sp|O94901-2|SUN1_HUMAN	Isoform 2 of SUN domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SUN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	195-UNIMOD:188,210-UNIMOD:267	0.07	26.0	1	1	1
PRT	sp|Q9UHB6|LIMA1_HUMAN	LIM domain and actin-binding protein 1 OS=Homo sapiens OX=9606 GN=LIMA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	75-UNIMOD:188,91-UNIMOD:267,359-UNIMOD:188,366-UNIMOD:267	0.05	26.0	3	2	1
PRT	sp|P31948-3|STIP1_HUMAN	Isoform 3 of Stress-induced-phosphoprotein 1 OS=Homo sapiens OX=9606 GN=STIP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	44-UNIMOD:267	0.03	26.0	2	1	0
PRT	sp|Q15102|PA1B3_HUMAN	Platelet-activating factor acetylhydrolase IB subunit gamma OS=Homo sapiens OX=9606 GN=PAFAH1B3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.06	26.0	1	1	1
PRT	sp|Q27J81-2|INF2_HUMAN	Isoform 2 of Inverted formin-2 OS=Homo sapiens OX=9606 GN=INF2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|Q8IY37|DHX37_HUMAN	Probable ATP-dependent RNA helicase DHX37 OS=Homo sapiens OX=9606 GN=DHX37 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	956-UNIMOD:188,974-UNIMOD:188	0.02	26.0	1	1	1
PRT	sp|P22314-2|UBA1_HUMAN	Isoform 2 of Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.04	26.0	2	2	2
PRT	sp|P61106|RAB14_HUMAN	Ras-related protein Rab-14 OS=Homo sapiens OX=9606 GN=RAB14 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	26-UNIMOD:4,34-UNIMOD:188,35-UNIMOD:188	0.06	26.0	2	1	0
PRT	sp|Q14152-2|EIF3A_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit A OS=Homo sapiens OX=9606 GN=EIF3A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	264-UNIMOD:267	0.01	26.0	2	1	0
PRT	sp|Q9HC35-2|EMAL4_HUMAN	Isoform 2 of Echinoderm microtubule-associated protein-like 4 OS=Homo sapiens OX=9606 GN=EML4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	387-UNIMOD:267	0.02	26.0	1	1	1
PRT	sp|Q96Q11-2|TRNT1_HUMAN	Isoform 2 of CCA tRNA nucleotidyltransferase 1, mitochondrial OS=Homo sapiens OX=9606 GN=TRNT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.04	26.0	1	1	1
PRT	sp|Q8IXB1-2|DJC10_HUMAN	Isoform 2 of DnaJ homolog subfamily C member 10 OS=Homo sapiens OX=9606 GN=DNAJC10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q9HC38-3|GLOD4_HUMAN	Isoform 3 of Glyoxalase domain-containing protein 4 OS=Homo sapiens OX=9606 GN=GLOD4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	41-UNIMOD:4	0.07	26.0	2	1	0
PRT	sp|P48147|PPCE_HUMAN	Prolyl endopeptidase OS=Homo sapiens OX=9606 GN=PREP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	343-UNIMOD:4	0.03	26.0	1	1	1
PRT	sp|O95373|IPO7_HUMAN	Importin-7 OS=Homo sapiens OX=9606 GN=IPO7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	113-UNIMOD:4,119-UNIMOD:188,1018-UNIMOD:188	0.04	26.0	3	2	1
PRT	sp|Q9BRR6-4|ADPGK_HUMAN	Isoform 4 of ADP-dependent glucokinase OS=Homo sapiens OX=9606 GN=ADPGK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.09	26.0	1	1	1
PRT	sp|O60506|HNRPQ_HUMAN	Heterogeneous nuclear ribonucleoprotein Q OS=Homo sapiens OX=9606 GN=SYNCRIP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	232-UNIMOD:188,237-UNIMOD:4,244-UNIMOD:267	0.03	26.0	1	1	0
PRT	sp|Q9UHY7|ENOPH_HUMAN	Enolase-phosphatase E1 OS=Homo sapiens OX=9606 GN=ENOPH1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	187-UNIMOD:188,194-UNIMOD:267	0.05	26.0	1	1	0
PRT	sp|Q96EP5|DAZP1_HUMAN	DAZ-associated protein 1 OS=Homo sapiens OX=9606 GN=DAZAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	124-UNIMOD:4	0.05	26.0	1	1	0
PRT	sp|O75569|PRKRA_HUMAN	Interferon-inducible double-stranded RNA-dependent protein kinase activator A OS=Homo sapiens OX=9606 GN=PRKRA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	156-UNIMOD:188,157-UNIMOD:267	0.05	26.0	1	1	0
PRT	sp|Q5T9A4|ATD3B_HUMAN	ATPase family AAA domain-containing protein 3B OS=Homo sapiens OX=9606 GN=ATAD3B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	492-UNIMOD:4	0.02	26.0	1	1	1
PRT	sp|Q96FZ2|HMCES_HUMAN	Abasic site processing protein HMCES OS=Homo sapiens OX=9606 GN=HMCES PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	260-UNIMOD:267	0.06	26.0	1	1	1
PRT	sp|P62873|GBB1_HUMAN	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Homo sapiens OX=9606 GN=GNB1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.06	26.0	1	1	1
PRT	sp|Q8IZH2|XRN1_HUMAN	5'-3' exoribonuclease 1 OS=Homo sapiens OX=9606 GN=XRN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|Q9NV06|DCA13_HUMAN	DDB1- and CUL4-associated factor 13 OS=Homo sapiens OX=9606 GN=DCAF13 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	78-UNIMOD:188,87-UNIMOD:4,92-UNIMOD:267	0.04	26.0	1	1	1
PRT	sp|Q5W0Z9-4|ZDH20_HUMAN	Isoform 4 of Palmitoyltransferase ZDHHC20 OS=Homo sapiens OX=9606 GN=ZDHHC20	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	142-UNIMOD:4,145-UNIMOD:4,148-UNIMOD:4,151-UNIMOD:188	0.04	25.0	1	1	1
PRT	sp|Q8N1G4|LRC47_HUMAN	Leucine-rich repeat-containing protein 47 OS=Homo sapiens OX=9606 GN=LRRC47 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	83-UNIMOD:267	0.03	25.0	1	1	1
PRT	sp|P07741-2|APT_HUMAN	Isoform 2 of Adenine phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=APRT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.13	25.0	1	1	1
PRT	sp|Q96C01|F136A_HUMAN	Protein FAM136A OS=Homo sapiens OX=9606 GN=FAM136A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	114-UNIMOD:4,127-UNIMOD:188	0.11	25.0	1	1	1
PRT	sp|P18077|RL35A_HUMAN	60S ribosomal protein L35a OS=Homo sapiens OX=9606 GN=RPL35A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.14	25.0	1	1	1
PRT	sp|Q9GZQ8|MLP3B_HUMAN	Microtubule-associated proteins 1A/1B light chain 3B OS=Homo sapiens OX=9606 GN=MAP1LC3B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.11	25.0	1	1	1
PRT	sp|P00558-2|PGK1_HUMAN	Isoform 2 of Phosphoglycerate kinase 1 OS=Homo sapiens OX=9606 GN=PGK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q16836|HCDH_HUMAN	Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=HADH PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.08	25.0	1	1	1
PRT	sp|P04843|RPN1_HUMAN	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Homo sapiens OX=9606 GN=RPN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	2	1	0
PRT	sp|O00499-9|BIN1_HUMAN	Isoform BIN1-10-13 of Myc box-dependent-interacting protein 1 OS=Homo sapiens OX=9606 GN=BIN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q14562|DHX8_HUMAN	ATP-dependent RNA helicase DHX8 OS=Homo sapiens OX=9606 GN=DHX8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	1096-UNIMOD:4,1090-UNIMOD:188,1098-UNIMOD:188	0.01	25.0	2	1	0
PRT	sp|Q01433-3|AMPD2_HUMAN	Isoform Ex1A-3 of AMP deaminase 2 OS=Homo sapiens OX=9606 GN=AMPD2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|O00159-2|MYO1C_HUMAN	Isoform 2 of Unconventional myosin-Ic OS=Homo sapiens OX=9606 GN=MYO1C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|Q9BUJ2-4|HNRL1_HUMAN	Isoform 4 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 OS=Homo sapiens OX=9606 GN=HNRNPUL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	183-UNIMOD:267	0.02	25.0	3	1	0
PRT	sp|Q13190-3|STX5_HUMAN	Isoform 3 of Syntaxin-5 OS=Homo sapiens OX=9606 GN=STX5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.06	25.0	1	1	1
PRT	sp|Q9BR76|COR1B_HUMAN	Coronin-1B OS=Homo sapiens OX=9606 GN=CORO1B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	25-UNIMOD:4	0.04	25.0	1	1	1
PRT	sp|Q9BQG0|MBB1A_HUMAN	Myb-binding protein 1A OS=Homo sapiens OX=9606 GN=MYBBP1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	338-UNIMOD:4,341-UNIMOD:188	0.01	25.0	1	1	1
PRT	sp|P11387|TOP1_HUMAN	DNA topoisomerase 1 OS=Homo sapiens OX=9606 GN=TOP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|O75821|EIF3G_HUMAN	Eukaryotic translation initiation factor 3 subunit G OS=Homo sapiens OX=9606 GN=EIF3G PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	160-UNIMOD:4	0.03	25.0	1	1	1
PRT	sp|Q96JG6-3|VPS50_HUMAN	Isoform 3 of Syndetin OS=Homo sapiens OX=9606 GN=VPS50	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	821-UNIMOD:4,823-UNIMOD:267	0.02	25.0	1	1	1
PRT	sp|Q12874|SF3A3_HUMAN	Splicing factor 3A subunit 3 OS=Homo sapiens OX=9606 GN=SF3A3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null	97-UNIMOD:188,103-UNIMOD:4,115-UNIMOD:188	0.04	25.0	2	1	0
PRT	sp|P08727|K1C19_HUMAN	Keratin, type I cytoskeletal 19 OS=Homo sapiens OX=9606 GN=KRT19 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q9ULX6-2|AKP8L_HUMAN	Isoform 2 of A-kinase anchor protein 8-like OS=Homo sapiens OX=9606 GN=AKAP8L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	423-UNIMOD:4,426-UNIMOD:4	0.04	25.0	1	1	1
PRT	sp|P02794|FRIH_HUMAN	Ferritin heavy chain OS=Homo sapiens OX=9606 GN=FTH1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	125-UNIMOD:188,131-UNIMOD:4,144-UNIMOD:188	0.14	25.0	1	1	1
PRT	sp|Q9UBB6-2|NCDN_HUMAN	Isoform 2 of Neurochondrin OS=Homo sapiens OX=9606 GN=NCDN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	452-UNIMOD:4	0.02	25.0	1	1	1
PRT	sp|P0DMV8-2|HS71A_HUMAN	Isoform 2 of Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q8IX12-2|CCAR1_HUMAN	Isoform 2 of Cell division cycle and apoptosis regulator protein 1 OS=Homo sapiens OX=9606 GN=CCAR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|O15347|HMGB3_HUMAN	High mobility group protein B3 OS=Homo sapiens OX=9606 GN=HMGB3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	104-UNIMOD:4	0.08	25.0	1	1	1
PRT	sp|Q9GZZ1-2|NAA50_HUMAN	Isoform 2 of N-alpha-acetyltransferase 50 OS=Homo sapiens OX=9606 GN=NAA50	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.16	25.0	1	1	1
PRT	sp|P50570-3|DYN2_HUMAN	Isoform 3 of Dynamin-2 OS=Homo sapiens OX=9606 GN=DNM2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	86-UNIMOD:4,87-UNIMOD:188	0.01	25.0	1	1	1
PRT	sp|Q96CS2|HAUS1_HUMAN	HAUS augmin-like complex subunit 1 OS=Homo sapiens OX=9606 GN=HAUS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.04	25.0	1	1	1
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	113-UNIMOD:188	0.05	25.0	1	1	1
PRT	sp|P08243-3|ASNS_HUMAN	Isoform 3 of Asparagine synthetase [glutamine-hydrolyzing] OS=Homo sapiens OX=9606 GN=ASNS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	108-UNIMOD:188,112-UNIMOD:188	0.04	25.0	1	1	1
PRT	sp|Q9H4A4|AMPB_HUMAN	Aminopeptidase B OS=Homo sapiens OX=9606 GN=RNPEP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q29RF7|PDS5A_HUMAN	Sister chromatid cohesion protein PDS5 homolog A OS=Homo sapiens OX=9606 GN=PDS5A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	686-UNIMOD:4	0.02	25.0	1	1	1
PRT	sp|Q10471-2|GALT2_HUMAN	Isoform 2 of Polypeptide N-acetylgalactosaminyltransferase 2 OS=Homo sapiens OX=9606 GN=GALNT2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	137-UNIMOD:4,139-UNIMOD:4	0.09	25.0	1	1	1
PRT	sp|Q96H79|ZCCHL_HUMAN	Zinc finger CCCH-type antiviral protein 1-like OS=Homo sapiens OX=9606 GN=ZC3HAV1L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	99-UNIMOD:4,102-UNIMOD:4,108-UNIMOD:4	0.06	25.0	1	1	1
PRT	sp|P13647|K2C5_HUMAN	Keratin, type II cytoskeletal 5 OS=Homo sapiens OX=9606 GN=KRT5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	383-UNIMOD:188,391-UNIMOD:267	0.02	25.0	1	1	1
PRT	sp|Q9UPN3-2|MACF1_HUMAN	Isoform 2 of Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	3548-UNIMOD:267	0.00	25.0	1	1	1
PRT	sp|Q9H4G0|E41L1_HUMAN	Band 4.1-like protein 1 OS=Homo sapiens OX=9606 GN=EPB41L1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	515-UNIMOD:188,516-UNIMOD:267	0.01	25.0	2	1	0
PRT	sp|P30050|RL12_HUMAN	60S ribosomal protein L12 OS=Homo sapiens OX=9606 GN=RPL12 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	114-UNIMOD:267	0.10	25.0	1	1	1
PRT	sp|Q9Y2Z0|SGT1_HUMAN	Protein SGT1 homolog OS=Homo sapiens OX=9606 GN=SUGT1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.07	25.0	1	1	0
PRT	sp|P36941-2|TNR3_HUMAN	Isoform 2 of Tumor necrosis factor receptor superfamily member 3 OS=Homo sapiens OX=9606 GN=LTBR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	399-UNIMOD:4	0.04	24.0	1	1	0
PRT	sp|Q13501-2|SQSTM_HUMAN	Isoform 2 of Sequestosome-1 OS=Homo sapiens OX=9606 GN=SQSTM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	26-UNIMOD:267,29-UNIMOD:4,35-UNIMOD:267	0.04	24.0	1	1	1
PRT	sp|Q9H6Z4-3|RANB3_HUMAN	Isoform 3 of Ran-binding protein 3 OS=Homo sapiens OX=9606 GN=RANBP3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|P43034|LIS1_HUMAN	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens OX=9606 GN=PAFAH1B1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	281-UNIMOD:4	0.08	24.0	1	1	1
PRT	sp|Q14008-2|CKAP5_HUMAN	Isoform 2 of Cytoskeleton-associated protein 5 OS=Homo sapiens OX=9606 GN=CKAP5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	1378-UNIMOD:267,1383-UNIMOD:267	0.01	24.0	1	1	1
PRT	sp|Q15437|SC23B_HUMAN	Protein transport protein Sec23B OS=Homo sapiens OX=9606 GN=SEC23B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	2	2	2
PRT	sp|O95394|AGM1_HUMAN	Phosphoacetylglucosamine mutase OS=Homo sapiens OX=9606 GN=PGM3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	244-UNIMOD:188,249-UNIMOD:4,255-UNIMOD:188	0.03	24.0	1	1	1
PRT	sp|P15313|VATB1_HUMAN	V-type proton ATPase subunit B, kidney isoform OS=Homo sapiens OX=9606 GN=ATP6V1B1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	201-UNIMOD:4	0.05	24.0	1	1	1
PRT	sp|Q9BWS9-3|CHID1_HUMAN	Isoform 3 of Chitinase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CHID1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.06	24.0	1	1	1
PRT	sp|O43719|HTSF1_HUMAN	HIV Tat-specific factor 1 OS=Homo sapiens OX=9606 GN=HTATSF1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|O95251-3|KAT7_HUMAN	Isoform 3 of Histone acetyltransferase KAT7 OS=Homo sapiens OX=9606 GN=KAT7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	70-UNIMOD:4,81-UNIMOD:4	0.05	24.0	1	1	1
PRT	sp|Q2TB10|ZN800_HUMAN	Zinc finger protein 800 OS=Homo sapiens OX=9606 GN=ZNF800 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	517-UNIMOD:188	0.02	24.0	1	1	1
PRT	sp|Q9UKV3-5|ACINU_HUMAN	Isoform 4 of Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens OX=9606 GN=ACIN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	138-UNIMOD:188	0.02	24.0	1	1	1
PRT	sp|Q9P0J7|KCMF1_HUMAN	E3 ubiquitin-protein ligase KCMF1 OS=Homo sapiens OX=9606 GN=KCMF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	54-UNIMOD:4	0.04	24.0	1	1	1
PRT	sp|P15880|RS2_HUMAN	40S ribosomal protein S2 OS=Homo sapiens OX=9606 GN=RPS2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	176-UNIMOD:188,182-UNIMOD:4,183-UNIMOD:188	0.04	24.0	1	1	1
PRT	sp|P27708|PYR1_HUMAN	CAD protein OS=Homo sapiens OX=9606 GN=CAD PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	854-UNIMOD:267	0.01	24.0	1	1	1
PRT	sp|P49588|SYAC_HUMAN	Alanine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=AARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	184-UNIMOD:4,187-UNIMOD:4	0.03	24.0	1	1	1
PRT	sp|Q6PJT7-10|ZC3HE_HUMAN	Isoform 10 of Zinc finger CCCH domain-containing protein 14 OS=Homo sapiens OX=9606 GN=ZC3H14	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q9NX55|HYPK_HUMAN	Huntingtin-interacting protein K OS=Homo sapiens OX=9606 GN=HYPK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.09	24.0	1	1	1
PRT	sp|P05787|K2C8_HUMAN	Keratin, type II cytoskeletal 8 OS=Homo sapiens OX=9606 GN=KRT8 PE=1 SV=7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	225-UNIMOD:267	0.05	24.0	2	2	2
PRT	sp|Q9BV20|MTNA_HUMAN	Methylthioribose-1-phosphate isomerase OS=Homo sapiens OX=9606 GN=MRI1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	199-UNIMOD:4	0.05	24.0	1	1	1
PRT	sp|Q9Y2Z0-2|SGT1_HUMAN	Isoform 2 of Protein SGT1 homolog OS=Homo sapiens OX=9606 GN=SUGT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	189-UNIMOD:188,204-UNIMOD:188	0.08	24.0	1	1	0
PRT	sp|P06132|DCUP_HUMAN	Uroporphyrinogen decarboxylase OS=Homo sapiens OX=9606 GN=UROD PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.05	24.0	1	1	1
PRT	sp|Q13442|HAP28_HUMAN	28 kDa heat- and acid-stable phosphoprotein OS=Homo sapiens OX=9606 GN=PDAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	132-UNIMOD:188,137-UNIMOD:188	0.07	24.0	1	1	1
PRT	sp|Q9BX66-4|SRBS1_HUMAN	Isoform 4 of Sorbin and SH3 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SORBS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	488-UNIMOD:267	0.02	24.0	1	1	1
PRT	sp|P61978-3|HNRPK_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q7Z4Q2|HEAT3_HUMAN	HEAT repeat-containing protein 3 OS=Homo sapiens OX=9606 GN=HEATR3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q96CT7|CC124_HUMAN	Coiled-coil domain-containing protein 124 OS=Homo sapiens OX=9606 GN=CCDC124 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	134-UNIMOD:267,135-UNIMOD:267	0.07	24.0	1	1	1
PRT	sp|Q9NQW6-2|ANLN_HUMAN	Isoform 2 of Anillin OS=Homo sapiens OX=9606 GN=ANLN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q96HC4-7|PDLI5_HUMAN	Isoform 7 of PDZ and LIM domain protein 5 OS=Homo sapiens OX=9606 GN=PDLIM5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	343-UNIMOD:4,346-UNIMOD:4	0.03	24.0	1	1	1
PRT	sp|Q8N0Y7|PGAM4_HUMAN	Probable phosphoglycerate mutase 4 OS=Homo sapiens OX=9606 GN=PGAM4 PE=3 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.09	24.0	1	1	1
PRT	sp|O94973-3|AP2A2_HUMAN	Isoform 3 of AP-2 complex subunit alpha-2 OS=Homo sapiens OX=9606 GN=AP2A2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|P22102|PUR2_HUMAN	Trifunctional purine biosynthetic protein adenosine-3 OS=Homo sapiens OX=9606 GN=GART PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|O14653-3|GOSR2_HUMAN	Isoform 3 of Golgi SNAP receptor complex member 2 OS=Homo sapiens OX=9606 GN=GOSR2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.11	24.0	1	1	1
PRT	sp|P13804-2|ETFA_HUMAN	Isoform 2 of Electron transfer flavoprotein subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=ETFA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.10	24.0	1	1	1
PRT	sp|P54136-2|SYRC_HUMAN	Isoform Monomeric of Arginine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=RARS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|P21281|VATB2_HUMAN	V-type proton ATPase subunit B, brain isoform OS=Homo sapiens OX=9606 GN=ATP6V1B2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	81-UNIMOD:188,82-UNIMOD:267	0.03	24.0	1	1	1
PRT	sp|Q9UNX3|RL26L_HUMAN	60S ribosomal protein L26-like 1 OS=Homo sapiens OX=9606 GN=RPL26L1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	103-UNIMOD:188	0.10	24.0	1	1	1
PRT	sp|O14979|HNRDL_HUMAN	Heterogeneous nuclear ribonucleoprotein D-like OS=Homo sapiens OX=9606 GN=HNRNPDL PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	303-UNIMOD:4	0.03	24.0	1	1	0
PRT	sp|Q7Z2Z2|EFL1_HUMAN	Elongation factor-like GTPase 1 OS=Homo sapiens OX=9606 GN=EFL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	23-UNIMOD:4	0.01	24.0	1	1	1
PRT	sp|Q9NPF4|OSGEP_HUMAN	Probable tRNA N6-adenosine threonylcarbamoyltransferase OS=Homo sapiens OX=9606 GN=OSGEP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.05	24.0	1	1	1
PRT	sp|Q9Y6X2|PIAS3_HUMAN	E3 SUMO-protein ligase PIAS3 OS=Homo sapiens OX=9606 GN=PIAS3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	10-UNIMOD:35	0.03	24.0	1	1	1
PRT	sp|Q49A26|GLYR1_HUMAN	Putative oxidoreductase GLYR1 OS=Homo sapiens OX=9606 GN=GLYR1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q9Y4R8|TELO2_HUMAN	Telomere length regulation protein TEL2 homolog OS=Homo sapiens OX=9606 GN=TELO2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	625-UNIMOD:267	0.02	24.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	QRHELLLGAGSGPGAGQQQATPGALLQAGPPR	1	sp|Q96DI7|SNR40_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	51.0	1-UNIMOD:28	ms_run[1]:scan=8475	54.97737166666667	3	3115.6245	3115.6270	R	C	20	52
PSM	LLHLLLDDMPVKPYSDGEGGIEDENR	2	sp|Q92621|NU205_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	49.0	12-UNIMOD:188,26-UNIMOD:267	ms_run[1]:scan=10150	66.09988833333333	3	2940.443662	2940.450986	R	S	1139	1165
PSM	QRHELLLGAGSGPGAGQQQATPGALLQAGPPR	3	sp|Q96DI7|SNR40_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	49.0	1-UNIMOD:28,2-UNIMOD:267,32-UNIMOD:267	ms_run[1]:scan=8453	54.82376333333333	3	3135.6424	3135.6435	R	C	20	52
PSM	AHGPGLEGGLVGKPAEFTIDTK	4	sp|O75369-7|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	13-UNIMOD:188,22-UNIMOD:188	ms_run[2]:scan=7115	46.11	2	2205.1832	2205.1832	K	G	876	898
PSM	CTHWAEGGKGALALAQAVQR	5	sp|P11586|C1TC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	1-UNIMOD:4	ms_run[2]:scan=6826	44.309	2	2123.0694	2123.0694	K	A	785	805
PSM	KISSIQSIVPALEIANAHR	6	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0		ms_run[2]:scan=9124	59.223	2	2046.1586	2046.1586	K	K	250	269
PSM	HAIYDKLDDDGLIAPGVR	7	sp|P30876|RPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0		ms_run[2]:scan=7011	45.46	2	1967.0112	1967.0112	R	V	842	860
PSM	LRGIEQAVQSHAVAEEEAR	8	sp|Q16891-3|MIC60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0		ms_run[2]:scan=5242	34.381	2	2092.0661	2092.0661	R	K	514	533
PSM	MREIVHLQAGQCGNQIGAK	9	sp|P68371|TBB4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	12-UNIMOD:4	ms_run[2]:scan=4662	30.827	2	2109.0572	2109.0572	-	F	1	20
PSM	RLVHQNSASDDAEASMISK	10	sp|Q13616|CUL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0		ms_run[2]:scan=3230	22.041	2	2057.98	2057.9800	K	L	473	492
PSM	MREIVHIQAGQCGNQIGAK	11	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	47.0	2-UNIMOD:267,12-UNIMOD:4,19-UNIMOD:188	ms_run[1]:scan=4659	30.812009999999997	2	2125.082446	2125.085560	-	F	1	20
PSM	FHDPDSAVVAQHLTNTVFVDR	12	sp|Q05519-2|SRS11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	21-UNIMOD:267	ms_run[2]:scan=8211	53.212	2	2377.169	2377.1690	K	A	83	104
PSM	RATVAPEDVSEVIFGHVLAAGCGQNPVR	13	sp|Q9BWD1|THIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	1-UNIMOD:267,22-UNIMOD:4,28-UNIMOD:267	ms_run[2]:scan=11191	73.166	3	2968.5092	2968.5092	K	Q	44	72
PSM	HIDSAHLYNNEEQVGLAIR	14	sp|P42330|AK1C3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=6438	41.858	2	2178.0818	2178.0818	R	S	48	67
PSM	INMAHLCIVGSHAVNGVAK	15	sp|P06737-2|PYGL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	7-UNIMOD:4	ms_run[2]:scan=6581	42.774	2	1990.0241	1990.0241	R	I	406	425
PSM	LQHLAESWGGKENGFGLAECCR	16	sp|Q7Z6Z7-2|HUWE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	20-UNIMOD:4,21-UNIMOD:4	ms_run[2]:scan=6920	44.899	2	2518.1482	2518.1482	R	D	163	185
PSM	AHAAQVTCVAASPHKDSVFLSCSEDNR	17	sp|Q9BQA1|MEP50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	8-UNIMOD:4,22-UNIMOD:4	ms_run[2]:scan=4777	31.515	3	2956.3556	2956.3556	R	I	165	192
PSM	AHGPGLEGGLVGKPAEFTIDTK	18	sp|O75369-7|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=7122	46.148	2	2193.143	2193.1430	K	G	876	898
PSM	AHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLR	19	sp|P46937-5|YAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	37-UNIMOD:267	ms_run[2]:scan=8287	53.693	3	3543.8673	3543.8673	R	Q	125	162
PSM	HVTDYKTSESTGSLPSPFLR	20	sp|O95456-2|PSMG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=6694	43.48	2	2221.1015	2221.1015	R	A	150	170
PSM	IHYIGQNEPELLVAHAYTR	21	sp|P30519-2|HMOX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=7632	49.433	2	2223.1437	2223.1437	R	Y	109	128
PSM	KHEALMSDLSAYGSSIQALR	22	sp|Q13813-2|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=9069	58.822	2	2176.0947	2176.0947	K	E	931	951
PSM	NWRDPDQTDGLGLSYLSSHIANVER	23	sp|P06396-2|GELS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	3-UNIMOD:267,25-UNIMOD:267	ms_run[2]:scan=10014	65.174	3	2862.38	2862.3800	K	V	344	369
PSM	FVHSENQHLVSPEALDFLDK	24	sp|P68400|CSK21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	20-UNIMOD:188	ms_run[2]:scan=8960	58.111	2	2330.1638	2330.1638	R	L	284	304
PSM	FVHSENQHLVSPEALDFLDK	25	sp|P68400|CSK21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=8964	58.139	2	2324.1437	2324.1437	R	L	284	304
PSM	HTLEQHNWNIEAAVQDR	26	sp|Q96CS3|FAF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	17-UNIMOD:267	ms_run[2]:scan=6274	40.814	2	2069.9907	2069.9907	R	L	34	51
PSM	HVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGR	27	sp|P00441|SODC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	32-UNIMOD:4	ms_run[2]:scan=10399	67.745	3	3719.8061	3719.8061	R	T	81	117
PSM	HVVFTAETHNFPTGVCPFSGATTGTGGR	28	sp|O15067|PUR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	16-UNIMOD:4	ms_run[2]:scan=7656	49.587	3	2904.3613	2904.3613	R	I	303	331
PSM	IHYIGQNEPELLVAHAYTR	29	sp|P30519-2|HMOX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	19-UNIMOD:267	ms_run[2]:scan=7630	49.421	2	2233.1519	2233.1519	R	Y	109	128
PSM	KTHDASGQLVLISQELLR	30	sp|Q9UDT6-2|CLIP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=9980	64.944	2	2007.1113	2007.1113	R	K	852	870
PSM	LAAAILGGVDQIHIKPGAK	31	sp|P22087|FBRL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	15-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=7628	49.409	2	1883.1395	1883.1395	K	V	144	163
PSM	SNKIFVGGIPHNCGETELR	32	sp|Q96EP5-2|DAZP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	13-UNIMOD:4	ms_run[2]:scan=5754	37.534	2	2127.0531	2127.0531	K	E	112	131
PSM	REIVHIQAGQCGNQIGAK	33	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0	1-UNIMOD:267,11-UNIMOD:4,18-UNIMOD:188	ms_run[1]:scan=3771	25.366075	2	1994.0433	1994.0446	M	F	2	20
PSM	AWHLAETEHCGATPSNR	34	sp|P36941|TNR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	10-UNIMOD:4	ms_run[1]:scan=3750	25.231823333333335	2	1936.868070	1935.864593	K	G	409	426
PSM	AHLLADMAHISGLVAAK	35	sp|P34897-3|GLYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	17-UNIMOD:188	ms_run[2]:scan=8818	57.2	2	1722.9546	1722.9546	K	V	225	242
PSM	AHLLADMAHISGLVAAK	36	sp|P34897-3|GLYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=8816	57.188	2	1716.9345	1716.9345	K	V	225	242
PSM	AHTDFFEAFKNYDESGSPR	37	sp|P61201|CSN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=8283	53.669	2	2216.9763	2216.9763	K	R	254	273
PSM	FVLQDGAHHMVDSNEISFIR	38	sp|Q96RP9|EFGM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=8608	55.831	2	2314.1165	2314.1165	R	A	609	629
PSM	GHYTEGAELVDSVLDVVRK	39	sp|P68371|TBB4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=11144	72.847	2	2086.0695	2086.0695	K	E	104	123
PSM	HIGKVVVQVLAEEPEAVLK	40	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	4-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=8890	57.666	2	2069.2287	2069.2287	K	G	1848	1867
PSM	HVVFTAETHNFPTGVCPFSGATTGTGGR	41	sp|O15067|PUR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	16-UNIMOD:4	ms_run[2]:scan=7659	49.603	2	2904.3613	2904.3613	R	I	303	331
PSM	HWILPQDYDHAQAEAR	42	sp|Q15293-2|RCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	16-UNIMOD:267	ms_run[2]:scan=5936	38.671	2	1958.9263	1958.9263	R	H	220	236
PSM	HWVAPGGPYSAETPGVPSPIAALK	43	sp|Q8IU81|I2BP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=9188	59.652	2	2401.243	2401.2430	R	N	404	428
PSM	KFDEVLVNHFCEEFGK	44	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:188,11-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=8746	56.736	2	2008.9756	2008.9756	R	K	235	251
PSM	KLSSWDQAETPGHTPSLR	45	sp|O75533|SF3B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=5179	33.993	2	2008.9967	2008.9967	K	W	214	232
PSM	KWDTCAPEVILHAVGGK	46	sp|O95861-3|BPNT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	5-UNIMOD:4	ms_run[2]:scan=9017	58.482	2	1879.9615	1879.9615	K	L	190	207
PSM	KWESPAQNTAHLDQFER	47	sp|P17612-2|KAPCA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=5658	36.945	2	2055.9763	2055.9763	K	I	22	39
PSM	MHDLNTDQENLVGTHDAPIR	48	sp|O43684-2|BUB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:35,20-UNIMOD:267	ms_run[2]:scan=4956	32.621	2	2301.0683	2301.0683	K	C	81	101
PSM	MHDLNTDQENLVGTHDAPIR	49	sp|O43684-2|BUB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:35	ms_run[2]:scan=4950	32.583	2	2291.0601	2291.0601	K	C	81	101
PSM	REIVHLQAGQCGNQIGAK	50	sp|P68371|TBB4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	11-UNIMOD:4	ms_run[2]:scan=3772	25.372	2	1978.0167	1978.0167	M	F	2	20
PSM	SLHDALCVLAQTVKDSR	51	sp|P78371-2|TCPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	7-UNIMOD:4	ms_run[2]:scan=10471	68.221	2	1911.9836	1911.9836	R	T	342	359
PSM	THFGGGKTTGFGMIYDSLDYAK	52	sp|P62847-2|RS24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=9174	59.559	2	2365.1049	2365.1049	R	K	62	84
PSM	TITGFQTHTTPVLLAHGER	53	sp|Q13200|PSMD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	19-UNIMOD:267	ms_run[2]:scan=6216	40.445	2	2088.0992	2088.0992	K	A	861	880
PSM	QLFHPEQLITGKEDAANNYAR	54	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	1-UNIMOD:28,12-UNIMOD:188,21-UNIMOD:267	ms_run[1]:scan=9066	58.804233333333336	2	2413.2010	2413.1992	R	G	85	106
PSM	QQSHFAMMHGGTGFAGIDSSSPEVK	55	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	1-UNIMOD:28,25-UNIMOD:188	ms_run[1]:scan=7664	49.63639833333333	3	2594.1667	2594.1620	R	G	244	269
PSM	MREIVHIQAGQCGNQIGAK	56	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	1-UNIMOD:35,2-UNIMOD:267,12-UNIMOD:4,19-UNIMOD:188	ms_run[1]:scan=3926	26.295140000000004	2	2141.077611	2141.080475	-	F	1	20
PSM	AEVQKLQMEAPHIIVGTPGR	57	sp|P60842-2|IF4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=6985	45.3	2	2173.1678	2173.1678	R	V	142	162
PSM	AHDGGIYAISWSPDSTHLLSASGDKTSK	58	sp|O75083|WDR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=8180	53.007	2	2900.3941	2900.3941	K	I	232	260
PSM	FHDPDSAVVAQHLTNTVFVDR	59	sp|Q05519-2|SRS11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=8210	53.206	2	2367.1608	2367.1608	K	A	83	104
PSM	GFGFVYFQNHDAADKAAVVK	60	sp|Q13151|ROA0_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	15-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=7830	50.686	2	2195.1202	2195.1202	R	F	140	160
PSM	HADHSSLTLGSGSSTTR	61	sp|Q7Z6Z7-2|HUWE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=2060	14.945	2	1712.8078	1712.8078	R	L	2522	2539
PSM	HGLLVPNNTTDQELQHIR	62	sp|P56537|IF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=6149	40.022	2	2084.0763	2084.0763	R	N	68	86
PSM	HLAGLGLTEAIDKNK	63	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=5704	37.217	2	1578.873	1578.8730	K	A	320	335
PSM	HLIPAANTGESKVFYYK	64	sp|P62258-2|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	12-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=5867	38.246	2	1949.045	1949.0450	K	M	85	102
PSM	HNIQFSSFDIFSDEEVRQGLK	65	sp|O76003|GLRX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=10282	66.972	2	2495.2081	2495.2081	K	A	172	193
PSM	HWILPQDYDHAQAEAR	66	sp|Q15293-2|RCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=5943	38.715	2	1948.918	1948.9180	R	H	220	236
PSM	KFDEVLVNHFCEEFGK	67	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	11-UNIMOD:4	ms_run[2]:scan=8747	56.741	2	1996.9353	1996.9353	R	K	235	251
PSM	KLYGAQFHPEVGLTENGK	68	sp|P49915-2|GUAA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=5803	37.845	2	1999.0566	1999.0566	K	V	84	102
PSM	NVTGILWNLSSSDHLKDR	69	sp|Q9Y446|PKP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=8986	58.275	2	2054.0545	2054.0545	K	L	422	440
PSM	RAVPLALALISVSNPR	70	sp|Q13200|PSMD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=10473	68.233	2	1696.0263	1696.0263	R	L	688	704
PSM	RFTAQGLPDLNHSQVYAVK	71	sp|Q92900-2|RENT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=6787	44.064	2	2143.1174	2143.1174	K	T	462	481
PSM	TADEVPLKILAHNNFVGR	72	sp|Q9NZI8|IF2B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=8255	53.494	2	1993.0745	1993.0745	K	L	273	291
PSM	THFGGGKTTGFGMIYDSLDYAK	73	sp|P62847-2|RS24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	7-UNIMOD:188,22-UNIMOD:188	ms_run[2]:scan=9182	59.611	2	2377.1451	2377.1451	R	K	62	84
PSM	TREGNDLYHEMIESGVINLK	74	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=9696	63.028	2	2317.1372	2317.1372	R	D	240	260
PSM	VIHLSNLPHSGYSDSAVLK	75	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=6491	42.191	2	2036.0691	2036.0691	R	L	497	516
PSM	TCVHTFFDHQDQVWGVK	76	sp|Q9GZS3|WDR61_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	2-UNIMOD:4	ms_run[1]:scan=7674	49.698948333333334	2	2103.967780	2102.963245	R	Y	265	282
PSM	MREIVHIQAGQCGNQIGAK	77	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	1-UNIMOD:35,12-UNIMOD:4	ms_run[1]:scan=3928	26.306888333333337	2	2125.049752	2125.052077	-	F	1	20
PSM	AHAAQVTCVAASPHKDSVFLSCSEDNR	78	sp|Q9BQA1|MEP50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	8-UNIMOD:4,22-UNIMOD:4	ms_run[2]:scan=4780	31.533	2	2956.3556	2956.3556	R	I	165	192
PSM	AHVSPHEMLQAVVLCSK	79	sp|Q53GS9-2|SNUT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	15-UNIMOD:4	ms_run[2]:scan=7290	47.21	2	1904.9601	1904.9601	K	K	189	206
PSM	ASPAPGSGHPEGPGAHLDMNSLDR	80	sp|O94826|TOM70_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=5227	34.287	2	2369.0819	2369.0819	R	A	90	114
PSM	DNVSSPGGATIHALHVLESGGFR	81	sp|P32322-2|P5CR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=10413	67.837	2	2320.156	2320.1560	K	S	229	252
PSM	GFGFVYFQNHDAADKAAVVK	82	sp|Q13151|ROA0_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=7825	50.654	2	2183.08	2183.0800	R	F	140	160
PSM	HADHSSLTLGSGSSTTR	83	sp|Q7Z6Z7-2|HUWE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	17-UNIMOD:267	ms_run[2]:scan=2059	14.939	2	1722.8161	1722.8161	R	L	2522	2539
PSM	HGVYNPNKIFGVTTLDIVR	84	sp|P40926|MDHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=9254	60.08	2	2142.1586	2142.1586	K	A	158	177
PSM	HIDSAHLYNNEEQVGLAIR	85	sp|P42330|AK1C3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=6456	41.971	3	2178.0818	2178.0818	R	S	48	67
PSM	HKDAAIYLVTSLASK	86	sp|P55060-4|XPO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	2-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=7728	50.04	2	1627.9336	1627.9336	K	A	370	385
PSM	HLAGLGLTEAIDKNK	87	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	13-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=5700	37.196	2	1590.9132	1590.9132	K	A	320	335
PSM	HLEINPDHPIVETLR	88	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=6515	42.342	2	1781.9424	1781.9424	K	Q	625	640
PSM	KISSIQSIVPALEIANAHR	89	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=9118	59.184	3	2046.1586	2046.1586	K	K	250	269
PSM	LNFHPDQEDQFFSLVHEK	90	sp|Q969Z0-2|FAKD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=9327	60.589	2	2229.0491	2229.0491	R	L	269	287
PSM	MHTTFEHDIQALGTQVR	91	sp|Q01082-3|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=7218	46.74	2	1982.9632	1982.9632	R	Q	1832	1849
PSM	MKQVEELYHSLLELGEK	92	sp|Q13813-2|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:35	ms_run[2]:scan=10026	65.251	2	2061.0452	2061.0452	R	R	1066	1083
PSM	MKQVEELYHSLLELGEK	93	sp|Q13813-2|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:35	ms_run[2]:scan=10028	65.267	3	2061.0452	2061.0452	R	R	1066	1083
PSM	MNLASEPQEVLHIGSAHNR	94	sp|O00151|PDLI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:35,19-UNIMOD:267	ms_run[2]:scan=6253	40.685	2	2128.0359	2128.0359	K	S	104	123
PSM	NIKHSGNITFDEIVNIAR	95	sp|P30050-2|RL12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=8819	57.206	2	2040.0752	2040.0752	K	Q	64	82
PSM	QQSHFAMMHGGTGFAGIDSSSPEVK	96	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=6709	43.575	2	2605.169	2605.1690	R	G	244	269
PSM	RATVAPEDVSEVIFGHVLAAGCGQNPVR	97	sp|Q9BWD1|THIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	22-UNIMOD:4	ms_run[2]:scan=11192	73.173	3	2948.4927	2948.4927	K	Q	44	72
PSM	RVIISAPSADAPMFVMGVNHEK	98	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=8281	53.658	3	2368.2032	2368.2032	K	Y	76	98
PSM	SHLLDCCPHDILAGTR	99	sp|Q9NQ29-2|LUC7L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:4,7-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=6181	40.225	2	1873.8803	1873.8803	K	M	38	54
PSM	TNRLAELEEFINGPNNAHIQQVGDR	100	sp|Q00610-2|CLH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=9879	64.259	3	2834.406	2834.4060	K	C	1180	1205
PSM	VIHLSNLPHSGYSDSAVLK	101	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	19-UNIMOD:188	ms_run[2]:scan=6492	42.198	2	2042.0892	2042.0892	R	L	497	516
PSM	YSHLQPGDHLTDITLK	102	sp|Q15046|SYK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=6139	39.962	2	1836.937	1836.9370	K	V	112	128
PSM	YYVTIIDAPGHRDFIK	103	sp|Q5VTE0|EF1A3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=7389	47.854	2	1906.9941	1906.9941	K	N	85	101
PSM	QQSHFAMMHGGTGFAGIDSSSPEVK	104	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:28	ms_run[1]:scan=7670	49.67136	2	2588.1458	2588.1419	R	G	244	269
PSM	SHVETAGHNIDTCYHVSITEK	105	sp|Q86SQ0|PHLB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	13-UNIMOD:4,21-UNIMOD:188	ms_run[1]:scan=4599	30.450788333333335	2	2404.117391	2403.122052	R	T	1124	1145
PSM	SAVGAATPYLHHPGDSHSGR	106	sp|Q9GZQ3|COMD5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:1,20-UNIMOD:267	ms_run[1]:scan=4796	31.635820000000002	2	2067.9852	2067.9742	M	V	2	22
PSM	AGKFPSLLTHNENMVAK	107	sp|P62906|RL10A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=6015	39.166	2	1868.0017	1868.0017	K	V	131	148
PSM	AHDGGIYAISWSPDSTHLLSASGDKTSK	108	sp|O75083|WDR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	25-UNIMOD:188,28-UNIMOD:188	ms_run[2]:scan=8175	52.974	2	2912.4343	2912.4343	K	I	232	260
PSM	AHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLR	109	sp|P46937-5|YAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=8286	53.687	3	3533.859	3533.8590	R	Q	125	162
PSM	DKLESEMEDAYHEHQANLLR	110	sp|P23246-2|SFPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=7655	49.581	2	2427.1125	2427.1125	K	Q	517	537
PSM	FQEHIIQAPKPVEAIK	111	sp|Q9UHD1-2|CHRD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=5818	37.942	2	1847.0305	1847.0305	K	R	73	89
PSM	FVIHCNSPVWGADKCEELLEK	112	sp|O75367-2|H2AY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:4,14-UNIMOD:188,15-UNIMOD:4,21-UNIMOD:188	ms_run[2]:scan=7837	50.732	2	2542.2387	2542.2387	K	T	269	290
PSM	GHKEIINAIDGIGGLGIGEGAPEIVTGSR	113	sp|Q96MX6-2|WDR92_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=10211	66.503	3	2829.4985	2829.4985	K	D	109	138
PSM	HGLLVPNNTTDQELQHIR	114	sp|P56537|IF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	18-UNIMOD:267	ms_run[2]:scan=6147	40.011	2	2094.0846	2094.0846	R	N	68	86
PSM	HIHSQVTVQINSAEQEIK	115	sp|Q70UQ0-4|IKIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=5362	35.123	2	2060.0651	2060.0651	K	L	179	197
PSM	HVINFDLPSDIEEYVHR	116	sp|O00571-2|DDX3X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=10561	68.822	2	2082.0171	2082.0171	K	I	496	513
PSM	HVVWHPSQELLASASYDDTVK	117	sp|O76071|CIAO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=7374	47.754	2	2381.1652	2381.1652	K	L	155	176
PSM	ISIEMHGTLEDQLSHLR	118	sp|P12814-2|ACTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	17-UNIMOD:267	ms_run[2]:scan=8859	57.468	2	1988.0025	1988.0025	R	Q	656	673
PSM	ITHQIVDRPGQQTSVIGR	119	sp|O00541-2|PESC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=3797	25.526	2	2004.0865	2004.0865	R	C	368	386
PSM	IVGAPMHDLLLWNNATVTTCHSK	120	sp|P11586|C1TC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	20-UNIMOD:4	ms_run[2]:scan=9539	61.992	2	2577.2832	2577.2832	K	T	176	199
PSM	IVGCSVHKGFAFVQYVNER	121	sp|P07910-4|HNRPC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:4	ms_run[2]:scan=7171	46.45	2	2209.1102	2209.1102	K	N	43	62
PSM	KGIAFPTSISVNNCVCHFSPLK	122	sp|Q9UQ80-2|PA2G4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:188,14-UNIMOD:4,16-UNIMOD:4,22-UNIMOD:188	ms_run[2]:scan=9202	59.744	2	2487.2805	2487.2805	K	S	18	40
PSM	KHFVCEGCEQLLSGR	123	sp|Q9NZU5-2|LMCD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=4754	31.372	2	1818.8505	1818.8505	R	A	258	273
PSM	KLDYGQHVVAGTPGR	124	sp|P38919|IF4A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=3250	22.16	2	1596.8372	1596.8372	R	V	152	167
PSM	KNGGLGHMNIALLSDLTK	125	sp|P30048-2|PRDX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=9439	61.329	2	1881.0142	1881.0142	R	Q	131	149
PSM	KTFSHELSDFGLESTAGEIPVVAIR	126	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=10353	67.442	2	2702.3915	2702.3915	R	T	305	330
PSM	SHLLNCCPHDVLSGTR	127	sp|Q9Y383-3|LC7L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=4830	31.846	2	1864.8672	1864.8672	K	M	35	51
PSM	SHLLNCCPHDVLSGTR	128	sp|Q9Y383-3|LC7L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:4,7-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=4833	31.861	2	1874.8755	1874.8755	K	M	35	51
PSM	TGVHHYSGNNIELGTACGK	129	sp|P62888|RL30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	17-UNIMOD:4,19-UNIMOD:188	ms_run[2]:scan=3236	22.077	2	2019.9528	2019.9528	K	Y	69	88
PSM	TYFPHFDLSHGSAQVK	130	sp|P69905|HBA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=7116	46.116	2	1832.8846	1832.8846	K	G	42	58
PSM	VALLSGGGSGHEPAHAGFIGK	131	sp|Q3LXA3-2|TKFC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=5550	36.271	2	1961.0119	1961.0119	R	G	49	70
PSM	YGDGGSSFQSTTGHCVHMR	132	sp|P55795|HNRH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	15-UNIMOD:4,19-UNIMOD:267	ms_run[2]:scan=3706	24.956	2	2092.8719	2092.8719	R	G	276	295
PSM	MREIVHIQAGQCGNQIGAK	133	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	1-UNIMOD:1,12-UNIMOD:4	ms_run[1]:scan=4149	27.665463333333335	2	2152.057538	2151.067727	-	F	1	20
PSM	KFLSDPQVHTVLVER	134	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0		ms_run[1]:scan=5964	38.843215	2	1766.964507	1766.967919	R	S	67	82
PSM	NVEGVEEVHELHVWQLAGSR	135	sp|Q9Y6M5|ZNT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	20-UNIMOD:267	ms_run[1]:scan=8256	53.50001333333333	2	2298.148340	2297.142813	R	I	362	382
PSM	FQGIKHECQANGPEDLNR	136	sp|P60981|DEST_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	5-UNIMOD:188,8-UNIMOD:4,18-UNIMOD:267	ms_run[1]:scan=3381	22.947266666666664	2	2128.004847	2128.009084	K	A	128	146
PSM	QQSHFAMMHGGTGFAGIDSSSPEVK	137	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:28,25-UNIMOD:188	ms_run[1]:scan=7669	49.66511166666666	2	2594.1661	2594.1620	R	G	244	269
PSM	FQGIKHECQANGPEDLNR	138	sp|P60981|DEST_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	8-UNIMOD:4	ms_run[1]:scan=3362	22.826808333333336	2	2111.976776	2111.980686	K	A	128	146
PSM	MLEIDPQKVNINGGAVSLGHPIGMSGAR	139	sp|P24752|THIL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	1-UNIMOD:35	ms_run[1]:scan=8557	55.50640666666666	3	2877.449907	2876.463683	K	I	366	394
PSM	AHSIQIMKVEEIAASK	140	sp|Q02543|RL18A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	8-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=6237	40.58	2	1765.9799	1765.9799	R	C	121	137
PSM	AHVSPHEMLQAVVLCSK	141	sp|Q53GS9-2|SNUT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	15-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=7288	47.197	2	1910.9802	1910.9802	K	K	189	206
PSM	ASPAPGSGHPEGPGAHLDMNSLDR	142	sp|O94826|TOM70_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	24-UNIMOD:267	ms_run[2]:scan=5224	34.27	2	2379.0901	2379.0901	R	A	90	114
PSM	ECLQALEFLHANQVIHR	143	sp|Q13177|PAK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	2-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=8894	57.694	2	2087.061	2087.0610	R	D	351	368
PSM	FVIHCNSPVWGADKCEELLEK	144	sp|O75367-2|H2AY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	5-UNIMOD:4,14-UNIMOD:188,15-UNIMOD:4,21-UNIMOD:188	ms_run[2]:scan=7820	50.628	3	2542.2387	2542.2387	K	T	269	290
PSM	GGGGPGGGGPGGGSAGGPSQPPGGGGPGIRK	145	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=2639	18.448	2	2397.1534	2397.1534	R	D	41	72
PSM	GHYTEGAELVDSVLDVVR	146	sp|P68371|TBB4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	18-UNIMOD:267	ms_run[2]:scan=11887	78.245	2	1967.9828	1967.9828	K	K	104	122
PSM	HKELAPYDENWFYTR	147	sp|P39019|RS19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=7541	48.847	2	1967.9166	1967.9166	K	A	42	57
PSM	HLCICSVDPPGCTDIDDALHCR	148	sp|Q9Y2L1-2|RRP44_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:4,5-UNIMOD:4,12-UNIMOD:4,21-UNIMOD:4	ms_run[2]:scan=7718	49.978	2	2610.1083	2610.1083	R	E	442	464
PSM	HLIPAANTGESKVFYYK	149	sp|P62258-2|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=5865	38.235	2	1937.0047	1937.0047	K	M	85	102
PSM	HLQVNVTNPVQCSLHGK	150	sp|O94832|MYO1D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	12-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=5357	35.094	3	1936.0044	1936.0044	R	K	959	976
PSM	HSQFLGYPITLYLEKER	151	sp|Q58FF8|H90B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=9723	63.2	3	2093.0946	2093.0946	K	E	127	144
PSM	HSQFLGYPITLYLEKER	152	sp|Q58FF8|H90B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=9726	63.216	2	2093.0946	2093.0946	K	E	127	144
PSM	HTLEQHNWNIEAAVQDR	153	sp|Q96CS3|FAF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=6281	40.86	2	2059.9824	2059.9824	R	L	34	51
PSM	HVFGQAVKNDQCYDDIR	154	sp|Q9ULV4|COR1C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	12-UNIMOD:4	ms_run[2]:scan=4553	30.173	2	2063.9483	2063.9483	R	V	12	29
PSM	IHYIGQNEPELLVAHAYTR	155	sp|P30519-2|HMOX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=7645	49.521	3	2223.1437	2223.1437	R	Y	109	128
PSM	INMAHLCIVGSHAVNGVAK	156	sp|P06737-2|PYGL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	7-UNIMOD:4,19-UNIMOD:188	ms_run[2]:scan=6580	42.768	2	1996.0442	1996.0442	R	I	406	425
PSM	ITHQIVDRPGQQTSVIGR	157	sp|O00541-2|PESC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	8-UNIMOD:267,18-UNIMOD:267	ms_run[2]:scan=3815	25.636	2	2024.103	2024.1030	R	C	368	386
PSM	IVGAPMHDLLLWNNATVTTCHSK	158	sp|P11586|C1TC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	20-UNIMOD:4	ms_run[2]:scan=9534	61.962	3	2577.2832	2577.2832	K	T	176	199
PSM	LAAAILGGVDQIHIKPGAK	159	sp|P22087|FBRL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=7619	49.35	2	1871.0993	1871.0993	K	V	144	163
PSM	LTHYDHVLIELTQAGLK	160	sp|Q14566|MCM6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=9425	61.239	2	1950.0575	1950.0575	R	G	780	797
PSM	MKQVEELYHSLLELGEK	161	sp|Q13813-2|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:35,2-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=10030	65.279	2	2073.0855	2073.0855	R	R	1066	1083
PSM	RFDEILEASDGIMVAR	162	sp|P14618-3|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=9466	61.51	2	1840.9256	1840.9256	R	G	264	280
PSM	RGEAHLAVNDFELAR	163	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=6200	40.342	2	1696.8645	1696.8645	R	A	359	374
PSM	TGVHHYSGNNIELGTACGK	164	sp|P62888|RL30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	17-UNIMOD:4	ms_run[2]:scan=3242	22.115	2	2013.9327	2013.9327	K	Y	69	88
PSM	TITGFQTHTTPVLLAHGER	165	sp|Q13200|PSMD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=6184	40.243	2	2078.0909	2078.0909	K	A	861	880
PSM	VILHLKEDQTEYLEER	166	sp|P07900-2|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=6208	40.392	2	2014.0371	2014.0371	K	R	308	324
PSM	AGHFDKEIVPVLVSTR	167	sp|Q9BWD1|THIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=6885	44.681	2	1766.9679	1766.9679	K	K	195	211
PSM	AHDGGIYAISWSPDSTHLLSASGDKTSK	168	sp|O75083|WDR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=8171	52.95	3	2900.3941	2900.3941	K	I	232	260
PSM	AHIVFDFHQAADGIQEQQR	169	sp|P30520|PURA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	19-UNIMOD:267	ms_run[2]:scan=7143	46.281	3	2219.0747	2219.0747	R	Q	133	152
PSM	AHSIQIMKVEEIAASK	170	sp|Q02543|RL18A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=6229	40.527	2	1753.9397	1753.9397	R	C	121	137
PSM	GHLSRPEAQSLSPYTTSANR	171	sp|O94776|MTA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=4188	27.905	2	2171.0719	2171.0719	R	A	424	444
PSM	GKHDELADSLPCAEGEFIFLR	172	sp|Q9H0D6-2|XRN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	12-UNIMOD:4	ms_run[2]:scan=10718	69.877	2	2403.1529	2403.1529	K	L	209	230
PSM	HGYIGEFEIIDDHR	173	sp|P62244|RS15A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	14-UNIMOD:267	ms_run[2]:scan=7187	46.548	2	1709.8037	1709.8037	K	A	44	58
PSM	HGYIGEFEIIDDHR	174	sp|P62244|RS15A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=7185	46.533	2	1699.7954	1699.7954	K	A	44	58
PSM	HIVNHAVVNEDPNAR	175	sp|Q9NQT8|KI13B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	15-UNIMOD:267	ms_run[2]:scan=2000	14.583	2	1693.8524	1693.8524	K	I	352	367
PSM	HKVLQSQLDTLLQGQESIK	176	sp|Q9C040|TRIM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=7668	49.659	2	2176.2254	2176.2254	K	S	234	253
PSM	HLLQAPVDDAQEILHSR	177	sp|Q15436-2|SC23A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=7865	50.912	3	1941.0068	1941.0068	R	F	481	498
PSM	HLNEIDLFHCIDPNDSK	178	sp|Q15185-3|TEBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	10-UNIMOD:4	ms_run[2]:scan=8544	55.424	2	2065.9527	2065.9527	K	H	49	66
PSM	HRDGGEALVSPDGTVTEAPR	179	sp|Q96HN2-2|SAHH3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=4284	28.505	2	2063.0032	2063.0032	R	T	98	118
PSM	HTDSWLHTSELNDGYDWGR	180	sp|Q9H089|LSG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	19-UNIMOD:267	ms_run[2]:scan=7834	50.709	2	2297.9965	2297.9965	R	L	29	48
PSM	HVAEVLEYTKDEQLESLFQR	181	sp|P05198|IF2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=9640	62.663	3	2433.2176	2433.2176	R	T	114	134
PSM	HVINFDLPSDIEEYVHR	182	sp|O00571-2|DDX3X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	17-UNIMOD:267	ms_run[2]:scan=10551	68.756	3	2092.0253	2092.0253	K	I	496	513
PSM	HVINFDLPSDIEEYVHR	183	sp|O00571-2|DDX3X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=10552	68.762	3	2082.0171	2082.0171	K	I	496	513
PSM	IFASIAPSIYGHEDIKR	184	sp|P49736|MCM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=6962	45.156	2	1916.0156	1916.0156	K	G	477	494
PSM	ILFLDPSGKVHPEIINENGNPSYK	185	sp|O95881|TXD12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=8722	56.585	2	2680.3861	2680.3861	R	Y	115	139
PSM	ILGSGISSSSVLHGMVFKK	186	sp|P50990|TCPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	18-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=8089	52.365	2	1958.1062	1958.1062	K	E	207	226
PSM	ISIENSEEALTVHAPFPAAHPASR	187	sp|Q9Y653-2|AGRG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=7944	51.416	2	2543.2769	2543.2769	R	S	56	80
PSM	KGIAFPTSISVNNCVCHFSPLK	188	sp|Q9UQ80-2|PA2G4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:188,14-UNIMOD:4,16-UNIMOD:4,22-UNIMOD:188	ms_run[2]:scan=9193	59.686	3	2487.2805	2487.2805	K	S	18	40
PSM	KIGDLACANIQHLSSR	189	sp|Q7L8L6|FAKD5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:4	ms_run[2]:scan=5766	37.61	2	1781.9207	1781.9207	R	S	339	355
PSM	KIHTEPQLSAALEYVR	190	sp|P47897|SYQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=7188	46.554	2	1853.9999	1853.9999	K	S	80	96
PSM	LKGEMMDLQHGSLFLQTPK	191	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=8344	54.064	2	2172.1071	2172.1071	K	I	59	78
PSM	LLHVAVSDVNDDVRR	192	sp|Q99460-2|PSMD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=5216	34.223	2	1706.9064	1706.9064	R	A	602	617
PSM	LPEYTLSQEGGPAHKR	193	sp|O75569-3|PRKRA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=3996	26.734	2	1781.906	1781.9060	R	E	117	133
PSM	LQFHDVAGDIFHQQCK	194	sp|P11413|G6PD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	15-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=7726	50.028	2	1947.9357	1947.9357	R	R	371	387
PSM	LQGQKEPGDQGPAHPPGADMSHSL	195	sp|Q9Y399|RT02_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=4529	30.025	2	2453.1394	2453.1394	R	-	273	297
PSM	RECPSDECGAGVFMASHFDR	196	sp|P62979|RS27A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:267,3-UNIMOD:4,8-UNIMOD:4,20-UNIMOD:267	ms_run[2]:scan=6644	43.162	3	2346.9683	2346.9683	R	H	119	139
PSM	RLVHQNSASDDAEASMISK	197	sp|Q13616|CUL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=3226	22.013	3	2057.98	2057.9800	K	L	473	492
PSM	SLVEIIEHGLVDEQQKVR	198	sp|O75533|SF3B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=11190	73.16	3	2091.1324	2091.1324	R	T	685	703
PSM	THINIVVIGHVDSGK	199	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=5718	37.305	2	1587.8733	1587.8733	K	S	6	21
PSM	THINIVVIGHVDSGK	200	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=5885	38.352	2	1587.8733	1587.8733	K	S	6	21
PSM	TPFLLSGTSYKDLMPHDLAR	201	sp|P55084-2|ECHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=10273	66.912	2	2261.1514	2261.1514	R	A	40	60
PSM	VIGIDHIKELVDDSVNNVR	202	sp|P22061|PIMT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=10381	67.628	2	2134.1382	2134.1382	K	K	106	125
PSM	YFLHDDRDDGVDYWAK	203	sp|Q9NYF8-2|BCLF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=7172	46.456	2	2013.8857	2013.8857	K	R	844	860
PSM	KFLSDPQVHTVLVER	204	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	1-UNIMOD:188,15-UNIMOD:267	ms_run[1]:scan=5962	38.831516666666666	2	1782.994151	1782.996317	R	S	67	82
PSM	QLFHPEQLITGKEDAANNYAR	205	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:28,12-UNIMOD:188,21-UNIMOD:267	ms_run[1]:scan=9080	58.896746666666665	3	2413.2020	2413.1992	R	G	85	106
PSM	QLFHPEQLITGKEDAANNYAR	206	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:28	ms_run[1]:scan=9068	58.81604833333333	2	2397.1729	2397.1708	R	G	85	106
PSM	HLQLAIRNDEELNK	207	sp|Q96QV6|H2A1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	7-UNIMOD:267,14-UNIMOD:188	ms_run[1]:scan=5361	35.11732	2	1708.906514	1707.923880	R	L	83	97
PSM	HGLLVPNNTTDQELQHIR	208	sp|P56537|IF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=6931	44.96711833333333	3	2085.057236	2084.076300	R	N	68	86
PSM	HEDLKDMLEFPAQELR	209	sp|O00267|SPT5H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=9902	64.42107166666666	2	1971.963926	1969.956762	K	K	454	470
PSM	AHIVFDFHQAADGIQEQQR	210	sp|P30520|PURA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=7153	46.34	3	2209.0665	2209.0665	R	Q	133	152
PSM	AIQGGTSHHLGQNFSK	211	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=2311	16.471	2	1680.8332	1680.8332	R	M	1235	1251
PSM	DKQNLHENLQGLGPGVR	212	sp|Q9ULE6|PALD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=4781	31.54	2	1873.9759	1873.9759	R	V	184	201
PSM	FGPDTQHLVLNENCASVHNLR	213	sp|Q9BQ52-2|RNZ2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	14-UNIMOD:4	ms_run[2]:scan=6625	43.04	3	2420.1655	2420.1655	R	S	267	288
PSM	FNDEHIPESPYLVPVIAPSDDARR	214	sp|O75369-7|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	23-UNIMOD:267,24-UNIMOD:267	ms_run[2]:scan=8736	56.673	2	2756.3673	2756.3673	K	L	2086	2110
PSM	FVIHCNSPVWGADKCEELLEK	215	sp|O75367-2|H2AY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	5-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=7828	50.676	3	2530.1985	2530.1985	K	T	269	290
PSM	GLAPDLPEDLYHLIKK	216	sp|P62277|RS13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	15-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=10884	71.028	2	1833.0439	1833.0439	K	A	79	95
PSM	GLQCHPSKPLLASCGLDR	217	sp|Q6RFH5-2|WDR74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	4-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=4811	31.729	2	2007.9982	2007.9983	R	V	274	292
PSM	HGLLVPNNTTDQELQHIR	218	sp|P56537|IF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=6145	40.001	3	2084.0763	2084.0763	R	N	68	86
PSM	HIHITQATETTTTR	219	sp|Q14677|EPN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	14-UNIMOD:267	ms_run[2]:scan=2030	14.761	2	1618.8303	1618.8303	K	H	261	275
PSM	HLVLLDTAQAAAAGHR	220	sp|O00754-2|MA2B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	16-UNIMOD:267	ms_run[2]:scan=6563	42.66	3	1652.8986	1652.8986	R	L	841	857
PSM	HQAFEAELHANADR	221	sp|Q13813-2|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=3518	23.81	2	1607.7441	1607.7441	K	I	1597	1611
PSM	HSQFLGYPITLYLEKER	222	sp|Q58FF8|H90B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=9872	64.211	3	2093.0946	2093.0946	K	E	127	144
PSM	IHVFYIDYGNREVLPSTR	223	sp|Q7KZF4|SND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	11-UNIMOD:267,18-UNIMOD:267	ms_run[2]:scan=8114	52.539	2	2198.1387	2198.1387	K	L	759	777
PSM	IKSEHPGLSIGDTAK	224	sp|P26583|HMGB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=3113	21.334	2	1551.8257	1551.8257	K	K	113	128
PSM	KAHEILPNLVCCSAK	225	sp|P50990|TCPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	11-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=5489	35.895	2	1738.8858	1738.8858	R	N	138	153
PSM	KAHEILPNLVCCSAK	226	sp|P50990|TCPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:188,11-UNIMOD:4,12-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=5511	36.031	2	1750.9261	1750.9261	R	N	138	153
PSM	KFDPMGQQTCSAHPAR	227	sp|Q9NPE3|NOP10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	10-UNIMOD:4	ms_run[2]:scan=2834	19.608	2	1829.8301	1829.8301	K	F	19	35
PSM	KGIAFPTSISVNNCVCHFSPLK	228	sp|Q9UQ80-2|PA2G4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	14-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=9201	59.738	2	2475.2403	2475.2403	K	S	18	40
PSM	LKAEPAAPPAAPSTPAPPPAVPK	229	sp|P48634-4|PRC2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=5106	33.537	2	2174.2099	2174.2099	R	E	504	527
PSM	LKGIEEEEILPGFILCDPNNLCHSGR	230	sp|P15170|ERF3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	16-UNIMOD:4,22-UNIMOD:4	ms_run[2]:scan=10850	70.799	3	3009.4688	3009.4688	R	T	366	392
PSM	LNCQVIGASVDSHFCHLAWVNTPK	231	sp|Q06830|PRDX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:4,15-UNIMOD:4,24-UNIMOD:188	ms_run[2]:scan=9212	59.809	2	2758.3415	2758.3415	K	K	69	93
PSM	LQFHNVKPECLEAYNK	232	sp|O75323|NIPS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	10-UNIMOD:4	ms_run[2]:scan=5769	37.628	2	1988.9778	1988.9778	K	I	76	92
PSM	LQGQKEPGDQGPAHPPGADMSHSL	233	sp|Q9Y399|RT02_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	5-UNIMOD:188	ms_run[2]:scan=4530	30.032	2	2459.1595	2459.1595	R	-	273	297
PSM	LRGIEQAVQSHAVAEEEAR	234	sp|Q16891-3|MIC60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	2-UNIMOD:267,19-UNIMOD:267	ms_run[2]:scan=5258	34.476	3	2112.0827	2112.0827	R	K	514	533
PSM	NRLQQELDDLTVDLDHQR	235	sp|P35580|MYH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=10452	68.098	3	2207.0931	2207.0931	K	Q	1423	1441
PSM	QQSHFAMMHGGTGFAGIDSSSPEVK	236	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	25-UNIMOD:188	ms_run[2]:scan=6707	43.564	2	2611.1891	2611.1891	R	G	244	269
PSM	RGEAHLAVNDFELAR	237	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:267,15-UNIMOD:267	ms_run[2]:scan=6192	40.292	2	1716.8811	1716.8811	R	A	359	374
PSM	RHEILQWVLQTDSQQ	238	sp|Q96AG4|LRC59_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:267	ms_run[2]:scan=8997	58.347	2	1889.9623	1889.9623	R	-	293	308
PSM	RVHVTQEDFEMAVAK	239	sp|P62195-2|PRS8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=5498	35.948	2	1758.8723	1758.8723	R	V	367	382
PSM	RVIISAPSADAPMFVMGVNHEK	240	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=8285	53.681	2	2368.2032	2368.2032	K	Y	76	98
PSM	SKGLAPDLPEDLYHLIK	241	sp|P62277|RS13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	2-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=10654	69.442	2	1920.0759	1920.0759	K	K	77	94
PSM	SKGLAPDLPEDLYHLIK	242	sp|P62277|RS13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=10647	69.395	2	1908.0357	1908.0357	K	K	77	94
PSM	TCVHTFFDHQDQVWGVK	243	sp|Q9GZS3|WDR61_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	2-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=7673	49.693	2	2108.9834	2108.9834	R	Y	265	282
PSM	TFKTVFAEHISDECK	244	sp|P39023|RL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:188,14-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=5810	37.891	2	1822.8962	1822.8962	R	R	101	116
PSM	THDHQLESSLSPVEVFAK	245	sp|Q9H410-4|DSN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=7367	47.708	2	2023.0011	2023.0011	K	T	4	22
PSM	THINIVVIGHVDSGK	246	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	15-UNIMOD:188	ms_run[2]:scan=6217	40.451	2	1593.8934	1593.8934	K	S	6	21
PSM	THINIVVIGHVDSGK	247	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=6461	41.997	2	1587.8733	1587.8733	K	S	6	21
PSM	TLGKDHPAVAATLNNLAVLYGK	248	sp|Q9H0B6-2|KLC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=9430	61.27	2	2265.2481	2265.2481	K	R	196	218
PSM	TLREQGVEEHETLLLR	249	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=5651	36.9	2	1922.0221	1922.0221	R	R	179	195
PSM	TTNAGPLHPYWPQHLR	250	sp|Q15125|EBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:1	ms_run[2]:scan=7756	50.214	2	1928.9646	1928.9646	M	L	2	18
PSM	TTNAGPLHPYWPQHLR	251	sp|Q15125|EBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:1,16-UNIMOD:267	ms_run[2]:scan=7765	50.269	2	1938.9728	1938.9728	M	L	2	18
PSM	VAHSFNCTPIEGMLSHQLK	252	sp|Q9UQ80-2|PA2G4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	7-UNIMOD:4	ms_run[2]:scan=7985	51.679	2	2168.0507	2168.0507	K	Q	119	138
PSM	VAHSFNCTPIEGMLSHQLK	253	sp|Q9UQ80-2|PA2G4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	7-UNIMOD:4,19-UNIMOD:188	ms_run[2]:scan=7998	51.764	2	2174.0708	2174.0708	K	Q	119	138
PSM	HSQFLGYPITLYLEKER	254	sp|Q58FF8|H90B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	15-UNIMOD:188,17-UNIMOD:267	ms_run[1]:scan=9729	63.23845333333333	2	2109.125746	2109.122974	K	E	127	144
PSM	CTHWAEGGKGALALAQAVQR	255	sp|P11586|C1TC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	1-UNIMOD:4	ms_run[1]:scan=6830	44.337271666666666	3	2124.071677	2123.069441	K	A	785	805
PSM	HLQLAIRNDEELNK	256	sp|Q96QV6|H2A1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=5358	35.099175	2	1692.879689	1691.895482	R	L	83	97
PSM	LHHQNQQQIQQQQQQLQR	257	sp|Q96RN5|MED15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	18-UNIMOD:267	ms_run[1]:scan=1857	13.722655	2	2321.172282	2320.177241	K	I	223	241
PSM	MREIVHIQAGQCGNQIGAK	258	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	2-UNIMOD:267,12-UNIMOD:4,19-UNIMOD:188	ms_run[1]:scan=4658	30.807153333333332	3	2125.083046	2125.085560	-	F	1	20
PSM	ACQSIYPLHDVFVRK	259	sp|P61247|RS3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:4	ms_run[2]:scan=6994	45.356	2	1831.9403	1831.9403	K	V	200	215
PSM	AGSRYEDFSNLGTTHLLR	260	sp|P22695|QCR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=7145	46.291	2	2036.0076	2036.0076	K	L	67	85
PSM	AIQGGTSHHLGQNFSK	261	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	16-UNIMOD:188	ms_run[2]:scan=2312	16.477	2	1686.8533	1686.8533	R	M	1235	1251
PSM	EFTMAEIEHFVDPSEKDHPK	262	sp|P41250|GARS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	16-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=9778	63.562	2	2397.135	2397.1350	R	F	345	365
PSM	FCNPGFPIGCYITDKGHAK	263	sp|Q99805|TM9S2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=7867	50.923	2	2181.0136	2181.0136	R	D	173	192
PSM	FQAKLEHEYIQNFK	264	sp|Q15691|MARE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	4-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=5915	38.541	2	1805.9503	1805.9503	K	I	63	77
PSM	FVIHCNSPVWGADKCEELLEK	265	sp|O75367-2|H2AY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	5-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=7838	50.738	2	2530.1985	2530.1985	K	T	269	290
PSM	FYHDWNDKEIEVLNK	266	sp|Q9NTK5|OLA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=6949	45.08	2	1948.9319	1948.9319	R	H	202	217
PSM	GHYTEGAELVDSVLDVVRK	267	sp|P68371|TBB4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=11138	72.811	3	2086.0695	2086.0695	K	E	104	123
PSM	HGLLVPNNTTDQELQHIR	268	sp|P56537|IF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	18-UNIMOD:267	ms_run[2]:scan=6144	39.996	3	2094.0846	2094.0846	R	N	68	86
PSM	HGYEKPTPIQTQAIPAIMSGR	269	sp|Q7L014|DDX46_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=6899	44.764	2	2294.1841	2294.1841	K	D	390	411
PSM	HKLTVMYSQINGASR	270	sp|Q14258|TRI25_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=4478	29.699	2	1703.8777	1703.8777	R	A	204	219
PSM	HLCICSVDPPGCTDIDDALHCR	271	sp|Q9Y2L1-2|RRP44_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:4,5-UNIMOD:4,12-UNIMOD:4,21-UNIMOD:4,22-UNIMOD:267	ms_run[2]:scan=7699	49.86	3	2620.1166	2620.1166	R	E	442	464
PSM	HLLQAPVDDAQEILHSR	272	sp|Q15436-2|SC23A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	17-UNIMOD:267	ms_run[2]:scan=7866	50.918	3	1951.0151	1951.0151	R	F	481	498
PSM	HLQVNVTNPVQCSLHGK	273	sp|O94832|MYO1D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	12-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=5359	35.105	2	1936.0044	1936.0044	R	K	959	976
PSM	HVEVSQAPLPPAPAYLSSPLALPSQR	274	sp|Q9Y6K9-3|NEMO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=9735	63.275	2	2724.4599	2724.4599	R	R	261	287
PSM	HYCYPHFTCAVDTENIR	275	sp|P38405-3|GNAL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=6364	41.392	2	2181.936	2181.9360	K	R	137	154
PSM	IGEEQSAEDAEDGPPELLFIHGGHTAK	276	sp|Q16576|RBBP7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	27-UNIMOD:188	ms_run[2]:scan=8038	52.029	3	2852.356	2852.3560	K	I	349	376
PSM	ILFLDPSGKVHPEIINENGNPSYK	277	sp|O95881|TXD12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	9-UNIMOD:188,24-UNIMOD:188	ms_run[2]:scan=8732	56.646	2	2692.4263	2692.4263	R	Y	115	139
PSM	ILGSGISSSSVLHGMVFKK	278	sp|P50990|TCPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=8100	52.44	2	1946.0659	1946.0659	K	E	207	226
PSM	IRLQAYHTQTTPLIEYYR	279	sp|P54819-6|KAD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:267,18-UNIMOD:267	ms_run[2]:scan=7309	47.33	2	2285.2071	2285.2071	K	K	137	155
PSM	IRLQAYHTQTTPLIEYYR	280	sp|P54819-6|KAD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=7310	47.336	2	2265.1906	2265.1906	K	K	137	155
PSM	KFDPMGQQTCSAHPAR	281	sp|Q9NPE3|NOP10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	10-UNIMOD:4	ms_run[2]:scan=2827	19.565	3	1829.8301	1829.8301	K	F	19	35
PSM	KIIVDTYGGWGAHGGGAFSGK	282	sp|P31153-2|METK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=6729	43.702	2	2077.0381	2077.0381	R	D	202	223
PSM	KTTIENIQLPHTLLSR	283	sp|P33991|MCM4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=7849	50.81	2	1863.0578	1863.0578	K	F	628	644
PSM	KWDTCAPEVILHAVGGK	284	sp|O95861-3|BPNT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	5-UNIMOD:4	ms_run[2]:scan=9016	58.476	3	1879.9615	1879.9615	K	L	190	207
PSM	LGVLHVGQKLEEQDEFEK	285	sp|Q9NTJ5-2|SAC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	9-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=6617	42.99	2	2109.1145	2109.1145	R	I	354	372
PSM	LLKNHDEESLECLCR	286	sp|Q04637-6|IF4G1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	12-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=4852	31.969	2	1914.8928	1914.8928	K	L	727	742
PSM	LNFHPDQEDQFFSLVHEK	287	sp|Q969Z0-2|FAKD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=9325	60.578	3	2229.0491	2229.0491	R	L	269	287
PSM	LNFHPDQEDQFFSLVHEK	288	sp|Q969Z0-2|FAKD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	18-UNIMOD:188	ms_run[2]:scan=9328	60.595	2	2235.0692	2235.0692	R	L	269	287
PSM	LNSHMNALHLGSQANR	289	sp|P11413|G6PD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=4166	27.772	2	1761.8693	1761.8693	R	L	121	137
PSM	LQFHDVAGDIFHQQCK	290	sp|P11413|G6PD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:4	ms_run[2]:scan=7711	49.934	2	1941.9156	1941.9156	R	R	371	387
PSM	LSGPLKEQYAQEHGLNFQR	291	sp|Q15126|PMVK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=5955	38.786	2	2214.1182	2214.1182	R	L	43	62
PSM	MCTLIDKFDEHDGPVR	292	sp|P53621|COPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:4	ms_run[2]:scan=6890	44.708	2	1931.887	1931.8870	R	G	40	56
PSM	MHTTFEHDIQALGTQVR	293	sp|Q01082-3|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	17-UNIMOD:267	ms_run[2]:scan=7221	46.763	2	1992.9715	1992.9715	R	Q	1832	1849
PSM	MLEIDPQKVNINGGAVSLGHPIGMSGAR	294	sp|P24752|THIL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:35	ms_run[2]:scan=8467	54.925	3	2876.4637	2876.4637	K	I	366	394
PSM	NLHQSGFSLSGAQIDDNIPRR	295	sp|Q16555-2|DPYL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=6733	43.73	2	2324.1622	2324.1622	R	T	497	518
PSM	PRPDPSPEIEGDLQPATHGSR	296	sp|P51970|NDUA8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:267,21-UNIMOD:267	ms_run[2]:scan=4908	32.315	3	2275.1096	2275.1096	R	F	146	167
PSM	QLFHPEQLITGKEDAANNYAR	297	sp|P68363-2|TBA1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=7296	47.249	3	2414.1979	2414.1979	R	G	85	106
PSM	SIYGEKFEDENFILK	298	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=8631	55.987	2	1842.9442	1842.9442	K	H	77	92
PSM	SWVGFSGGQHHTVCMDSEGK	299	sp|P18754|RCC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	14-UNIMOD:4,20-UNIMOD:188	ms_run[2]:scan=5415	35.453	2	2210.9569	2210.9569	K	A	295	315
PSM	TFKTVFAEHISDECK	300	sp|P39023|RL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	14-UNIMOD:4	ms_run[2]:scan=5813	37.909	2	1810.856	1810.8560	R	R	101	116
PSM	VKGGGHVAQIYAIR	301	sp|P62249|RS16_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=3846	25.824	2	1467.831	1467.8310	R	Q	72	86
PSM	VNLQNNPGAMEHFHMK	302	sp|P51572|BAP31_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=5472	35.791	2	1865.8665	1865.8665	K	L	80	96
PSM	YGDGGSSFQSTTGHCVHMR	303	sp|P55795|HNRH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:4	ms_run[2]:scan=3697	24.899	2	2082.8636	2082.8636	R	G	276	295
PSM	YGDGGSTFQSTTGHCVHMR	304	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:4,19-UNIMOD:267	ms_run[2]:scan=3862	25.918	2	2106.8875	2106.8875	R	G	276	295
PSM	SGPFGQIFRPDNFVFGQSGAGNNWAK	305	sp|Q13885|TBB2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=11503	75.463075	3	2797.330337	2797.336097	R	G	78	104
PSM	KDIHFMPCSGLTGANLK	306	sp|P15170|ERF3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	1-UNIMOD:188,8-UNIMOD:4,17-UNIMOD:188	ms_run[1]:scan=6503	42.26840333333333	2	1899.971306	1899.973782	K	E	254	271
PSM	HGLLVPNNTTDQELQHIR	307	sp|P56537|IF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	18-UNIMOD:267	ms_run[1]:scan=6930	44.96154166666667	3	2095.068517	2094.084569	R	N	68	86
PSM	HIADLAGNSEVILPVPAFNVINGGSHAGNK	308	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=10617	69.19851833333334	3	3011.537074	3010.562468	R	L	133	163
PSM	ECLQALEFLHANQVIHR	309	sp|Q13177|PAK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	2-UNIMOD:4	ms_run[1]:scan=8897	57.71174	2	2077.051061	2077.052728	R	D	351	368
PSM	KNGGLGHMNIALLSDLTK	310	sp|P30048|PRDX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=10278	66.94651666666667	2	1881.995832	1881.014217	R	Q	149	167
PSM	LQSRPAAPPAPGPGQLTLR	311	sp|Q99536|VAT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	4-UNIMOD:267,19-UNIMOD:267	ms_run[1]:scan=5703	37.210815000000004	2	1946.098199	1946.096467	K	L	64	83
PSM	AEVQKLQMEAPHIIVGTPGR	312	sp|P60842-2|IF4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=6982	45.283	3	2173.1678	2173.1678	R	V	142	162
PSM	AGKFPSLLTHNENMVAK	313	sp|P62906|RL10A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=6011	39.139	2	1855.9615	1855.9615	K	V	131	148
PSM	CPKPVIAAVHGGCIGGGVDLVTACDIR	314	sp|Q13011|ECH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:4,13-UNIMOD:4,24-UNIMOD:4	ms_run[2]:scan=7924	51.29	3	2791.3932	2791.3932	R	Y	159	186
PSM	CTHWAEGGKGALALAQAVQR	315	sp|P11586|C1TC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:4,9-UNIMOD:188,20-UNIMOD:267	ms_run[2]:scan=6841	44.407	2	2139.0978	2135.1097	K	A	785	805
PSM	DGQVHLFEHILNGYCK	316	sp|Q15061|WDR43_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	15-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=8899	57.724	2	1934.9404	1934.9404	R	K	293	309
PSM	DHPHTAAYLQELGR	317	sp|Q6GMV3|PTRD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:267	ms_run[2]:scan=5250	34.429	2	1616.7935	1616.7935	R	M	64	78
PSM	EEKEQHGLQLQSEINQLHSK	318	sp|Q15075|EEA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=5610	36.65	2	2374.1877	2374.1877	R	L	403	423
PSM	ELGLNPEKVNIEGGAIALGHPLGASGCR	319	sp|Q9BWD1|THIC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	27-UNIMOD:4	ms_run[2]:scan=9120	59.194	2	2828.4603	2828.4603	K	I	334	362
PSM	ESGLQAAHPNSIFLIDHAWTCR	320	sp|Q14166|TTL12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	21-UNIMOD:4	ms_run[2]:scan=9426	61.245	2	2522.2125	2522.2125	R	V	106	128
PSM	FETEKNNGAGYFLEHLAFK	321	sp|P31930|QCR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=10067	65.519	2	2214.0746	2214.0746	R	G	81	100
PSM	FGPDTQHLVLNENCASVHNLR	322	sp|Q9BQ52-2|RNZ2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:4	ms_run[2]:scan=6628	43.058	2	2420.1655	2420.1655	R	S	267	288
PSM	FQSSHHPTDITSLDQYVER	323	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=6797	44.128	2	2259.0556	2259.0556	R	M	512	531
PSM	FSHEEIAMATVTALRR	324	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	15-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=7279	47.139	2	1850.9576	1850.9576	K	T	244	260
PSM	GFGFVTFDDHDPVDKIVLQK	325	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=10336	67.331	2	2276.1477	2276.1477	R	Y	142	162
PSM	GHYTEGAELVDSVLDVVR	326	sp|P68371|TBB4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=11891	78.274	2	1957.9745	1957.9745	K	K	104	122
PSM	HGYIGEFEIIDDHR	327	sp|P62244|RS15A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=7183	46.522	3	1699.7954	1699.7954	K	A	44	58
PSM	HIDYFNNQIIVDLVEQQHK	328	sp|O94832|MYO1D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	19-UNIMOD:188	ms_run[2]:scan=10934	71.383	3	2358.2064	2358.2064	K	G	432	451
PSM	HKDAAIYLVTSLASK	329	sp|P55060-4|XPO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=7747	50.156	2	1615.8934	1615.8934	K	A	370	385
PSM	HLLQAPVDDAQEILHSR	330	sp|Q15436-2|SC23A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=7875	50.974	2	1941.0068	1941.0068	R	F	481	498
PSM	HVINFDLPSDIEEYVHR	331	sp|O00571-2|DDX3X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	17-UNIMOD:267	ms_run[2]:scan=10556	68.786	2	2092.0253	2092.0253	K	I	496	513
PSM	HYFQNTQGLIFVVDSNDRER	332	sp|P84085|ARF5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=8027	51.956	2	2437.1775	2437.1775	R	V	80	100
PSM	IHVLEAQDLIAKDR	333	sp|Q9BSJ8|ESYT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=6424	41.773	2	1619.8995	1619.8995	R	F	651	665
PSM	IHYIGQNEPELLVAHAYTR	334	sp|P30519-2|HMOX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	19-UNIMOD:267	ms_run[2]:scan=7631	49.427	3	2233.1519	2233.1519	R	Y	109	128
PSM	IKGEHPGLSIGDVAK	335	sp|P09429|HMGB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=4353	28.923	2	1531.8761	1531.8761	K	K	113	128
PSM	IKGEHPGLSIGDVAK	336	sp|P09429|HMGB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=4356	28.937	2	1519.8358	1519.8358	K	K	113	128
PSM	IKSEHPGLSIGDTAK	337	sp|P26583|HMGB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=3114	21.339	2	1563.8659	1563.8659	K	K	113	128
PSM	IMGLDLPDGGHLTHGYMSDVK	338	sp|P34897-3|GLYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	21-UNIMOD:188	ms_run[2]:scan=8786	56.996	2	2261.0916	2261.0916	R	R	140	161
PSM	KHGLEVIYMIEPIDEYCVQQLK	339	sp|P07900-2|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:188,17-UNIMOD:4,22-UNIMOD:188	ms_run[2]:scan=10772	70.235	3	2716.4007	2716.4007	R	E	635	657
PSM	KLDLEAWFPGSGAFR	340	sp|P49591|SYSC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=11530	75.654	2	1692.8624	1692.8624	K	E	376	391
PSM	KPAAGLSAAPVPTAPAAGAPLMDFGNDFVPPAPR	341	sp|Q9NQC3-2|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=11033	72.093	3	3270.686	3270.6860	R	G	58	92
PSM	KVPEFQFLIGDEAATHLK	342	sp|P34949|MPI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9652	62.738	2	2042.0837	2042.0837	K	Q	163	181
PSM	LEQEVSRPIDHDLANWTPAQPLAPGR	343	sp|P56945-4|BCAR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=8116	52.556	3	2909.4784	2909.4784	R	T	559	585
PSM	LGHASDRIIALDGDTK	344	sp|P29401|TKT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=4764	31.432	2	1680.8795	1680.8795	K	N	328	344
PSM	LHLSGIDANPNALFPPVEFPAPR	345	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	23-UNIMOD:267	ms_run[2]:scan=11347	74.282	2	2481.3044	2481.3044	R	G	803	826
PSM	LHTDDELNWLDHGR	346	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:267	ms_run[2]:scan=6953	45.101	2	1729.8048	1729.8048	K	T	165	179
PSM	LLEAQIATGGVIDPVHSHR	347	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=6863	44.544	2	2012.0803	2012.0803	R	V	2773	2792
PSM	LNSHMNALHLGSQANR	348	sp|P11413|G6PD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	16-UNIMOD:267	ms_run[2]:scan=4162	27.745	2	1771.8776	1771.8776	R	L	121	137
PSM	LQSRPAAPPAPGPGQLTLR	349	sp|Q99536|VAT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=5706	37.227	2	1926.0799	1926.0799	K	L	64	83
PSM	NHDHQEIAVPVANLK	350	sp|O75607|NPM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=5067	33.287	2	1683.8693	1683.8693	R	L	88	103
PSM	NHDHQEIAVPVANLK	351	sp|O75607|NPM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	15-UNIMOD:188	ms_run[2]:scan=5072	33.318	2	1689.8894	1689.8894	R	L	88	103
PSM	NIKLGIHEDSQNR	352	sp|P07900-2|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=2942	20.276	2	1522.7852	1522.7852	K	K	566	579
PSM	NRLQQELDDLTVDLDHQR	353	sp|P35580|MYH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:267,18-UNIMOD:267	ms_run[2]:scan=10475	68.245	3	2227.1096	2227.1096	K	Q	1423	1441
PSM	NVTKDHIMEIFSTYGK	354	sp|Q15287-3|RNPS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=8549	55.455	2	1893.9697	1893.9697	R	I	134	150
PSM	PSQMEHAMETMMFTFHK	355	sp|P60903|S10AA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	17-UNIMOD:188	ms_run[2]:scan=10480	68.28	3	2087.9033	2087.9033	M	F	2	19
PSM	QLPDKWQHDLFDSGFGGGAGVETGGK	356	sp|Q86V81|THOC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=8947	58.032	2	2702.2725	2702.2725	K	L	82	108
PSM	REIVHLQAGQCGNQIGAK	357	sp|P68371|TBB4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	11-UNIMOD:4	ms_run[2]:scan=3770	25.361	3	1978.0167	1978.0167	M	F	2	20
PSM	RIMLFTNEDNPHGNDSAK	358	sp|P12956-2|XRCC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=4926	32.43	2	2057.9589	2057.9589	K	A	124	142
PSM	RVSHQGYSTEAEFEEPR	359	sp|P30533|AMRP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=3744	25.193	2	2020.9239	2020.9239	R	V	240	257
PSM	SWAQASVTHGAHGDGGR	360	sp|P48634-4|PRC2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	17-UNIMOD:267	ms_run[2]:scan=2307	16.445	2	1702.7799	1702.7799	K	A	141	158
PSM	THINIVVIGHVDSGK	361	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	15-UNIMOD:188	ms_run[2]:scan=5717	37.3	2	1593.8934	1593.8934	K	S	6	21
PSM	THINIVVIGHVDSGK	362	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	15-UNIMOD:188	ms_run[2]:scan=5886	38.357	2	1593.8934	1593.8934	K	S	6	21
PSM	THINIVVIGHVDSGK	363	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	15-UNIMOD:188	ms_run[2]:scan=6042	39.337	2	1593.8934	1593.8934	K	S	6	21
PSM	THINIVVIGHVDSGK	364	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	15-UNIMOD:188	ms_run[2]:scan=7094	45.983	2	1593.8934	1593.8934	K	S	6	21
PSM	THSDQFLVAFKEVGR	365	sp|P36542-2|ATPG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=7438	48.176	2	1732.8897	1732.8897	R	K	144	159
PSM	TIKVWQLGSSSPNFTLEGHEK	366	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=8265	53.557	3	2357.2016	2357.2016	R	G	137	158
PSM	TLREQGVEEHETLLLR	367	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=5657	36.938	2	1942.0387	1942.0387	R	R	179	195
PSM	TREGNDLYHEMIESGVINLK	368	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9695	63.022	3	2317.1372	2317.1372	R	D	240	260
PSM	VDISAPDVDVHGPDWHLK	369	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	18-UNIMOD:188	ms_run[2]:scan=7766	50.276	2	2005.0001	2005.0001	K	M	1364	1382
PSM	VIHDNFGIVEGLMTTVHAITATQK	370	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=12929	88.493	3	2594.3527	2594.3527	K	T	121	145
PSM	VVEVLAGHGHLYSR	371	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:267	ms_run[2]:scan=4677	30.911	2	1545.8291	1545.8291	K	I	1242	1256
PSM	VVEVLAGHGHLYSR	372	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=4679	30.92	2	1535.8209	1535.8209	K	I	1242	1256
PSM	YLSHSEFKDLILPTIQK	373	sp|Q92616|GCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=8723	56.591	2	2031.1041	2031.1041	R	S	252	269
PSM	HSQFLGYPITLYLEKER	374	sp|Q58FF8|H90B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	15-UNIMOD:188,17-UNIMOD:267	ms_run[1]:scan=9722	63.19413833333333	3	2109.126134	2109.122974	K	E	127	144
PSM	DGQVHLFEHILNGYCK	375	sp|Q15061|WDR43_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	15-UNIMOD:4	ms_run[1]:scan=8905	57.764790000000005	2	1928.918797	1928.920317	R	K	293	309
PSM	IVGCSVHKGFAFVQYVNER	376	sp|P07910|HNRPC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	4-UNIMOD:4	ms_run[1]:scan=7169	46.44000666666666	3	2209.115969	2209.110243	K	N	43	62
PSM	RQFPNASLIGLTATATNHVLTDAQK	377	sp|P46063|RECQ1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=10137	66.00201666666666	3	2666.406675	2666.414013	K	I	243	268
PSM	HYRGPAGDATVASEK	378	sp|Q15758|AAAT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	3-UNIMOD:267,15-UNIMOD:188	ms_run[1]:scan=1454	11.305716666666667	2	1573.784673	1573.781967	K	E	523	538
PSM	AWGPGLHGGIVGR	379	sp|O75369-7|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	13-UNIMOD:267	ms_run[2]:scan=5871	38.272	2	1285.6919	1285.6919	R	S	385	398
PSM	EAEAAIYHLQLFEELRR	380	sp|P14618-3|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	16-UNIMOD:267,17-UNIMOD:267	ms_run[2]:scan=10046	65.383	2	2107.0965	2107.0965	R	L	369	386
PSM	EHLGHESDNLLFVQITGK	381	sp|Q6FI81-3|CPIN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=8069	52.232	2	2036.0327	2036.0327	R	K	132	150
PSM	EKTHVADFAPEVAWVTR	382	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=8323	53.922	2	1954.9901	1954.9901	K	S	1090	1107
PSM	ESGLQAAHPNSIFLIDHAWTCR	383	sp|Q14166|TTL12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	21-UNIMOD:4	ms_run[2]:scan=9415	61.175	3	2522.2125	2522.2125	R	V	106	128
PSM	FGPDTQHLVLNENCASVHNLR	384	sp|Q9BQ52-2|RNZ2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	14-UNIMOD:4,21-UNIMOD:267	ms_run[2]:scan=6640	43.133	2	2430.1738	2430.1738	R	S	267	288
PSM	GFLDACEKGPLSGHK	385	sp|Q96RP9|EFGM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:4,8-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=5593	36.541	2	1626.8227	1626.8227	K	L	589	604
PSM	HFILDECDKMLEQLDMR	386	sp|Q13838|DX39B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	7-UNIMOD:4,16-UNIMOD:35	ms_run[2]:scan=9449	61.392	2	2208.0013	2208.0013	K	R	192	209
PSM	HGNQYIQVNEPWKR	387	sp|P56192|SYMC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=5371	35.178	2	1767.8805	1767.8805	R	I	714	728
PSM	HGYIGEFEIIDDHR	388	sp|P62244|RS15A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	14-UNIMOD:267	ms_run[2]:scan=7181	46.511	3	1709.8037	1709.8037	K	A	44	58
PSM	HIHSQVTVQINSAEQEIK	389	sp|Q70UQ0-4|IKIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=5360	35.111	3	2060.0651	2060.0651	K	L	179	197
PSM	HLCICSVDPPGCTDIDDALHCR	390	sp|Q9Y2L1-2|RRP44_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:4,5-UNIMOD:4,12-UNIMOD:4,21-UNIMOD:4	ms_run[2]:scan=7683	49.756	3	2610.1083	2610.1083	R	E	442	464
PSM	HLIPAANTGESKVFYYK	391	sp|P62258-2|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	12-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=5863	38.224	3	1949.045	1949.0450	K	M	85	102
PSM	HLNEIDLFHCIDPNDSK	392	sp|Q15185-3|TEBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	10-UNIMOD:4	ms_run[2]:scan=8543	55.419	3	2065.9527	2065.9527	K	H	49	66
PSM	HLNEIDLFHCIDPNDSK	393	sp|Q15185-3|TEBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	10-UNIMOD:4	ms_run[2]:scan=8392	54.4	2	2065.9527	2065.9527	K	H	49	66
PSM	HNNCMASHLTPAVYAR	394	sp|P12532|KCRU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	4-UNIMOD:4	ms_run[2]:scan=4482	29.727	2	1840.8461	1840.8461	K	L	59	75
PSM	HQAFEAELHANADR	395	sp|Q13813-2|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	14-UNIMOD:267	ms_run[2]:scan=3515	23.795	2	1617.7523	1617.7523	K	I	1597	1611
PSM	HRVVVVAGETGSGK	396	sp|Q7Z478|DHX29_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=1284	10.301	2	1394.763	1394.7630	R	S	588	602
PSM	HYFQNTQGLIFVVDSNDRER	397	sp|P84085|ARF5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	18-UNIMOD:267,20-UNIMOD:267	ms_run[2]:scan=8025	51.944	2	2457.194	2457.1940	R	V	80	100
PSM	IAELLENVTLIHKPVSLQPR	398	sp|Q14694|UBP10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=9313	60.498	2	2269.3158	2269.3158	K	G	396	416
PSM	KFVHLLDQSDQDFQEELDLMK	399	sp|P46940|IQGA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=10544	68.707	3	2577.2421	2577.2421	R	M	871	892
PSM	KTFSHELSDFGLESTAGEIPVVAIR	400	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=10344	67.382	3	2702.3915	2702.3915	R	T	305	330
PSM	KVPEFQFLIGDEAATHLK	401	sp|P34949|MPI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=9655	62.761	2	2054.1239	2054.1239	K	Q	163	181
PSM	LAAAILGGVDQIHIKPGAK	402	sp|P22087|FBRL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=7610	49.295	3	1871.0993	1871.0993	K	V	144	163
PSM	LLHLLLDDMPVKPYSDGEGGIEDENR	403	sp|Q92621|NU205_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=10130	65.954	3	2924.4226	2924.4226	R	S	1139	1165
PSM	LQFHNVKPECLEAYNK	404	sp|O75323|NIPS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	7-UNIMOD:188,10-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=5773	37.656	3	2001.0181	2001.0181	K	I	76	92
PSM	MCTLIDKFDEHDGPVR	405	sp|P53621|COPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:35,2-UNIMOD:4	ms_run[2]:scan=6248	40.65	2	1947.8819	1947.8819	R	G	40	56
PSM	MHDLNTDQENLVGTHDAPIR	406	sp|O43684-2|BUB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:35	ms_run[2]:scan=4955	32.616	3	2291.0601	2291.0601	K	C	81	101
PSM	MKQVEELYHSLLELGEK	407	sp|Q13813-2|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:35,2-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=10022	65.227	3	2073.0855	2073.0855	R	R	1066	1083
PSM	NGQTREHALLAYTLGVK	408	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=6871	44.594	2	1870.0061	1870.0061	K	Q	130	147
PSM	NTKEPPLSLTIHLTSPVVR	409	sp|Q12906-5|ILF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=8292	53.728	2	2101.1895	2101.1895	K	E	159	178
PSM	NVTKDHIMEIFSTYGK	410	sp|Q15287-3|RNPS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=8555	55.494	2	1881.9295	1881.9295	R	I	134	150
PSM	PKHEFSVDMTCGGCAEAVSR	411	sp|O00244|ATOX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:188,11-UNIMOD:4,14-UNIMOD:4,20-UNIMOD:267	ms_run[2]:scan=5002	32.896	2	2252.9948	2249.0066	M	V	2	22
PSM	PSQMEHAMETMMFTFHK	412	sp|P60903|S10AA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=10497	68.392	2	2081.8831	2081.8831	M	F	2	19
PSM	QLPDKWQHDLFDSGFGGGAGVETGGK	413	sp|Q86V81|THOC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=8945	58.022	3	2702.2725	2702.2725	K	L	82	108
PSM	RLQELCQILGEAVAPAHVPAPSPQGPGGLQGAST	414	sp|P33897|ABCD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:4	ms_run[2]:scan=10754	70.118	3	3405.7463	3405.7463	R	-	712	746
PSM	SGKHIGVCISVANNR	415	sp|O60506-4|HNRPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	8-UNIMOD:4	ms_run[2]:scan=3489	23.639	2	1610.8311	1610.8311	R	L	230	245
PSM	SYREHIEQQIQTYQR	416	sp|Q9UPT5-2|EXOC7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=5182	34.011	2	1977.9657	1977.9657	R	S	525	540
PSM	TADEVPLKILAHNNFVGR	417	sp|Q9NZI8|IF2B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=8251	53.469	3	1993.0745	1993.0745	K	L	273	291
PSM	TGTITTFEHAHNMR	418	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=3871	25.97	2	1614.7573	1614.7573	K	V	482	496
PSM	THDLTLASHEENPAWLPLYGSVCCR	419	sp|Q9BST9-3|RTKN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	23-UNIMOD:4,24-UNIMOD:4,25-UNIMOD:267	ms_run[2]:scan=9544	62.028	2	2935.3621	2935.3621	R	L	225	250
PSM	THDLTLASHEENPAWLPLYGSVCCR	420	sp|Q9BST9-3|RTKN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	23-UNIMOD:4,24-UNIMOD:4	ms_run[2]:scan=9545	62.034	2	2925.3538	2925.3538	R	L	225	250
PSM	THINIVVIGHVDSGK	421	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=6295	40.954	2	1587.8733	1587.8733	K	S	6	21
PSM	THLENNRFGGSGSQVDSAR	422	sp|Q13200|PSMD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=2537	17.835	2	2030.9518	2030.9518	K	M	351	370
PSM	TIGGGDDSFNTFFSETGAGKHVPR	423	sp|P68363-2|TBA1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=8319	53.898	2	2496.167	2496.1670	K	A	41	65
PSM	TKDGLEVAVLPHNIR	424	sp|Q14690|RRP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=6130	39.904	2	1660.9261	1660.9261	K	A	647	662
PSM	TLPAHSDPVSAVHFNR	425	sp|P61964|WDR5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=5120	33.623	2	1746.8802	1746.8802	K	D	166	182
PSM	VAHSFNCTPIEGMLSHQLK	426	sp|Q9UQ80-2|PA2G4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	7-UNIMOD:4	ms_run[2]:scan=7995	51.749	3	2168.0507	2168.0507	K	Q	119	138
PSM	VDINAPDVDVHGPDWHLK	427	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	18-UNIMOD:188	ms_run[2]:scan=7582	49.117	2	2032.011	2032.0110	K	M	3584	3602
PSM	VHELNEEIGKLLAK	428	sp|Q9Y383-3|LC7L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=7696	49.838	2	1591.8934	1591.8934	R	V	123	137
PSM	VHGPGIQSGTTNKPNK	429	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	13-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=995	8.6718	2	1645.8939	1645.8939	R	F	1360	1376
PSM	VIGIDHIKELVDDSVNNVR	430	sp|P22061|PIMT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=10368	67.547	3	2134.1382	2134.1382	K	K	106	125
PSM	VSGQGLHEGHTFEPAEFIIDTR	431	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	22-UNIMOD:267	ms_run[2]:scan=8583	55.671	2	2449.1902	2449.1902	R	D	2044	2066
PSM	YCCEHLLDHITNNQDFKGSAGAPSVENVK	432	sp|P35813-2|PPM1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:4,3-UNIMOD:4	ms_run[2]:scan=7039	45.638	3	3302.5085	3302.5085	K	N	70	99
PSM	YFDGSGGNNHAVEHYR	433	sp|P45974-2|UBP5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=2951	20.332	2	1821.7819	1821.7819	R	E	223	239
PSM	YGDGGSTFQSTTGHCVHMR	434	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	15-UNIMOD:4	ms_run[2]:scan=3865	25.935	2	2096.8793	2096.8793	R	G	276	295
PSM	YLRAEPEDHYFLLTEPPLNTPENR	435	sp|P61158|ARP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=8992	58.316	3	2913.4297	2913.4297	K	E	100	124
PSM	YRHDENILESEPIVYR	436	sp|Q96F86|EDC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=6719	43.639	2	2032.0014	2032.0014	R	R	244	260
PSM	REIVHIQAGQCGNQIGAK	437	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:267,11-UNIMOD:4,18-UNIMOD:188	ms_run[1]:scan=3769	25.355079999999997	3	1994.0437	1994.0446	M	F	2	20
PSM	QLFHPEQLITGKEDAANNYAR	438	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:28	ms_run[1]:scan=9057	58.74867333333333	3	2397.1746	2397.1708	R	G	85	106
PSM	FKILDAVVAQEPLHR	439	sp|Q15029|U5S1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=8337	54.013868333333335	2	1735.984347	1734.978090	K	G	789	804
PSM	GILTLKYPIEHGIITNWDDMEK	440	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	6-UNIMOD:188,22-UNIMOD:188	ms_run[1]:scan=10510	68.47637666666667	3	2597.363993	2597.360219	R	I	65	87
PSM	QLPDKWQHDLFDSGFGGGAGVETGGK	441	sp|Q86V81|THOC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:28	ms_run[1]:scan=10578	68.93520166666667	3	2685.2387	2685.2454	K	L	82	108
PSM	TQFGEKIHNFGLIQEK	442	sp|P49748|ACADV_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=6734	43.736291666666666	2	1888.987582	1887.984297	R	L	367	383
PSM	MREIVHIQAGQCGNQIGAK	443	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	2-UNIMOD:267,12-UNIMOD:4,19-UNIMOD:188	ms_run[1]:scan=4931	32.464353333333335	3	2126.063015	2125.085560	-	F	1	20
PSM	MREIVHIQAGQCGNQIGAK	444	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	1-UNIMOD:35,2-UNIMOD:267,12-UNIMOD:4,19-UNIMOD:188	ms_run[1]:scan=4254	28.315540000000002	2	2142.061999	2141.080475	-	F	1	20
PSM	APSHVPFLLIGGGTAAFAAAR	445	sp|O95831-6|AIFM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	21-UNIMOD:267	ms_run[2]:scan=10811	70.49	3	2033.1086	2033.1086	K	S	41	62
PSM	AQIHQFREDSLDSVLFLK	446	sp|Q13620-3|CUL4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9615	62.498	2	2145.1219	2145.1219	K	K	74	92
PSM	EFTMAEIEHFVDPSEKDHPK	447	sp|P41250|GARS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9785	63.609	2	2385.0947	2385.0947	R	F	345	365
PSM	EIGELTQLKELHIQGNR	448	sp|Q15404-2|RSU1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7543	48.859	2	1977.0643	1977.0643	K	L	122	139
PSM	ELEDFKLQHGSILGFPK	449	sp|P00367-2|DHE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=8924	57.888	2	1957.0309	1957.0309	K	A	180	197
PSM	EQCCYNCGKPGHLAR	450	sp|P62633-7|CNBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:4,4-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=1650	12.461	2	1848.7818	1848.7818	R	D	78	93
PSM	FIIQSEKPPHYLESR	451	sp|P14735|IDE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=5802	37.839	2	1842.9628	1842.9628	R	V	848	863
PSM	FYHDWNDKEIEVLNK	452	sp|Q9NTK5|OLA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	8-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=6946	45.065	2	1960.9722	1960.9722	R	H	202	217
PSM	GFGFVTFDDHDPVDKIVLQK	453	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	15-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=10352	67.435	2	2288.188	2288.1880	R	Y	142	162
PSM	GIGHVIKVPDNYGDEIAIELR	454	sp|Q92900-2|RENT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9073	58.846	3	2307.2223	2307.2223	K	S	376	397
PSM	HEMPPHIYAITDTAYR	455	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=5920	38.57	3	1913.9094	1913.9094	R	S	144	160
PSM	HGAEVIDTPVFELKETLMGK	456	sp|P12081-4|HARS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=10778	70.273	3	2213.1402	2213.1402	R	Y	87	107
PSM	HHYEQQQEDLAR	457	sp|Q12873-2|CHD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:267	ms_run[2]:scan=1195	9.8018	2	1562.7101	1562.7101	R	N	1324	1336
PSM	HIVNHAVVNEDPNAR	458	sp|Q9NQT8|KI13B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=1991	14.527	2	1683.8441	1683.8441	K	I	352	367
PSM	HLAGLGLTEAIDKNK	459	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=5701	37.202	3	1578.873	1578.8730	K	A	320	335
PSM	HLEINPDHPIVETLR	460	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	15-UNIMOD:267	ms_run[2]:scan=6514	42.336	2	1791.9507	1791.9507	K	Q	625	640
PSM	HLNEIDLFHCIDPNDSK	461	sp|Q15185-3|TEBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	10-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=8396	54.428	2	2071.9729	2071.9729	K	H	49	66
PSM	HLTHAQSTLDAK	462	sp|Q15125|EBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:188	ms_run[2]:scan=1044	8.9477	2	1326.6987	1326.6987	K	A	210	222
PSM	HLVLLDTAQAAAAGHR	463	sp|O00754-2|MA2B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=6559	42.632	3	1642.8903	1642.8903	R	L	841	857
PSM	HYRGPAGDATVASEK	464	sp|Q15758-3|AAAT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=1463	11.359	2	1557.7536	1557.7536	K	E	295	310
PSM	ISIEMHGTLEDQLSHLR	465	sp|P12814-2|ACTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	5-UNIMOD:35,17-UNIMOD:267	ms_run[2]:scan=7697	49.845	2	2003.9974	2003.9974	R	Q	656	673
PSM	KDIHFMPCSGLTGANLK	466	sp|P15170|ERF3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	8-UNIMOD:4	ms_run[2]:scan=6502	42.262	3	1887.9335	1887.9335	K	E	254	271
PSM	KHFSQAEGSQLDEVR	467	sp|Q7L5Y9-3|MAEA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=3000	20.635	2	1729.8384	1729.8384	R	Q	182	197
PSM	KHPDSSVNFAEFSK	468	sp|P26583|HMGB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=4966	32.681	2	1591.7631	1591.7631	K	K	30	44
PSM	KLDALCNIHENIR	469	sp|P53621|COPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:4	ms_run[2]:scan=5197	34.106	2	1594.825	1594.8250	R	V	517	530
PSM	KLSSWDQAETPGHTPSLR	470	sp|O75533|SF3B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=5180	33.999	2	2008.9967	2008.9967	K	W	214	232
PSM	KQMVIDVLHPGK	471	sp|P62847-2|RS24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=5429	35.537	2	1375.8048	1375.8048	R	A	21	33
PSM	KQMVIDVLHPGK	472	sp|P62847-2|RS24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=5431	35.546	2	1363.7646	1363.7646	R	A	21	33
PSM	KVLCLAVAVGHVK	473	sp|P62906|RL10A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:188,4-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=5586	36.496	2	1404.8678	1404.8678	K	M	161	174
PSM	KVLCLAVAVGHVK	474	sp|P62906|RL10A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	4-UNIMOD:4	ms_run[2]:scan=5589	36.513	2	1392.8275	1392.8275	K	M	161	174
PSM	LGKHDVTCTVSGGGR	475	sp|P82933|RT09_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	8-UNIMOD:4	ms_run[2]:scan=1658	12.509	2	1542.7573	1542.7573	R	S	323	338
PSM	LHHQNQQQIQQQQQQLQR	476	sp|Q96RN5-3|MED15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	18-UNIMOD:267	ms_run[2]:scan=1855	13.711	3	2320.1772	2320.1772	K	I	152	170
PSM	LHHQNQQQIQQQQQQLQR	477	sp|Q96RN5-3|MED15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=1866	13.779	2	2310.169	2310.1690	K	I	152	170
PSM	LITQTFSHHNQLAQK	478	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=3781	25.429	2	1764.9271	1764.9271	K	T	54	69
PSM	LITQTFSHHNQLAQK	479	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	15-UNIMOD:188	ms_run[2]:scan=3782	25.434	2	1770.9472	1770.9472	K	T	54	69
PSM	LKGSGNLEAIHIIK	480	sp|P78371-2|TCPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=5646	36.872	2	1503.9176	1503.9176	R	K	143	157
PSM	LLEAQIATGGIIDPVHSHR	481	sp|Q15149-7|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7470	48.389	2	2026.096	2026.0960	R	V	3432	3451
PSM	LNEQYEHASIHLWDLLEGK	482	sp|Q14444-2|CAPR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=11210	73.292	2	2294.1331	2294.1331	R	E	203	222
PSM	LNQVCATHQHFESR	483	sp|O43795-2|MYO1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	5-UNIMOD:4	ms_run[2]:scan=2298	16.39	2	1725.8005	1725.8005	K	M	479	493
PSM	LNQVCATHQHFESR	484	sp|O43795-2|MYO1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	5-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=2305	16.433	2	1735.8088	1735.8088	K	M	479	493
PSM	LPFTPLSYIQGLSHR	485	sp|Q9UM00-1|TMCO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=11811	77.713	2	1727.9359	1727.9359	K	N	117	132
PSM	LQPTAGLQDLHIHSR	486	sp|Q9Y653-2|AGRG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=5777	37.681	2	1684.9009	1684.9009	K	Q	240	255
PSM	MHDLNTDQENLVGTHDAPIR	487	sp|O43684-2|BUB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:35,20-UNIMOD:267	ms_run[2]:scan=4946	32.56	3	2301.0683	2301.0683	K	C	81	101
PSM	MKHYEVEILDAK	488	sp|Q9NZ01-2|TECR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:35,2-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=4847	31.943	2	1502.7842	1502.7842	-	T	1	13
PSM	NKHEAMITDLEER	489	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=4362	28.974	2	1584.7566	1584.7566	K	L	1023	1036
PSM	NLHVVFTMNPSSEGLKDR	490	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7031	45.585	2	2043.0208	2043.0208	R	A	3061	3079
PSM	NLVNKHSETFTR	491	sp|Q9UNS2-2|CSN3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=2349	16.697	2	1444.7423	1444.7423	R	D	257	269
PSM	QQSHFAMMHGGTGFAGIDSSSPEVK	492	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	25-UNIMOD:188	ms_run[2]:scan=6706	43.558	3	2611.1891	2611.1891	R	G	244	269
PSM	RAVPLALALISVSNPR	493	sp|Q13200|PSMD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=10444	68.045	2	1676.0097	1676.0097	R	L	688	704
PSM	RELHGQNPVVTPCNK	494	sp|Q16630-3|CPSF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:4	ms_run[2]:scan=1894	13.946	2	1747.8788	1747.8788	K	Q	147	162
PSM	RGEAHLAVNDFELAR	495	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:267,15-UNIMOD:267	ms_run[2]:scan=6235	40.568	3	1716.8811	1716.8811	R	A	359	374
PSM	RIEEQSLHDVLFELSK	496	sp|P98196|AT11A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9653	62.744	2	1942.016	1942.0160	K	T	717	733
PSM	RIMLFTNEDNPHGNDSAK	497	sp|P12956-2|XRCC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=4925	32.425	3	2057.9589	2057.9589	K	A	124	142
PSM	RMEELHNQEVQK	498	sp|Q15233-2|NONO_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=1419	11.096	2	1539.7464	1539.7464	R	R	236	248
PSM	RVHVTQEDFEMAVAK	499	sp|P62195-2|PRS8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	11-UNIMOD:35	ms_run[2]:scan=4794	31.624	2	1774.8672	1774.8672	R	V	367	382
PSM	SLSNVIAHEISHSWTGNLVTNK	500	sp|P09960-3|LKHA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=10179	66.294	3	2406.2292	2406.2292	K	T	265	287
PSM	SLVEIIEHGLVDEQQKVR	501	sp|O75533|SF3B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=11205	73.256	2	2091.1324	2091.1324	R	T	685	703
PSM	STANKYQVFFFGTHETAFLGPK	502	sp|P51858-2|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=10076	65.584	3	2489.2379	2489.2379	K	D	33	55
PSM	STANKYQVFFFGTHETAFLGPK	503	sp|P51858-2|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=10094	65.702	2	2489.2379	2489.2379	K	D	33	55
PSM	SWVGFSGGQHHTVCMDSEGK	504	sp|P18754|RCC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	14-UNIMOD:4	ms_run[2]:scan=5417	35.465	2	2204.9368	2204.9368	K	A	295	315
PSM	THINIVVIGHVDSGK	505	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	15-UNIMOD:188	ms_run[2]:scan=6736	43.748	2	1593.8934	1593.8934	K	S	6	21
PSM	THINIVVIGHVDSGK	506	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=6043	39.343	2	1587.8733	1587.8733	K	S	6	21
PSM	THNDIIHNENMR	507	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=2159	15.554	2	1492.6841	1492.6841	R	Q	548	560
PSM	TTHLIAKEEMIHNLQ	508	sp|O00232-2|PSD12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=5333	34.941	2	1776.9193	1776.9193	K	-	422	437
PSM	TVKHPTLLQDPDLR	509	sp|O60749-2|SNX2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=5032	33.074	2	1631.8995	1631.8995	R	Q	129	143
PSM	VIHDNFGIVEGLMTTVHAITATQK	510	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:35,24-UNIMOD:188	ms_run[2]:scan=11648	76.505	3	2616.3677	2616.3677	K	T	121	145
PSM	VILHLKEDQTEYLEER	511	sp|P07900-2|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=6199	40.337	3	2014.0371	2014.0371	K	R	308	324
PSM	YLRAEPEDHYFLLTEPPLNTPENR	512	sp|P61158|ARP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:267,24-UNIMOD:267	ms_run[2]:scan=9008	58.423	2	2933.4463	2933.4463	K	E	100	124
PSM	QLNVNAKPFVPNVHAAEFVPSFLR	513	sp|P15170-2|ERF3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:28	ms_run[1]:scan=11960	78.78729666666666	3	2676.4115	2676.4171	R	G	68	92
PSM	YFLHDDRDDGVDYWAK	514	sp|Q9NYF8|BCLF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	7-UNIMOD:267,16-UNIMOD:188	ms_run[1]:scan=7173	46.46187166666667	2	2030.925517	2029.914104	K	R	846	862
PSM	RMEELHNQEMQK	515	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	1-UNIMOD:267,12-UNIMOD:188	ms_run[1]:scan=1697	12.744353333333335	2	1587.738927	1587.746844	R	R	548	560
PSM	GLQCHPSKPLLASCGLDR	516	sp|Q6RFH5|WDR74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	4-UNIMOD:4,14-UNIMOD:4	ms_run[1]:scan=4812	31.735056666666665	3	2009.001854	2007.998250	R	V	274	292
PSM	DGQVHLFEHILNGYCK	517	sp|Q15061|WDR43_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	15-UNIMOD:4,16-UNIMOD:188	ms_run[1]:scan=9594	62.361761666666666	2	1935.925691	1934.940446	R	K	293	309
PSM	FQGIKHECQANGPEDLNR	518	sp|P60981|DEST_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	8-UNIMOD:4	ms_run[1]:scan=3357	22.79348166666667	3	2111.977522	2111.980686	K	A	128	146
PSM	EHLGHESDNLLFVQITGK	519	sp|Q6FI81|CPIN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	18-UNIMOD:188	ms_run[1]:scan=8077	52.284345	2	2043.049953	2042.052833	R	K	145	163
PSM	HVLDNSGEWSVTKR	520	sp|Q8WVC6|DCAKD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=4319	28.725316666666668	2	1626.818710	1626.811418	R	Q	174	188
PSM	QLPDKWQHDLFDSGFGGGAGVETGGK	521	sp|Q86V81|THOC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:28	ms_run[1]:scan=10610	69.15089666666667	2	2685.2373	2685.2454	K	L	82	108
PSM	LGKADIVQQLLQQGASPNAATTSGYTPLHLSAR	522	sp|Q12955|ANK3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=10542	68.69511166666668	4	3405.807350	3405.800467	R	E	509	542
PSM	AGSRYEDFSNLGTTHLLR	523	sp|P22695|QCR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=7144	46.286	3	2036.0076	2036.0076	K	L	67	85
PSM	AHGPGLEGGLVGKPAEFTIDTK	524	sp|O75369-7|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:188,22-UNIMOD:188	ms_run[2]:scan=7124	46.164	3	2205.1832	2205.1832	K	G	876	898
PSM	AHIAQLCEKAGLLQR	525	sp|Q00610-2|CLH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:4	ms_run[2]:scan=5164	33.898	2	1706.925	1706.9250	R	A	611	626
PSM	AHLLADMAHISGLVAAK	526	sp|P34897-3|GLYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	17-UNIMOD:188	ms_run[2]:scan=8815	57.183	3	1722.9546	1722.9546	K	V	225	242
PSM	AIHVLDVEQGQLERR	527	sp|Q9H6Y2|WDR55_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:267,15-UNIMOD:267	ms_run[2]:scan=5805	37.857	2	1781.9651	1781.9651	K	V	107	122
PSM	ALVHERDEAAYGELR	528	sp|Q9UL46|PSME2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	6-UNIMOD:267,15-UNIMOD:267	ms_run[2]:scan=4030	26.936	2	1747.8756	1747.8756	R	A	189	204
PSM	ATGEADVHFETHEDAVAAMLKDR	529	sp|Q12849-5|GRSF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=7291	47.216	3	2512.1653	2512.1653	K	S	277	300
PSM	DHPHTAAYLQELGR	530	sp|Q6GMV3|PTRD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5253	34.445	2	1606.7852	1606.7852	R	M	64	78
PSM	DKLESEMEDAYHEHQANLLR	531	sp|P23246-2|SFPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=7650	49.548	4	2427.1125	2427.1125	K	Q	517	537
PSM	DKQNLHENLQGLGPGVR	532	sp|Q9ULE6|PALD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=4787	31.578	3	1873.9759	1873.9759	R	V	184	201
PSM	DLIHGAPVGKPAANR	533	sp|Q14683|SMC1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=3544	23.955	2	1514.8318	1514.8318	R	A	63	78
PSM	DLLAEQQPHHLATAVPLTPR	534	sp|Q7L9B9|EEPD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6782	44.031	2	2206.1859	2206.1859	R	V	117	137
PSM	ELHEVCHLLEQER	535	sp|Q15276|RABE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	6-UNIMOD:4	ms_run[2]:scan=5611	36.657	2	1690.8097	1690.8097	K	Q	258	271
PSM	ESGLQAAHPNSIFLIDHAWTCR	536	sp|Q14166|TTL12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	21-UNIMOD:4,22-UNIMOD:267	ms_run[2]:scan=9427	61.252	2	2532.2207	2532.2207	R	V	106	128
PSM	FQAKLEHEYIQNFK	537	sp|Q15691|MARE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5917	38.552	2	1793.9101	1793.9101	K	I	63	77
PSM	FVLQDGAHHMVDSNEISFIR	538	sp|Q96RP9|EFGM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	20-UNIMOD:267	ms_run[2]:scan=8601	55.784	2	2324.1247	2324.1247	R	A	609	629
PSM	FYHDWNDKEIEVLNK	539	sp|Q9NTK5|OLA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	8-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=6965	45.177	3	1960.9722	1960.9722	R	H	202	217
PSM	GFLDACEKGPLSGHK	540	sp|Q96RP9|EFGM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	6-UNIMOD:4	ms_run[2]:scan=5622	36.724	2	1614.7824	1614.7824	K	L	589	604
PSM	GPDAASKLPLVTPHTQCR	541	sp|P62191|PRS4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	17-UNIMOD:4	ms_run[2]:scan=4862	32.033	2	1946.9996	1946.9996	K	L	42	60
PSM	HAIYDKLDDDGLIAPGVR	542	sp|P30876|RPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	6-UNIMOD:188,18-UNIMOD:267	ms_run[2]:scan=7005	45.421	2	1983.0396	1979.0515	R	V	842	860
PSM	HAYGLGEHYNSVTR	543	sp|Q8N6M0-2|OTU6B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=3191	21.805	2	1602.7539	1602.7539	R	L	169	183
PSM	HFILDECDKMLEQLDMR	544	sp|Q13838|DX39B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:4,16-UNIMOD:35	ms_run[2]:scan=9437	61.316	3	2208.0013	2208.0013	K	R	192	209
PSM	HHYEQQQEDLAR	545	sp|Q12873-2|CHD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=1196	9.8068	2	1552.7019	1552.7019	R	N	1324	1336
PSM	HINTWVAEKTEGK	546	sp|P35237|SPB6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=3178	21.731	2	1523.8135	1523.8135	K	I	133	146
PSM	HKDLQQQLVDAK	547	sp|P40222|TXLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=3294	22.417	2	1433.8029	1433.8029	K	L	329	341
PSM	HKTVALDGTLFQK	548	sp|Q14683|SMC1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5449	35.654	2	1456.8038	1456.8038	R	S	636	649
PSM	HLAGEVAKEWQELDDAEK	549	sp|Q13200|PSMD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	8-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=7957	51.498	2	2079.0312	2079.0312	R	V	161	179
PSM	HLNEIDLFHCIDPNDSK	550	sp|Q15185-3|TEBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	10-UNIMOD:4	ms_run[2]:scan=8391	54.394	3	2065.9527	2065.9527	K	H	49	66
PSM	HLTHAQSTLDAK	551	sp|Q15125|EBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=1043	8.943	2	1320.6786	1320.6786	K	A	210	222
PSM	HNESVVKEMLELAK	552	sp|O00487|PSDE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=8609	55.837	2	1637.8849	1637.8850	K	N	240	254
PSM	HNIQFSSFDIFSDEEVRQGLK	553	sp|O76003|GLRX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10269	66.887	3	2495.2081	2495.2081	K	A	172	193
PSM	HVAEDLGKVFGER	554	sp|P40939|ECHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5881	38.331	2	1455.747	1455.7470	K	F	598	611
PSM	HVVTLLQVQDCHVLK	555	sp|P09001|RM03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	11-UNIMOD:4	ms_run[2]:scan=6675	43.358	2	1787.9716	1787.9716	K	Y	117	132
PSM	HVVWHPSQELLASASYDDTVK	556	sp|O76071|CIAO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	21-UNIMOD:188	ms_run[2]:scan=7380	47.795	2	2387.1853	2387.1853	K	L	155	176
PSM	IFCCHGGLSPDLQSMEQIRR	557	sp|P62136-3|PP1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:4,4-UNIMOD:4	ms_run[2]:scan=7424	48.088	3	2403.1246	2403.1246	K	I	125	145
PSM	IISKIENHEGVR	558	sp|P14618-3|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=2079	15.059	2	1393.7678	1393.7678	K	R	252	264
PSM	ILHSYVPEEIRDGNQVR	559	sp|Q96CB9-4|NSUN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5342	34.998	2	2024.0439	2024.0439	K	V	167	184
PSM	IVGAPMHDLLLWNNATVTTCHSK	560	sp|P11586|C1TC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	20-UNIMOD:4,23-UNIMOD:188	ms_run[2]:scan=9531	61.94	3	2583.3033	2583.3033	K	T	176	199
PSM	KAIIIFVPVPQLK	561	sp|P62081|RS7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10318	67.21	2	1464.9432	1464.9432	R	S	58	71
PSM	KLVGFISAIPANIHIYDTEK	562	sp|P30419-2|NMT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10109	65.804	3	2228.2205	2228.2205	R	K	141	161
PSM	KNFESLSEAFSVASAAAVLSHNR	563	sp|P04844-2|RPN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=11052	72.219	3	2434.2241	2434.2241	K	Y	212	235
PSM	KNGGLGHMNIALLSDLTK	564	sp|P30048-2|PRDX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9436	61.31	3	1881.0142	1881.0142	R	Q	131	149
PSM	KQGSATDNVCHLFAEHDPEQPASAIVNFVSK	565	sp|Q68CZ2-2|TENS3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	10-UNIMOD:4	ms_run[2]:scan=10066	65.513	4	3395.6205	3395.6205	R	V	1166	1197
PSM	KTQHGVLSQQFVELINK	566	sp|Q12846-2|STX4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=7789	50.426	2	1980.1195	1980.1195	R	C	122	139
PSM	KVWYEWAVTAPVCSAIHNPTGR	567	sp|O14744-4|ANM5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:4	ms_run[2]:scan=9516	61.847	3	2541.2587	2541.2587	K	S	439	461
PSM	LDNCHSTPLHVAEYMLDAAR	568	sp|P35573-2|GDE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	4-UNIMOD:4	ms_run[2]:scan=10224	66.591	2	2312.0678	2312.0678	R	N	508	528
PSM	LDSQKHIDFSLR	569	sp|P46781|RS9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5264	34.507	2	1457.7627	1457.7627	R	S	151	163
PSM	LGVLHVGQKLEEQDEFEK	570	sp|Q9NTJ5-2|SAC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=6612	42.96	3	2109.1145	2109.1145	R	I	354	372
PSM	LHELNQKWEALK	571	sp|Q13813-2|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5021	33.01	2	1507.8147	1507.8147	K	A	865	877
PSM	LIHPDEDISLEERR	572	sp|O43670-3|ZN207_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:267,14-UNIMOD:267	ms_run[2]:scan=5175	33.966	2	1740.8909	1740.8910	K	A	280	294
PSM	LKGSGNLEAIHIIK	573	sp|P78371-2|TCPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5647	36.877	2	1491.8773	1491.8773	R	K	143	157
PSM	LNCQVIGASVDSHFCHLAWVNTPK	574	sp|Q06830|PRDX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=9213	59.815	2	2752.3214	2752.3214	K	K	69	93
PSM	LNVHKVTVLTLQDK	575	sp|Q9UBT2-2|SAE2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	5-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=5677	37.059	2	1618.9809	1618.9809	R	I	358	372
PSM	LPFTPLSYIQGLSHR	576	sp|Q9UM00-1|TMCO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	15-UNIMOD:267	ms_run[2]:scan=11818	77.76	2	1737.9442	1737.9442	K	N	117	132
PSM	LQHLAESWGGKENGFGLAECCR	577	sp|Q7Z6Z7-2|HUWE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	11-UNIMOD:188,20-UNIMOD:4,21-UNIMOD:4,22-UNIMOD:267	ms_run[2]:scan=6919	44.893	2	2534.1766	2530.1884	R	D	163	185
PSM	LREQLQLLEEQHR	578	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:267,13-UNIMOD:267	ms_run[2]:scan=5457	35.703	2	1710.928	1710.9280	R	A	2562	2575
PSM	LREQLQLLEEQHR	579	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5471	35.785	2	1690.9115	1690.9115	R	A	2562	2575
PSM	LTHYDHVLIELTQAGLK	580	sp|Q14566|MCM6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	17-UNIMOD:188	ms_run[2]:scan=9424	61.234	3	1956.0776	1956.0776	R	G	780	797
PSM	MHNQIPQVTSDGKR	581	sp|Q92499|DDX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:35	ms_run[2]:scan=2018	14.689	2	1625.7944	1625.7944	R	L	387	401
PSM	MKHYEVEILDAK	582	sp|Q9NZ01-2|TECR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:35	ms_run[2]:scan=4840	31.903	2	1490.7439	1490.7439	-	T	1	13
PSM	NHEEEVKGLQAQIASSGLTVEVDAPK	583	sp|P05783|K1C18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:188,26-UNIMOD:188	ms_run[2]:scan=8121	52.595	2	2760.4333	2760.4333	K	S	216	242
PSM	NKHEAMITDLEER	584	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	6-UNIMOD:35	ms_run[2]:scan=3100	21.25	2	1600.7515	1600.7515	K	L	1023	1036
PSM	NMSVIAHVDHGK	585	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	12-UNIMOD:188	ms_run[2]:scan=2823	19.542	2	1312.6653	1312.6653	R	S	21	33
PSM	NVHMNDNVLHSAFEVGAR	586	sp|Q13630|FCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=7028	45.568	3	2008.9537	2008.9537	K	K	90	108
PSM	PSQMEHAMETMMFTFHK	587	sp|P60903|S10AA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	17-UNIMOD:188	ms_run[2]:scan=10482	68.29	2	2087.9033	2087.9033	M	F	2	19
PSM	RPMSAYMLWLNASR	588	sp|Q08945|SSRP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:267,14-UNIMOD:267	ms_run[2]:scan=9676	62.899	2	1714.855	1714.8550	K	E	549	563
PSM	SKGLAPDLPEDLYHLIK	589	sp|P62277|RS13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10645	69.383	3	1908.0357	1908.0357	K	K	77	94
PSM	SLSNVIAHEISHSWTGNLVTNK	590	sp|P09960-3|LKHA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	22-UNIMOD:188	ms_run[2]:scan=10192	66.376	2	2412.2493	2412.2493	K	T	265	287
PSM	SSNDHGSLALTPRPQLELAESSPAASFLSSR	591	sp|Q9BQC3-2|DPH2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10008	65.133	3	3224.6062	3224.6062	K	S	197	228
PSM	TGTITTFEHAHNMR	592	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:35	ms_run[2]:scan=2735	19.025	2	1630.7522	1630.7522	K	V	482	496
PSM	THINIVVIGHVDSGK	593	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6924	44.922	2	1587.8733	1587.8733	K	S	6	21
PSM	THINIVVIGHVDSGK	594	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=7202	46.64	2	1587.8733	1587.8733	K	S	6	21
PSM	THLPGFVEQAEALKAK	595	sp|P30044-2|PRDX5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=6898	44.758	3	1749.9816	1749.9816	K	G	51	67
PSM	TTHLIAKEEMIHNLQ	596	sp|O00232-2|PSD12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:188	ms_run[2]:scan=5332	34.935	2	1782.9394	1782.9394	K	-	422	437
PSM	VDINAPDVEVHGPDWHLK	597	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	18-UNIMOD:188	ms_run[2]:scan=7591	49.175	2	2046.0266	2046.0266	K	M	1492	1510
PSM	VGKGEPGAAPLSAPAFSLVFPFLK	598	sp|Q92616|GCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:188,24-UNIMOD:188	ms_run[2]:scan=13141	91.296	3	2411.3656	2411.3656	R	M	963	987
PSM	VNLQNNPGAMEHFHMK	599	sp|P51572|BAP31_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	10-UNIMOD:35,16-UNIMOD:188	ms_run[2]:scan=4292	28.556	2	1887.8816	1887.8816	K	L	80	96
PSM	YHIEVNRVPAGNWVLIEGVDQPIVK	600	sp|Q15029|U5S1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10281	66.965	3	2844.5286	2844.5286	R	T	537	562
PSM	YHQIGSGKCEIK	601	sp|O14979-3|HNRDL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	8-UNIMOD:188,9-UNIMOD:4,12-UNIMOD:188	ms_run[2]:scan=1589	12.102	2	1430.7379	1430.7379	R	V	176	188
PSM	KDIHFMPCSGLTGANLK	602	sp|P15170|ERF3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	1-UNIMOD:188,8-UNIMOD:4,17-UNIMOD:188	ms_run[1]:scan=6510	42.31223833333333	3	1899.970807	1899.973782	K	E	254	271
PSM	GFGVDHGQVAEQSAGVLHLR	603	sp|O95822|DCMC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=6804	44.17388666666666	3	2077.047791	2076.050086	R	Q	94	114
PSM	RLEGIENDTQPILLQSCTGLVTHR	604	sp|O95425|SVIL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	17-UNIMOD:4	ms_run[1]:scan=8214	53.23048666666667	3	2750.421585	2749.418112	R	L	10	34
PSM	KISSIQSIVPALEIANAHR	605	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=8976	58.21191333333333	2	2046.160686	2046.158573	K	K	250	269
PSM	AFHNEAQVNPERK	606	sp|P17987|TCPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=1445	11.25	2	1538.759	1538.7590	R	N	469	482
PSM	AGKLDPHLVLDQLR	607	sp|P35580|MYH10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7811	50.571	2	1573.894	1573.8940	R	C	687	701
PSM	AHSIQIMKVEEIAASK	608	sp|Q02543|RL18A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6226	40.51	3	1753.9397	1753.9397	R	C	121	137
PSM	AHSIQIMKVEEIAASK	609	sp|Q02543|RL18A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	8-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=6236	40.574	3	1765.9799	1765.9799	R	C	121	137
PSM	ALVHERDEAAYGELR	610	sp|Q9UL46|PSME2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=4014	26.842	2	1727.8591	1727.8591	R	A	189	204
PSM	AQIHQFREDSLDSVLFLK	611	sp|Q13620-3|CUL4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9611	62.473	3	2145.1219	2145.1219	K	K	74	92
PSM	AWVWNTHADFADECPKPELLAIR	612	sp|P43487-2|RANG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:4	ms_run[2]:scan=10431	67.956	3	2738.3275	2738.3275	R	F	119	142
PSM	CGHLCPAPCHDQALIK	613	sp|Q6ZNB6-2|NFXL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:4,5-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=3718	25.028	2	1875.8542	1875.8542	K	Q	589	605
PSM	EIHQFNRDVEDEILWVGER	614	sp|Q01082-3|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	7-UNIMOD:267,19-UNIMOD:267	ms_run[2]:scan=9823	63.87	2	2403.1722	2403.1722	K	M	1473	1492
PSM	ELEDFKLQHGSILGFPK	615	sp|P00367-2|DHE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=8951	58.055	2	1969.0712	1969.0712	K	A	180	197
PSM	EVIELPVKHPELFEALGIAQPK	616	sp|P62195-2|PRS8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	8-UNIMOD:188,22-UNIMOD:188	ms_run[2]:scan=10860	70.87	2	2468.4082	2468.4082	K	G	155	177
PSM	FLHCTEKDLIPYLEK	617	sp|O75643|U520_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:4,7-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=7807	50.543	2	1917.0109	1917.0109	R	L	1589	1604
PSM	FQEHIIQAPKPVEAIK	618	sp|Q9UHD1-2|CHRD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	10-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=5819	37.948	2	1859.0708	1859.0708	K	R	73	89
PSM	GDAVRDVDIIDHHDNTYTVK	619	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5414	35.447	2	2282.0927	2282.0927	K	Y	917	937
PSM	GIGTLHLKPTANQK	620	sp|Q9UKX7-2|NUP50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=3322	22.583	2	1476.8413	1476.8413	K	T	349	363
PSM	GISHVIVDEIHER	621	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:267	ms_run[2]:scan=5588	36.507	2	1512.7924	1512.7924	R	D	504	517
PSM	GLAPDLPEDLYHLIKK	622	sp|P62277|RS13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=10889	71.064	2	1821.0036	1821.0036	K	A	79	95
PSM	HAIYDKLDDDGLIAPGVR	623	sp|P30876|RPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7002	45.405	3	1967.0112	1967.0112	R	V	842	860
PSM	HGNQYIQVNEPWKR	624	sp|P56192|SYMC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5369	35.167	3	1767.8805	1767.8805	R	I	714	728
PSM	HIHITQATETTTTR	625	sp|Q14677|EPN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=2033	14.782	2	1608.822	1608.8220	K	H	261	275
PSM	HKDLQQQLVDAK	626	sp|P40222|TXLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=3296	22.428	2	1421.7627	1421.7627	K	L	329	341
PSM	HLAGEVAKEWQELDDAEK	627	sp|Q13200|PSMD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	8-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=7937	51.371	3	2079.0312	2079.0312	R	V	161	179
PSM	HRDGGEALVSPDGTVTEAPR	628	sp|Q96HN2-2|SAHH3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=4280	28.481	3	2063.0032	2063.0032	R	T	98	118
PSM	HRDYETATLSDIK	629	sp|O43707|ACTN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=4194	27.942	2	1547.758	1547.7580	K	A	438	451
PSM	HRPSEADEEELAR	630	sp|O14617-3|AP3D1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:267,13-UNIMOD:267	ms_run[2]:scan=1907	14.028	2	1557.7286	1557.7286	K	R	486	499
PSM	IGEEQSAEDAEDGPPELLFIHGGHTAK	631	sp|Q16576|RBBP7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=8017	51.892	3	2846.3359	2846.3359	K	I	349	376
PSM	ISIEMHGTLEDQLSHLR	632	sp|P12814-2|ACTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	17-UNIMOD:267	ms_run[2]:scan=8853	57.427	3	1988.0025	1988.0025	R	Q	656	673
PSM	IVGAPMHDLLLWNNATVTTCHSK	633	sp|P11586|C1TC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	20-UNIMOD:4,23-UNIMOD:188	ms_run[2]:scan=9540	61.998	2	2583.3033	2583.3033	K	T	176	199
PSM	IWDTTQKEHLLK	634	sp|O75083|WDR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	7-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=4724	31.196	2	1522.8546	1522.8546	R	Y	84	96
PSM	KAGQVFLEELGNHK	635	sp|P09543-2|CN37_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=5911	38.514	2	1580.8713	1580.8713	R	A	184	198
PSM	KAGQVFLEELGNHK	636	sp|P09543-2|CN37_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5901	38.453	2	1568.8311	1568.8311	R	A	184	198
PSM	KAHEILPNLVCCSAK	637	sp|P50990|TCPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:188,11-UNIMOD:4,12-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=5487	35.885	2	1750.9261	1750.9261	R	N	138	153
PSM	KHPDASVNFSEFSK	638	sp|P09429|HMGB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=5141	33.752	2	1603.8033	1603.8033	K	K	30	44
PSM	KIIVDTYGGWGAHGGGAFSGK	639	sp|P31153-2|METK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6730	43.708	3	2077.0381	2077.0381	R	D	202	223
PSM	KLVEALCAAGHR	640	sp|P23919-2|KTHY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	7-UNIMOD:4	ms_run[2]:scan=3299	22.443	2	1323.7081	1323.7081	R	A	25	37
PSM	KNGGLGHMNIALLSDLTK	641	sp|P30048-2|PRDX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=9453	61.421	2	1893.0545	1893.0545	R	Q	131	149
PSM	KVVYENAYGQFIGPHR	642	sp|Q16881-7|TRXR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5893	38.401	3	1876.9584	1876.9584	K	I	86	102
PSM	LHISQLQHENSILK	643	sp|Q14203-5|DCTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5553	36.289	2	1658.9104	1658.9104	R	G	963	977
PSM	LHKNDIAINELMK	644	sp|P51665|PSMD7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=5782	37.715	2	1549.8689	1549.8689	K	R	101	114
PSM	LHKNDIAINELMK	645	sp|P51665|PSMD7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5784	37.725	2	1537.8286	1537.8286	K	R	101	114
PSM	LHTDDELNWLDHGR	646	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6969	45.199	2	1719.7965	1719.7965	K	T	165	179
PSM	LISSDGHEFIVKR	647	sp|Q15369-2|ELOC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=4644	30.725	2	1499.8096	1499.8096	K	E	5	18
PSM	LNVHKVTVLTLQDK	648	sp|Q9UBT2-2|SAE2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5687	37.117	2	1606.9406	1606.9406	R	I	358	372
PSM	LQFHDVAGDIFHQQCK	649	sp|P11413|G6PD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	15-UNIMOD:4	ms_run[2]:scan=7714	49.951	3	1941.9156	1941.9156	R	R	371	387
PSM	LQIRHEQISDLER	650	sp|P29144|TPP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=4805	31.691	2	1635.8693	1635.8693	R	L	890	903
PSM	LREQLQLLEEQHR	651	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:267,13-UNIMOD:267	ms_run[2]:scan=5442	35.61	2	1710.928	1710.9280	R	A	2562	2575
PSM	LTHYDHVLIELTQAGLK	652	sp|Q14566|MCM6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	17-UNIMOD:188	ms_run[2]:scan=9421	61.211	2	1956.0776	1956.0776	R	G	780	797
PSM	MREIVHLQAGQCGNQIGAK	653	sp|P68371|TBB4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:4	ms_run[2]:scan=4660	30.818	3	2109.0572	2109.0572	-	F	1	20
PSM	NLFAEIIEEHLANR	654	sp|Q9NWY4|HPF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=11709	76.969	2	1667.8631	1667.8631	R	S	323	337
PSM	NLKLGIHEDSTNR	655	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=3206	21.896	2	1495.7743	1495.7743	K	R	436	449
PSM	NTDLYHCLLEHLQR	656	sp|Q8WVV4-1|POF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	7-UNIMOD:4	ms_run[2]:scan=10263	66.847	2	1810.8785	1810.8785	K	I	268	282
PSM	NVTKDHIMEIFSTYGK	657	sp|Q15287-3|RNPS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=8553	55.482	3	1881.9295	1881.9295	R	I	134	150
PSM	RDPHLACVAYER	658	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	7-UNIMOD:4	ms_run[2]:scan=3186	21.778	2	1485.7147	1485.7147	K	G	912	924
PSM	RFDEILEASDGIMVAR	659	sp|P14618-3|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=9462	61.48	3	1840.9256	1840.9256	R	G	264	280
PSM	SFPLHFDENSFFAGDKK	660	sp|Q96HE7|ERO1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	16-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=9455	61.433	2	1996.9722	1996.9722	K	E	353	370
PSM	SHTGERPFQCSLCSYASR	661	sp|P49711-2|CTCF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	10-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=5020	33.004	2	2141.9371	2141.9371	R	D	44	62
PSM	SKGLAPDLPEDLYHLIK	662	sp|P62277|RS13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=10644	69.377	3	1920.0759	1920.0759	K	K	77	94
PSM	SLHDALCVLAQTVKDSR	663	sp|P78371-2|TCPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	7-UNIMOD:4	ms_run[2]:scan=10461	68.156	3	1911.9836	1911.9836	R	T	342	359
PSM	SQFEAQKIWYEHR	664	sp|O75874|IDHC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5831	38.021	2	1720.8322	1720.8322	K	L	237	250
PSM	TCEEHQLCVVAVLPHILDTGAAGR	665	sp|Q15084-3|PDIA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:4,8-UNIMOD:4,24-UNIMOD:267	ms_run[2]:scan=10484	68.302	3	2655.3137	2655.3137	R	N	287	311
PSM	TCEEHQLCVVAVLPHILDTGAAGR	666	sp|Q15084-3|PDIA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:4,8-UNIMOD:4,24-UNIMOD:267	ms_run[2]:scan=10500	68.411	2	2655.3137	2655.3137	R	N	287	311
PSM	TFHFNTVEEVHSR	667	sp|P30740|ILEU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:267	ms_run[2]:scan=4974	32.728	2	1611.7669	1611.7669	K	F	57	70
PSM	THINIVVIGHVDSGK	668	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	15-UNIMOD:188	ms_run[2]:scan=6564	42.666	2	1593.8934	1593.8934	K	S	6	21
PSM	THINIVVIGHVDSGK	669	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5735	37.414	3	1587.8733	1587.8733	K	S	6	21
PSM	THINIVVIGHVDSGK	670	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6069	39.507	3	1587.8733	1587.8733	K	S	6	21
PSM	THINIVVIGHVDSGK	671	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6620	43.008	3	1587.8733	1587.8733	K	S	6	21
PSM	TIEEQLDEEHLESHKK	672	sp|Q9Y2D5|AKAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	15-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=4117	27.468	2	1975.989	1975.9890	K	Y	249	265
PSM	TLTAVHDAILEDLVFPSEIVGKR	673	sp|P62081|RS7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=12127	80.057	2	2522.3744	2522.3744	R	I	121	144
PSM	TPFLLSGTSYKDLMPHDLAR	674	sp|P55084-2|ECHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:35	ms_run[2]:scan=8683	56.336	2	2277.1464	2277.1464	R	A	40	60
PSM	VHFEESSKLEDLLR	675	sp|P12956-2|XRCC6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7908	51.187	3	1700.8733	1700.8733	R	K	190	204
PSM	VIKNPVSDHFPVGCMK	676	sp|Q92979|NEP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:188,14-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=6241	40.604	2	1838.9574	1838.9574	K	V	158	174
PSM	VKLGHTDILVGVK	677	sp|Q15024|EXOS7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=5683	37.095	2	1389.8746	1389.8746	R	A	51	64
PSM	VKLGHTDILVGVK	678	sp|Q15024|EXOS7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5685	37.106	2	1377.8344	1377.8344	R	A	51	64
PSM	VLEGHTDFINGLVFDPKEGQEIASVSDDHTCR	679	sp|Q8NFH4|NUP37_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	31-UNIMOD:4	ms_run[2]:scan=9661	62.8	4	3584.6842	3584.6842	K	I	119	151
PSM	VNLQNNPGAMEHFHMK	680	sp|P51572|BAP31_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	16-UNIMOD:188	ms_run[2]:scan=5462	35.73	2	1871.8866	1871.8866	K	L	80	96
PSM	YHTINGHNCEVK	681	sp|P51991-2|ROA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	9-UNIMOD:4	ms_run[2]:scan=1163	9.6244	2	1470.6674	1470.6674	K	K	166	178
PSM	KFLSDPQVHTVLVER	682	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=5978	38.93432333333333	3	1768.970275	1766.967919	R	S	67	82
PSM	SPGEGPSPSPMDQPSAPSDPTDQPPAAHAKPDPGSGGQPAGPGAAGEALAVLTSFGR	683	sp|Q9BSJ8|ESYT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0		ms_run[1]:scan=11627	76.35051666666666	4	5370.4972	5370.5122	R	R	4	61
PSM	IHVLEAQDLIAKDR	684	sp|Q9BSJ8|ESYT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=6414	41.71297166666667	3	1619.901389	1619.899505	R	F	651	665
PSM	THINIVVIGHVDSGK	685	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	15-UNIMOD:188	ms_run[1]:scan=6405	41.656145	2	1594.898140	1593.893419	K	S	6	21
PSM	RMEELHNQEMQK	686	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=1698	12.749865	2	1571.710676	1571.718446	R	R	548	560
PSM	DGQVHLFEHILNGYCK	687	sp|Q15061|WDR43_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	15-UNIMOD:4	ms_run[1]:scan=9598	62.38601	2	1929.906142	1928.920317	R	K	293	309
PSM	FQGIKHECQANGPEDLNR	688	sp|P60981|DEST_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	8-UNIMOD:4	ms_run[1]:scan=3709	24.973851666666665	2	2112.964099	2111.980686	K	A	128	146
PSM	FQGIKHECQANGPEDLNR	689	sp|P60981|DEST_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	5-UNIMOD:188,8-UNIMOD:4,18-UNIMOD:267	ms_run[1]:scan=3358	22.799643333333332	3	2128.004382	2128.009084	K	A	128	146
PSM	HFILDECDKMLEQLDMR	690	sp|Q13838|DX39B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	7-UNIMOD:4	ms_run[1]:scan=10117	65.86131166666667	3	2191.999865	2192.006431	K	R	192	209
PSM	FSVGGMTDVAEIKGHR	691	sp|P36776|LONM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	13-UNIMOD:188,16-UNIMOD:267	ms_run[1]:scan=6382	41.50736333333334	2	1718.864202	1718.874487	R	R	547	563
PSM	HLAEHSPYYEAMK	692	sp|Q12931|TRAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	13-UNIMOD:188	ms_run[1]:scan=3472	23.536508333333334	2	1580.737140	1580.738892	R	K	506	519
PSM	SDHYWVVGIHENPQQLR	693	sp|O75717|WDHD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0		ms_run[1]:scan=6729	43.701521666666665	2	2077.0382	2077.0122	K	C	672	689
PSM	RNTIQFTHTQIEAIR	694	sp|O60306|AQR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=5636	36.809684999999995	3	1827.980548	1826.975130	K	A	797	812
PSM	KHPDSSVNFAEFSK	695	sp|P26583|HMGB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	1-UNIMOD:188,14-UNIMOD:188	ms_run[1]:scan=4973	32.723565	2	1603.806038	1603.803329	K	K	30	44
PSM	AADRLPNLSSPSAEGPPGPPSGPAPR	696	sp|O60784-3|TOM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6101	39.715	2	2494.2564	2494.2564	K	K	408	434
PSM	AAIDWFDGKEFHGNIIK	697	sp|Q92804-2|RBP56_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9480	61.604	2	1959.9843	1959.9843	K	V	295	312
PSM	AIHNKVNIVPVIAK	698	sp|Q15019|SEPT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	5-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=4932	32.471	2	1526.9699	1526.9699	K	A	170	184
PSM	CTKEEAIEHNYGGHDDDLSVR	699	sp|Q93009-3|UBP7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:4	ms_run[2]:scan=4069	27.171	4	2444.0663	2444.0663	R	H	472	493
PSM	DHQLLEPIRDFEAR	700	sp|Q14134-2|TRI29_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	9-UNIMOD:267,14-UNIMOD:267	ms_run[2]:scan=7647	49.531	2	1757.8964	1757.8964	R	K	210	224
PSM	DLQSSDRLSNHISSLFR	701	sp|P11413|G6PD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8144	52.765	2	1973.9919	1973.9919	R	E	176	193
PSM	EAEAAIYHLQLFEELRR	702	sp|P14618-3|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10040	65.342	2	2087.08	2087.0800	R	L	369	386
PSM	FASDDEHDEHDENGATGPVKR	703	sp|P05455|LA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=1488	11.5	3	2324.9894	2324.9894	K	A	364	385
PSM	FVLQDGAHHMVDSNEISFIR	704	sp|Q96RP9|EFGM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8607	55.825	3	2314.1165	2314.1165	R	A	609	629
PSM	FYHDWNDKEIEVLNK	705	sp|Q9NTK5|OLA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6948	45.075	3	1948.9319	1948.9319	R	H	202	217
PSM	GFGFVTFDDHDPVDKIVLQK	706	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10342	67.372	3	2276.1477	2276.1477	R	Y	142	162
PSM	GHLSRPEAQSLSPYTTSANR	707	sp|O94776|MTA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	5-UNIMOD:267,20-UNIMOD:267	ms_run[2]:scan=4230	28.165	2	2191.0885	2191.0885	R	A	424	444
PSM	HADHSSLTLGSGSSTTR	708	sp|Q7Z6Z7-2|HUWE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	17-UNIMOD:267	ms_run[2]:scan=2071	15.013	3	1722.8161	1722.8161	R	L	2522	2539
PSM	HGKNPVMELNEK	709	sp|Q12906-5|ILF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	3-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=2617	18.315	2	1406.7379	1406.7379	K	R	524	536
PSM	HGKNPVMELNEK	710	sp|Q12906-5|ILF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=2653	18.535	2	1394.6976	1394.6976	K	R	524	536
PSM	HGVYNPNKIFGVTTLDIVR	711	sp|P40926|MDHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9252	60.068	3	2142.1586	2142.1586	K	A	158	177
PSM	HINTWVAEKTEGK	712	sp|P35237|SPB6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=3179	21.736	2	1511.7732	1511.7732	K	I	133	146
PSM	HLAGLGLTEAIDKNK	713	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=5699	37.192	3	1590.9132	1590.9132	K	A	320	335
PSM	HLEINPDHPIVETLR	714	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6501	42.257	3	1781.9424	1781.9424	K	Q	625	640
PSM	HLLIGLPSGAILSLPK	715	sp|Q8N766-4|EMC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	16-UNIMOD:188	ms_run[2]:scan=11173	73.046	3	1634.0226	1634.0226	R	A	838	854
PSM	HQALQAEIAGHEPR	716	sp|Q13813-2|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	14-UNIMOD:267	ms_run[2]:scan=3657	24.66	3	1565.7938	1565.7938	K	I	826	840
PSM	HQALQAEIAGHEPR	717	sp|Q13813-2|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=3659	24.671	2	1555.7855	1555.7855	K	I	826	840
PSM	HQALQAEIAGHEPR	718	sp|Q13813-2|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=3672	24.748	3	1555.7855	1555.7855	K	I	826	840
PSM	HRPSEADEEELAR	719	sp|O14617-3|AP3D1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=1910	14.045	3	1537.7121	1537.7121	K	R	486	499
PSM	HRPSEADEEELAR	720	sp|O14617-3|AP3D1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	2-UNIMOD:267,13-UNIMOD:267	ms_run[2]:scan=1908	14.034	3	1557.7286	1557.7286	K	R	486	499
PSM	HTGPGILSMANAGPNTNGSQFFICTAK	721	sp|P62937|PPIA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	24-UNIMOD:4	ms_run[2]:scan=9555	62.099	3	2790.3218	2790.3218	K	T	92	119
PSM	HVFGQAVKNDQCYDDIR	722	sp|Q9ULV4|COR1C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:4	ms_run[2]:scan=4550	30.156	3	2063.9483	2063.9483	R	V	12	29
PSM	HVFLTGPPGVGK	723	sp|Q9BSD7|NTPCR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:188	ms_run[2]:scan=5228	34.293	2	1213.6915	1213.6915	R	T	4	16
PSM	HYFQNTQGLIFVVDSNDRER	724	sp|P84085|ARF5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8170	52.944	3	2437.1775	2437.1775	R	V	80	100
PSM	HYPVNSVIFCALDPQDRK	725	sp|Q68CZ2-2|TENS3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	10-UNIMOD:4	ms_run[2]:scan=8558	55.513	3	2158.063	2158.0630	R	W	1132	1150
PSM	IDHYLGKEMVQNLMVLR	726	sp|P11413|G6PD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9954	64.775	2	2058.0754	2058.0754	R	F	199	216
PSM	IHQCQHTNEPLFK	727	sp|Q92664-2|TF3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	4-UNIMOD:4	ms_run[2]:scan=2730	18.993	2	1650.7937	1650.7937	K	L	151	164
PSM	IHSLTHLDSVTK	728	sp|P46736-4|BRCC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:188	ms_run[2]:scan=3355	22.782	2	1355.7504	1355.7504	R	I	136	148
PSM	IHVFYIDYGNREVLPSTR	729	sp|Q7KZF4|SND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8096	52.411	2	2178.1222	2178.1222	K	L	759	777
PSM	KIIFHSGPTNSGK	730	sp|Q8IYB8|SUV3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=1834	13.584	2	1384.7463	1384.7463	R	T	201	214
PSM	KISSIQSIVPALEIANAHR	731	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:188,19-UNIMOD:267	ms_run[2]:scan=9119	59.189	2	2062.187	2058.1988	K	K	250	269
PSM	KPAAGLSAAPVPTAPAAGAPLMDFGNDFVPPAPR	732	sp|Q9NQC3-2|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	22-UNIMOD:35	ms_run[2]:scan=9993	65.032	3	3286.6809	3286.6809	R	G	58	92
PSM	KPHTESLELQVR	733	sp|Q9BSJ8|ESYT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=3537	23.916	2	1435.7783	1435.7783	R	G	855	867
PSM	KPQGVDPASFHFLDTPIAK	734	sp|Q969G9|NKD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8575	55.621	2	2067.0789	2067.0789	R	V	309	328
PSM	KQELEEILHDLESR	735	sp|P35580|MYH10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10364	67.518	2	1737.8897	1737.8897	K	V	917	931
PSM	KQMVIDVLHPGK	736	sp|P62847-2|RS24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5430	35.542	3	1363.7646	1363.7646	R	A	21	33
PSM	KTYFAHDALQQCTVGDIVLLR	737	sp|Q9Y2R5|RT17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:4	ms_run[2]:scan=9261	60.127	2	2447.2631	2447.2631	R	A	47	68
PSM	KWESPAQNTAHLDQFER	738	sp|P17612-2|KAPCA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5654	36.923	3	2055.9763	2055.9763	K	I	22	39
PSM	LHLSGIDANPNALFPPVEFPAPR	739	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11346	74.275	2	2471.2961	2471.2961	R	G	803	826
PSM	LHNMIVDLDNVVKK	740	sp|Q16891-3|MIC60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=7525	48.745	2	1648.9373	1648.9373	K	V	299	313
PSM	LHNMIVDLDNVVKK	741	sp|Q16891-3|MIC60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7533	48.797	2	1636.8971	1636.8971	K	V	299	313
PSM	LHNTIVEINNHK	742	sp|Q9NTJ3-2|SMC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:188	ms_run[2]:scan=2806	19.444	2	1436.7831	1436.7831	R	L	887	899
PSM	LIDLHTNVATAVLEHIK	743	sp|Q8WVM8-2|SCFD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10445	68.051	3	1886.0625	1886.0625	R	A	306	323
PSM	LKLPSIPLVPVSAQK	744	sp|Q15785|TOM34_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9682	62.934	2	1588.9916	1588.9916	R	R	142	157
PSM	LKSELHLLDFQGK	745	sp|Q9Y3A2-2|UTP11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7240	46.884	2	1526.8457	1526.8457	R	Q	119	132
PSM	LKSELHLLDFQGK	746	sp|Q9Y3A2-2|UTP11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	2-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=7239	46.878	2	1538.8859	1538.8859	R	Q	119	132
PSM	LKVPPAINQFTQALDR	747	sp|P62424|RL7A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10277	66.941	3	1810.0101	1810.0101	R	Q	74	90
PSM	LLHDLQIGEKK	748	sp|P49756-2|RBM25_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	10-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=4102	27.377	2	1304.7855	1304.7855	R	L	146	157
PSM	LQHLAESWGGKENGFGLAECCR	749	sp|Q7Z6Z7-2|HUWE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	20-UNIMOD:4,21-UNIMOD:4	ms_run[2]:scan=6921	44.905	3	2518.1482	2518.1482	R	D	163	185
PSM	LVGGTTPGKGGQTHLGLPVFNTVK	750	sp|P53597|SUCA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7430	48.123	2	2377.3118	2377.3118	K	E	82	106
PSM	MAQALEELRSQHDEQVR	751	sp|Q03252|LMNB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5153	33.828	2	2038.9854	2038.9854	K	L	256	273
PSM	MCTLIDKFDEHDGPVR	752	sp|P53621|COPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	2-UNIMOD:4	ms_run[2]:scan=6887	44.691	3	1931.887	1931.8870	R	G	40	56
PSM	MDIDAPDVDVHGPDWHLK	753	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:35,18-UNIMOD:188	ms_run[2]:scan=7228	46.809	2	2080.962	2080.9620	K	M	2030	2048
PSM	MGVVECAKHELLQPFNVLYEK	754	sp|Q9UQ80-2|PA2G4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:35,6-UNIMOD:4	ms_run[2]:scan=10306	67.132	3	2519.2553	2519.2553	R	E	237	258
PSM	MLEIDPQKVNINGGAVSLGHPIGMSGAR	755	sp|P24752|THIL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9019	58.494	3	2860.4688	2860.4688	K	I	366	394
PSM	MREIVHIQAGQCGNQIGTK	756	sp|Q9BUF5|TBB6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:35,2-UNIMOD:267,12-UNIMOD:4,19-UNIMOD:188	ms_run[2]:scan=3916	26.232	2	2171.091	2167.1029	-	F	1	20
PSM	NLEEGHSSTVAAHYNELQEVGLEKR	757	sp|O43148|MCES_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6019	39.188	3	2809.3631	2809.3631	K	S	140	165
PSM	NLHQSNFSLSGAQIDDNNPRR	758	sp|Q14194|DPYL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5299	34.729	2	2382.1425	2382.1425	R	T	533	554
PSM	NRNEQESAVHPR	759	sp|Q9UJU6-5|DBNL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=663	6.8053	2	1435.6916	1435.6916	R	E	144	156
PSM	NVEGVEEVHELHVWQLAGSR	760	sp|Q9Y6M5|ZNT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8278	53.637	2	2287.1345	2287.1345	R	I	362	382
PSM	NVTGILWNLSSSDHLKDR	761	sp|Q9Y446|PKP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8982	58.252	3	2054.0545	2054.0545	K	L	422	440
PSM	NVTKDHIMEIFSTYGK	762	sp|Q15287-3|RNPS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	4-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=8554	55.488	3	1893.9697	1893.9697	R	I	134	150
PSM	QVASHVGLHSASIPGILALDLCPSDTNK	763	sp|Q9UMS4|PRP19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	22-UNIMOD:4	ms_run[2]:scan=10190	66.364	3	2899.4862	2899.4862	R	I	209	237
PSM	RDQALTEEHAR	764	sp|P12814-2|ACTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=845	7.8284	2	1324.6484	1324.6484	R	Q	614	625
PSM	RGEQADHFTQTPLDPGSQVLVR	765	sp|Q9BTE6|AASD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6653	43.218	3	2450.2302	2450.2302	R	V	75	97
PSM	RGPGPVDLLLCCGDFQAVR	766	sp|Q9UK59|DBR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=10397	67.732	3	2129.051	2129.0510	R	N	26	45
PSM	RIEEQSLHDVLFELSK	767	sp|P98196|AT11A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9649	62.72	3	1942.016	1942.0160	K	T	717	733
PSM	RLAQDGAHVVVSSR	768	sp|Q9BTZ2-3|DHRS4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=2242	16.061	2	1493.8063	1493.8063	R	K	51	65
PSM	RLVHQNSASDDAEASMISK	769	sp|Q13616|CUL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:267,19-UNIMOD:188	ms_run[2]:scan=3227	22.019	2	2074.0084	2070.0203	K	L	473	492
PSM	SESNRFPLPFPFPSK	770	sp|Q96SY0-4|INT14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10601	69.094	2	1748.8886	1748.8886	R	L	58	73
PSM	SIYGEKFEDENFILK	771	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8623	55.93	2	1830.904	1830.9040	K	H	77	92
PSM	SQFEAQKIWYEHR	772	sp|O75874|IDHC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5829	38.01	3	1720.8322	1720.8322	K	L	237	250
PSM	TEWLDGKHVVFGK	773	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	7-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=6426	41.785	2	1526.8284	1526.8284	K	V	119	132
PSM	TEWLDGKHVVFGK	774	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6434	41.83	2	1514.7882	1514.7882	K	V	119	132
PSM	TFIIGELHPDDRPK	775	sp|P00167-2|CYB5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6368	41.42	2	1636.8573	1636.8573	K	L	78	92
PSM	TFRNWMNSLGVNPR	776	sp|P13796|PLSL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8729	56.63	2	1690.8362	1690.8362	R	V	399	413
PSM	TGTITTFEHAHNMR	777	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	14-UNIMOD:267	ms_run[2]:scan=3869	25.961	2	1624.7655	1624.7655	K	V	482	496
PSM	THINIVVIGHVDSGK	778	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	15-UNIMOD:188	ms_run[2]:scan=5726	37.357	3	1593.8934	1593.8934	K	S	6	21
PSM	THINIVVIGHVDSGK	779	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5907	38.492	3	1587.8733	1587.8733	K	S	6	21
PSM	THINIVVIGHVDSGK	780	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6622	43.018	2	1587.8733	1587.8733	K	S	6	21
PSM	THINIVVIGHVDSGK	781	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6243	40.621	3	1587.8733	1587.8733	K	S	6	21
PSM	THLPGFVEQAEALKAK	782	sp|P30044-2|PRDX5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6881	44.655	3	1737.9414	1737.9414	K	G	51	67
PSM	THLPGFVEQAEALKAK	783	sp|P30044-2|PRDX5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6889	44.702	2	1737.9414	1737.9414	K	G	51	67
PSM	THNDIIHNENMR	784	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:35,12-UNIMOD:267	ms_run[2]:scan=1122	9.3931	2	1518.6873	1518.6873	R	Q	548	560
PSM	TKDLPVTEAVFSALVTGHAR	785	sp|P42704|LPPRC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10801	70.425	3	2111.1375	2111.1375	K	A	225	245
PSM	TKGFHTTIDIGVK	786	sp|Q15417-3|CNN3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5049	33.177	2	1415.7773	1415.7773	K	Y	85	98
PSM	TLREQGVEEHETLLLR	787	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5655	36.928	3	1922.0221	1922.0221	R	R	179	195
PSM	VANDNAPEHALRPGFLSTFALATDQGSK	788	sp|Q9UHA4|LTOR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9601	62.409	3	2926.4573	2926.4573	K	L	35	63
PSM	VFLENVIRDAVTYTEHAK	789	sp|P62805|H4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=12125	80.045	2	2104.0953	2104.0953	K	R	61	79
PSM	VGKGEPGAAPLSAPAFSLVFPFLK	790	sp|Q92616|GCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=13140	91.29	3	2399.3253	2399.3253	R	M	963	987
PSM	VKLFTAHNNMTNYATVWASK	791	sp|Q08211|DHX9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7955	51.485	3	2295.147	2295.1470	K	T	736	756
PSM	YHTVNGHNCEVR	792	sp|P09651-3|ROA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	9-UNIMOD:4	ms_run[2]:scan=913	8.2077	2	1484.6579	1484.6579	K	K	167	179
PSM	YRTEAHQDVVGR	793	sp|Q9H0A0-2|NAT10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=1193	9.7924	2	1429.7062	1429.7062	R	F	99	111
PSM	YSHLQPGDHLTDITLK	794	sp|Q15046|SYK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	16-UNIMOD:188	ms_run[2]:scan=6141	39.974	2	1842.9571	1842.9571	K	V	112	128
PSM	HSQFLGYPITLYLEKER	795	sp|Q58FF8|H90B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	15-UNIMOD:188,17-UNIMOD:267	ms_run[1]:scan=9874	64.22340666666666	3	2109.126134	2109.122974	K	E	127	144
PSM	RDHALLEEQSK	796	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	1-UNIMOD:267,11-UNIMOD:188	ms_run[1]:scan=1477	11.436836666666666	2	1341.706730	1340.701926	K	Q	633	644
PSM	QLNVNAKPFVPNVHAAEFVPSFLR	797	sp|P15170-2|ERF3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:28,7-UNIMOD:188,24-UNIMOD:267	ms_run[1]:scan=11965	78.82357666666667	3	2692.4394	2692.4455	R	G	68	92
PSM	HLNEIDLFHCIDPNDSK	798	sp|Q15185|TEBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	10-UNIMOD:4,17-UNIMOD:188	ms_run[1]:scan=8386	54.358309999999996	3	2071.973139	2071.972869	K	H	49	66
PSM	TCEEHQLCVVAVLPHILDTGAAGR	799	sp|Q15084|PDIA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	2-UNIMOD:4,8-UNIMOD:4,24-UNIMOD:267	ms_run[1]:scan=10490	68.34467333333333	4	2655.317828	2655.313660	R	N	290	314
PSM	HFILDECDKMLEQLDMR	800	sp|Q13838|DX39B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	7-UNIMOD:4,9-UNIMOD:188,17-UNIMOD:267	ms_run[1]:scan=10121	65.89075	3	2208.027834	2208.034829	K	R	192	209
PSM	AADHLKPFLDDSTLR	801	sp|O43395|PRPF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	6-UNIMOD:188,15-UNIMOD:267	ms_run[1]:scan=6416	41.72397166666667	3	1713.904300	1713.902082	K	F	47	62
PSM	QGCKNEEVLAVLGHELGHWK	802	sp|O75844|FACE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:28,3-UNIMOD:4,4-UNIMOD:188,20-UNIMOD:188	ms_run[1]:scan=10971	71.65258333333334	3	2298.1556	2298.1613	K	L	322	342
PSM	YHTINGHNAEVR	803	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	12-UNIMOD:267	ms_run[1]:scan=1710	12.819126666666666	2	1420.666613	1419.688279	K	K	174	186
PSM	MREIVHIQAGQCGNQIGAK	804	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	1-UNIMOD:35,12-UNIMOD:4	ms_run[1]:scan=4247	28.270961666666665	3	2127.036488	2125.052077	-	F	1	20
PSM	AADRLPNLSSPSAEGPPGPPSGPAPR	805	sp|O60784-3|TOM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6062	39.462	3	2494.2564	2494.2564	K	K	408	434
PSM	AGKFPSLLTHNENMVAK	806	sp|P62906|RL10A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:188,14-UNIMOD:35,17-UNIMOD:188	ms_run[2]:scan=5210	34.186	2	1883.9966	1883.9966	K	V	131	148
PSM	AGSRYEDFSNLGTTHLLR	807	sp|P22695|QCR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	4-UNIMOD:267,18-UNIMOD:267	ms_run[2]:scan=7155	46.351	3	2056.0241	2056.0241	K	L	67	85
PSM	AHVSPHEMLQAVVLCSK	808	sp|Q53GS9-2|SNUT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	15-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=7267	47.058	3	1910.9802	1910.9802	K	K	189	206
PSM	CDLHRLEEGPPVTTVLTR	809	sp|P08559-3|ODPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:4,5-UNIMOD:267,18-UNIMOD:267	ms_run[2]:scan=7048	45.695	3	2112.0901	2112.0901	K	E	41	59
PSM	CPLLKPWALTFSYGR	810	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:4	ms_run[2]:scan=10803	70.437	3	1807.9443	1807.9443	K	A	290	305
PSM	DLLAEQQPHHLATAVPLTPR	811	sp|Q7L9B9|EEPD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6779	44.013	3	2206.1859	2206.1859	R	V	117	137
PSM	DNVSSPGGATIHALHVLESGGFR	812	sp|P32322-2|P5CR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10412	67.831	4	2320.156	2320.1560	K	S	229	252
PSM	ELHEVCHLLEQER	813	sp|Q15276|RABE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	6-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=5613	36.669	2	1700.818	1700.8180	K	Q	258	271
PSM	FLSNGHVTIPGQQDKDMFQETMEAMR	814	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9888	64.322	3	3009.3783	3009.3783	R	I	302	328
PSM	FNEEHIPDSPFVVPVASPSGDARR	815	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	23-UNIMOD:267,24-UNIMOD:267	ms_run[2]:scan=8272	53.602	3	2642.2992	2642.2992	K	L	2303	2327
PSM	GHFGVVYHGEYIDQAQNR	816	sp|Q04912-7|RON_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	18-UNIMOD:267	ms_run[2]:scan=5317	34.845	3	2098.9849	2098.9849	K	I	985	1003
PSM	GILTLKYPIEHGIITNWDDMEK	817	sp|P63267|ACTH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	6-UNIMOD:188,20-UNIMOD:35,22-UNIMOD:188	ms_run[2]:scan=9753	63.397	3	2613.3551	2613.3551	R	I	64	86
PSM	GISHVIVDEIHER	818	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5585	36.49	2	1502.7841	1502.7841	R	D	504	517
PSM	GLGTDEDSLIEIICSR	819	sp|P07355-2|ANXA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	14-UNIMOD:4	ms_run[2]:scan=11557	75.84	2	1776.8564	1776.8564	K	T	138	154
PSM	GSPNFTPGEHCEEHVAFFK	820	sp|Q96DM3|RMC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:4	ms_run[2]:scan=6521	42.384	2	2188.9636	2188.9636	R	Q	625	644
PSM	GVLKVFLENVIR	821	sp|P62805|H4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11305	73.998	2	1385.8395	1385.8395	R	D	57	69
PSM	HCLQTVWNKPTVK	822	sp|P07602|SAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:4,9-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=4057	27.099	2	1621.8801	1621.8801	K	S	47	60
PSM	HEDLKDMLEFPAQELR	823	sp|O00267-2|SPT5H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9892	64.351	3	1969.9568	1969.9568	K	K	450	466
PSM	HLIPAANTGESKVFYYK	824	sp|P62258-2|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5861	38.213	3	1937.0047	1937.0047	K	M	85	102
PSM	HLYDIHVTVQPK	825	sp|A8MXV4|NUD19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5301	34.741	2	1448.7776	1448.7776	R	Y	348	360
PSM	HQAFEAELHANADR	826	sp|Q13813-2|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	14-UNIMOD:267	ms_run[2]:scan=3514	23.79	3	1617.7523	1617.7523	K	I	1597	1611
PSM	HQAFEAELHANADR	827	sp|Q13813-2|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=3516	23.8	3	1607.7441	1607.7441	K	I	1597	1611
PSM	HRPSEADEEELAR	828	sp|O14617-3|AP3D1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=1906	14.022	2	1537.7121	1537.7121	K	R	486	499
PSM	HSQFLGYPITLYLEKER	829	sp|Q58FF8|H90B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9875	64.229	2	2093.0946	2093.0946	K	E	127	144
PSM	HVAEVLEYTKDEQLESLFQR	830	sp|P05198|IF2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	10-UNIMOD:188,20-UNIMOD:267	ms_run[2]:scan=9639	62.657	2	2449.246	2445.2579	R	T	114	134
PSM	HVVFTAETHNFPTGVCPFSGATTGTGGR	831	sp|O15067|PUR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	16-UNIMOD:4	ms_run[2]:scan=7657	49.592	4	2904.3613	2904.3613	R	I	303	331
PSM	HYGPGWVSMANAGKDTNGSQFFITTVK	832	sp|P23284|PPIB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9234	59.952	3	2912.3916	2912.3916	K	T	132	159
PSM	IFCCHGGLSPDLQSMEQIRR	833	sp|P62136-3|PP1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:4,4-UNIMOD:4	ms_run[2]:scan=7436	48.165	2	2403.1246	2403.1246	K	I	125	145
PSM	ILDWHVANTDKK	834	sp|P37837|TALDO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=4835	31.873	2	1438.7569	1438.7569	R	S	193	205
PSM	ILDWHVANTDKK	835	sp|P37837|TALDO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=4825	31.813	2	1450.7971	1450.7971	R	S	193	205
PSM	IQCVPKEPHSFQSR	836	sp|Q9HB07|MYG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:4	ms_run[2]:scan=3151	21.567	2	1711.8464	1711.8464	R	L	303	317
PSM	ISIEMHGTLEDQLSHLR	837	sp|P12814-2|ACTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8856	57.445	3	1977.9942	1977.9942	R	Q	656	673
PSM	KADVIPVHYYLIPPPTK	838	sp|P29144|TPP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=7638	49.474	3	1962.1381	1962.1381	K	T	983	1000
PSM	KAHEILPNLVCCSAK	839	sp|P50990|TCPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:188,11-UNIMOD:4,12-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=5510	36.026	3	1750.9261	1750.9261	R	N	138	153
PSM	KGADSLEDFLYHEGYACTSIHGDR	840	sp|O00571-2|DDX3X_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	17-UNIMOD:4	ms_run[2]:scan=8928	57.916	4	2740.2187	2740.2187	K	S	436	460
PSM	KGQTHTLEDFQR	841	sp|Q99714-2|HCD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=2800	19.408	2	1458.7215	1458.7215	K	V	105	117
PSM	KHFVCEGCEQLLSGR	842	sp|Q9NZU5-2|LMCD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	5-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=4755	31.378	3	1818.8505	1818.8505	R	A	258	273
PSM	KIGDLACANIQHLSSR	843	sp|Q7L8L6|FAKD5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	7-UNIMOD:4	ms_run[2]:scan=5764	37.598	3	1781.9207	1781.9207	R	S	339	355
PSM	KLSSWDQAETPGHTPSLR	844	sp|O75533|SF3B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5154	33.834	3	2008.9967	2008.9967	K	W	214	232
PSM	KTYFAHDALQQCTVGDIVLLR	845	sp|Q9Y2R5|RT17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:4	ms_run[2]:scan=9247	60.033	3	2447.2631	2447.2631	R	A	47	68
PSM	KVLCLAVAVGHVK	846	sp|P62906|RL10A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:188,4-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=5579	36.451	3	1404.8678	1404.8678	K	M	161	174
PSM	LGHAEQKDEMVPR	847	sp|Q9P258|RCC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=1926	14.142	2	1508.7406	1508.7406	R	L	362	375
PSM	LGVTANDVKNVIIWGNHSSTQYPDVNHAK	848	sp|P40925-2|MDHC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8651	56.125	3	3176.6003	3176.6003	K	V	82	111
PSM	LHELNQKWEALK	849	sp|Q13813-2|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	7-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=5019	32.998	2	1519.855	1519.8550	K	A	865	877
PSM	LHISQLQHENSILK	850	sp|Q14203-5|DCTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	14-UNIMOD:188	ms_run[2]:scan=5552	36.283	2	1664.9305	1664.9305	R	G	963	977
PSM	LHNMIVDLDNVVKK	851	sp|Q16891-3|MIC60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7532	48.791	3	1636.8971	1636.8971	K	V	299	313
PSM	LKEHIIGQESAIATVGAAIR	852	sp|Q9H078-5|CLPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:188,20-UNIMOD:267	ms_run[2]:scan=7422	48.071	2	2092.1975	2088.2094	R	R	142	162
PSM	LKGCSNEPYFGSLTALVCQHSITPLALPCK	853	sp|Q68CZ2-2|TENS3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	4-UNIMOD:4,18-UNIMOD:4,29-UNIMOD:4	ms_run[2]:scan=11583	76.032	3	3360.6669	3360.6669	R	L	1008	1038
PSM	LLLETHLPSKK	854	sp|O00567|NOP56_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	10-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=4686	30.96	2	1289.811	1289.8110	R	K	78	89
PSM	LNCQVIGASVDSHFCHLAWVNTPK	855	sp|Q06830|PRDX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:4,15-UNIMOD:4,24-UNIMOD:188	ms_run[2]:scan=9217	59.844	3	2758.3415	2758.3415	K	K	69	93
PSM	LQFHNVKPECLEAYNK	856	sp|O75323|NIPS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	10-UNIMOD:4	ms_run[2]:scan=5771	37.644	3	1988.9778	1988.9778	K	I	76	92
PSM	LQHTLQQVLDQREEVR	857	sp|O00273-2|DFFA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6070	39.513	2	1991.0548	1991.0548	R	Q	171	187
PSM	LQIRHEQISDLER	858	sp|P29144|TPP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	4-UNIMOD:267,13-UNIMOD:267	ms_run[2]:scan=4800	31.66	2	1655.8858	1655.8858	R	L	890	903
PSM	LRENVFQEHQTLK	859	sp|Q14247-3|SRC8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=4125	27.518	2	1640.8635	1640.8635	K	E	58	71
PSM	NMSVIAHVDHGK	860	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=2814	19.492	2	1306.6452	1306.6452	R	S	21	33
PSM	NSNLDRHNLQDFINIK	861	sp|P46821|MAP1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7414	48.017	2	1939.9864	1939.9864	K	L	198	214
PSM	PSQMEHAMETMMFTFHK	862	sp|P60903|S10AA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	17-UNIMOD:188	ms_run[2]:scan=10481	68.285	4	2087.9033	2087.9033	M	F	2	19
PSM	RDHALLEEQSK	863	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=1484	11.479	2	1324.6735	1324.6735	K	Q	633	644
PSM	RDQALTEEHAR	864	sp|P12814-2|ACTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:267,11-UNIMOD:267	ms_run[2]:scan=841	7.8098	2	1344.6649	1344.6649	R	Q	614	625
PSM	RDQALTEEHAR	865	sp|P12814-2|ACTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:267,11-UNIMOD:267	ms_run[2]:scan=850	7.8568	3	1344.6649	1344.6649	R	Q	614	625
PSM	RFDSELSQAHEEAQR	866	sp|Q92614-5|MY18A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:267,15-UNIMOD:267	ms_run[2]:scan=3658	24.665	3	1821.8509	1821.8509	R	E	1004	1019
PSM	RGDLPFVVPR	867	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:267,10-UNIMOD:267	ms_run[2]:scan=6756	43.867	2	1174.6726	1174.6726	R	R	1923	1933
PSM	RNTIQFTHTQIEAIR	868	sp|O60306|AQR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:267,15-UNIMOD:267	ms_run[2]:scan=5642	36.844	2	1846.9917	1846.9917	K	A	797	812
PSM	RVHVTQEDFEMAVAK	869	sp|P62195-2|PRS8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5496	35.937	3	1758.8723	1758.8723	R	V	367	382
PSM	RVQHSDTPSGAR	870	sp|Q5XXA6-3|ANO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:267,12-UNIMOD:267	ms_run[2]:scan=507	5.9288	2	1329.6652	1329.6652	R	S	54	66
PSM	SFHPEQDAGKVFK	871	sp|Q9BV38|WDR18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=4572	30.287	2	1488.7361	1488.7361	R	G	254	267
PSM	SFPLHFDENSFFAGDKK	872	sp|Q96HE7|ERO1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9438	61.323	3	1984.9319	1984.9319	K	E	353	370
PSM	SGGASHSELIHNLR	873	sp|P22061|PIMT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=3059	21.005	3	1476.7433	1476.7433	K	K	5	19
PSM	SGGASHSELIHNLR	874	sp|P22061|PIMT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=3076	21.109	2	1476.7433	1476.7433	K	K	5	19
PSM	SLHDALCVLAQTVKDSR	875	sp|P78371-2|TCPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	7-UNIMOD:4,14-UNIMOD:188,17-UNIMOD:267	ms_run[2]:scan=10468	68.198	2	1928.012	1924.0239	R	T	342	359
PSM	SLSNVIAHEISHSWTGNLVTNK	876	sp|P09960-3|LKHA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10201	66.437	2	2406.2292	2406.2292	K	T	265	287
PSM	SPTKAPHLQLIEGK	877	sp|O43491-2|E41L2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	4-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=4654	30.78	2	1529.8968	1529.8968	R	T	598	612
PSM	SQLDIIIHSLKK	878	sp|P13010|XRCC5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8019	51.904	2	1393.8293	1393.8293	K	C	145	157
PSM	STTGPFDREHLLSYLEK	879	sp|Q9NYL9|TMOD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8967	58.156	2	1991.9953	1991.9953	K	E	59	76
PSM	TAWLDGKHVVFGK	880	sp|P23284|PPIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6431	41.815	2	1456.7827	1456.7827	K	V	159	172
PSM	TCVHTFFDHQDQVWGVK	881	sp|Q9GZS3|WDR61_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:4	ms_run[2]:scan=7682	49.75	3	2102.9632	2102.9632	R	Y	265	282
PSM	TEILSLEKPLLLHTGMGR	882	sp|Q9GZT8|NIF3L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9121	59.2	2	2007.1187	2007.1187	K	L	235	253
PSM	TFHFNTVEEVHSR	883	sp|P30740|ILEU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:267	ms_run[2]:scan=4964	32.672	3	1611.7669	1611.7669	K	F	57	70
PSM	TGTITTFEHAHNMR	884	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:35,14-UNIMOD:267	ms_run[2]:scan=2734	19.019	2	1640.7605	1640.7605	K	V	482	496
PSM	THINIVVIGHVDSGK	885	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6452	41.942	3	1587.8733	1587.8733	K	S	6	21
PSM	THNDIIHNENMR	886	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:267	ms_run[2]:scan=2158	15.548	2	1502.6924	1502.6924	R	Q	548	560
PSM	TIKVWQLGSSSPNFTLEGHEK	887	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:188,21-UNIMOD:188	ms_run[2]:scan=8267	53.569	3	2369.2418	2369.2418	R	G	137	158
PSM	TVKHFSTEDGIFQGQR	888	sp|Q6RFH5-2|WDR74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=4798	31.647	2	1848.9119	1848.9119	R	H	66	82
PSM	TVKHFSTEDGIFQGQR	889	sp|Q6RFH5-2|WDR74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=4799	31.653	3	1848.9119	1848.9119	R	H	66	82
PSM	TWNHFSDNEAERVK	890	sp|Q99543|DNJC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=4107	27.405	2	1731.7965	1731.7965	K	M	362	376
PSM	VASLLEHHALQLCQQTGR	891	sp|O60826|CCD22_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:4,18-UNIMOD:267	ms_run[2]:scan=5937	38.677	3	2070.0668	2070.0668	R	D	203	221
PSM	VCEIHFHEINNK	892	sp|Q96DH6-3|MSI2H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:4,12-UNIMOD:188	ms_run[2]:scan=3970	26.569	2	1544.7501	1544.7501	K	M	63	75
PSM	VHLVGIDIFTGK	893	sp|Q9GZV4|IF5A2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:188	ms_run[2]:scan=9517	61.853	2	1303.7596	1303.7596	K	K	56	68
PSM	VHVGDEDFVHLR	894	sp|P04080|CYTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5772	37.651	2	1421.7052	1421.7052	K	V	57	69
PSM	VLKQVHPDTGISSK	895	sp|Q99880|H2B1L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=2187	15.726	2	1519.8761	1519.8761	K	A	45	59
PSM	VLKQVHPDTGISSK	896	sp|Q99880|H2B1L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=2189	15.737	2	1507.8358	1507.8358	K	A	45	59
PSM	YFLNHIDQTTTWQDPRK	897	sp|P46937-5|YAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6938	45.013	3	2162.0545	2162.0545	R	A	188	205
PSM	YGYTHLSAGELLRDER	898	sp|P30085|KCY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=6599	42.887	2	1898.939	1898.9390	K	K	27	43
PSM	YHTINGHNAEVR	899	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=1329	10.55	2	1409.68	1409.6800	K	K	162	174
PSM	YHTVNGHNCEVR	900	sp|P09651-3|ROA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	9-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=914	8.2119	2	1494.6662	1494.6662	K	K	167	179
PSM	YRTEAHQDVVGR	901	sp|Q9H0A0-2|NAT10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:267,12-UNIMOD:267	ms_run[2]:scan=1192	9.7877	2	1449.7228	1449.7228	R	F	99	111
PSM	NLHVVFTMNPSSEGLKDR	902	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=7022	45.527570000000004	3	2044.025813	2043.020759	R	A	3061	3079
PSM	SHLLNCCPHDVLSGTR	903	sp|Q9Y383|LC7L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	6-UNIMOD:4,7-UNIMOD:4,16-UNIMOD:267	ms_run[1]:scan=4884	32.170336666666664	2	1874.874456	1874.875505	K	M	38	54
PSM	IMGLDLPDGGHLTHGYMSDVK	904	sp|P34897|GLYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=8794	57.046641666666666	2	2256.047152	2255.071474	R	R	161	182
PSM	PLEQQQPHHIPTSAPVYQQPQQQPVAQSYGGYKEPAAPVSIQR	905	sp|Q14847|LASP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=6440	41.86915166666667	4	4777.401469	4777.400101	R	S	155	198
PSM	CDLHRLEEGPPVTTVLTR	906	sp|P08559|ODPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:385,1-UNIMOD:4,5-UNIMOD:267,18-UNIMOD:267	ms_run[1]:scan=9061	58.772171666666665	3	2095.0643	2095.0630	K	E	41	59
PSM	HYRGPAGDATVASEK	907	sp|Q15758|AAAT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1467	11.380721666666666	3	1557.755556	1557.753569	K	E	523	538
PSM	VNNNRGNSLTLIDLPGHESLR	908	sp|Q9Y5M8|SRPRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=7392	47.872146666666666	2	2319.208569	2318.209105	R	L	105	126
PSM	TLNNQFASFIDKVR	909	sp|Q8N1N4|K2C78_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=8565	55.559331666666665	2	1652.890673	1651.868205	R	F	117	131
PSM	LHVGNISPTCTNQELR	910	sp|Q9BQ04|RBM4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	10-UNIMOD:4	ms_run[1]:scan=4443	29.479726666666668	2	1837.9412	1837.9102	K	A	80	96
PSM	CGPLIDLCRGPHVR	911	sp|P26639|SYTC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:385,1-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=7901	51.14053666666666	2	1631.8052	1631.8019	R	H	254	268
PSM	NVHMNDNVLHSAFEVGAR	912	sp|Q13630|FCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	18-UNIMOD:267	ms_run[1]:scan=7023	45.53370666666667	3	2019.967978	2018.962011	K	K	90	108
PSM	LHVGNISPTCTNKELR	913	sp|Q9BWF3|RBM4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	10-UNIMOD:4	ms_run[1]:scan=4443	29.479726666666668	2	1837.941050	1837.946866	K	A	80	96
PSM	SDIATNGESPTECKSHELK	914	sp|Q8WTR7|ZN473_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	13-UNIMOD:4,14-UNIMOD:188	ms_run[1]:scan=4428	29.38150333333333	2	2108.017249	2107.978742	R	R	135	154
PSM	MREIVHIQAGQCGNQIGAK	915	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	1-UNIMOD:35,12-UNIMOD:4	ms_run[1]:scan=3924	26.283988333333337	3	2125.050494	2125.052077	-	F	1	20
PSM	MREIVHIQAGQCGNQIGAK	916	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	1-UNIMOD:35,2-UNIMOD:267,12-UNIMOD:4,19-UNIMOD:188	ms_run[1]:scan=3931	26.329541666666668	3	2141.077796	2141.080475	-	F	1	20
PSM	AFAETHIKGFTLNDAANSR	917	sp|P42704|LPPRC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6468	42.044	3	2062.0232	2062.0232	K	L	1091	1110
PSM	AHGPGLEGGLVGKPAEFTIDTK	918	sp|O75369-7|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7119	46.131	3	2193.143	2193.1430	K	G	876	898
PSM	AIHNKVNIVPVIAK	919	sp|Q15019|SEPT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4939	32.515	2	1514.9297	1514.9297	K	A	170	184
PSM	ALVHERDEAAYGELR	920	sp|Q9UL46|PSME2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	6-UNIMOD:267,15-UNIMOD:267	ms_run[2]:scan=4012	26.832	3	1747.8756	1747.8756	R	A	189	204
PSM	AQQGIVFLDEVDKIGSVPGIHQLR	921	sp|O76031|CLPX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=11113	72.644	3	2618.418	2618.4180	K	D	350	374
PSM	ASPAPGSGHPEGPGAHLDMNSLDR	922	sp|O94826|TOM70_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	24-UNIMOD:267	ms_run[2]:scan=5222	34.26	3	2379.0901	2379.0901	R	A	90	114
PSM	CPGESSHICDFIRK	923	sp|P50897-2|PPT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=4949	32.577	2	1704.7712	1704.7712	R	T	49	63
PSM	DGQVHLFEHILNGYCK	924	sp|Q15061|WDR43_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	15-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=8912	57.812	3	1934.9404	1934.9404	R	K	293	309
PSM	DKLESEMEDAYHEHQANLLR	925	sp|P23246-2|SFPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7654	49.576	3	2427.1125	2427.1125	K	Q	517	537
PSM	EIQEKLDAFIEALHQEK	926	sp|O60313-13|OPA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	5-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=10632	69.295	3	2052.093	2052.0930	R	-	908	925
PSM	EVIELPVKHPELFEALGIAQPK	927	sp|P62195-2|PRS8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10854	70.829	3	2456.3679	2456.3679	K	G	155	177
PSM	FGPDTQHLVLNENCASVHNLR	928	sp|Q9BQ52-2|RNZ2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	14-UNIMOD:4	ms_run[2]:scan=6618	42.996	4	2420.1655	2420.1655	R	S	267	288
PSM	FIPHENGVHTIDVK	929	sp|O75369-7|FLNB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	14-UNIMOD:188	ms_run[2]:scan=4498	29.829	2	1610.8512	1610.8512	R	F	2167	2181
PSM	FNDEHIPESPYLVPVIAPSDDARR	930	sp|O75369-7|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	23-UNIMOD:267,24-UNIMOD:267	ms_run[2]:scan=8714	56.534	3	2756.3673	2756.3673	K	L	2086	2110
PSM	FSQELLSNGELNHLPLKER	931	sp|P17480-2|UBF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7877	50.985	3	2223.1648	2223.1648	K	M	541	560
PSM	GHKEIINAIDGIGGLGIGEGAPEIVTGSR	932	sp|Q96MX6-2|WDR92_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10218	66.55	2	2829.4985	2829.4985	K	D	109	138
PSM	GKDPTEHIPEIILNNFTTR	933	sp|Q9H9Y2|RPF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9956	64.791	3	2194.1382	2194.1382	R	L	236	255
PSM	GRHETYLCYEVER	934	sp|Q9HC16|ABC3G_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:267,8-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=4559	30.212	2	1730.7949	1730.7949	R	M	214	227
PSM	HCLQTVWNKPTVK	935	sp|P07602|SAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:4	ms_run[2]:scan=4053	27.071	2	1609.8399	1609.8399	K	S	47	60
PSM	HGATHVFASK	936	sp|P28370-2|SMCA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:188	ms_run[2]:scan=982	8.5954	2	1059.5557	1059.5557	R	E	659	669
PSM	HHGQEGSILVTK	937	sp|Q9Y5P6|GMPPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:188	ms_run[2]:scan=1890	13.924	2	1310.7038	1310.7038	R	V	126	138
PSM	HIKENDYYTPTGEFR	938	sp|P46977-2|STT3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4688	30.97	3	1868.8693	1868.8693	K	V	519	534
PSM	HKSETDTSLIR	939	sp|P40227-2|TCPZ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=1828	13.546	2	1285.6626	1285.6626	K	G	153	164
PSM	HKTVALDGTLFQK	940	sp|Q14683|SMC1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=5452	35.672	2	1468.8441	1468.8441	R	S	636	649
PSM	HLDSVLSDHTR	941	sp|Q2M389|WASC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=2853	19.721	2	1278.6317	1278.6317	R	N	972	983
PSM	HNVFGLDLKDEK	942	sp|Q13206|DDX10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	9-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=6086	39.618	2	1425.7655	1425.7655	R	T	641	653
PSM	HVAEDLGKVFGER	943	sp|P40939|ECHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5882	38.337	3	1455.747	1455.7470	K	F	598	611
PSM	HVDNIMFENHTVADR	944	sp|Q8TAT6|NPL4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4968	32.691	3	1796.8264	1796.8264	R	F	222	237
PSM	HVVFTAETHNFPTGVCPFSGATTGTGGR	945	sp|O15067|PUR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	16-UNIMOD:4,28-UNIMOD:267	ms_run[2]:scan=7685	49.768	3	2914.3696	2914.3696	R	I	303	331
PSM	HVVTLLQVQDCHVLK	946	sp|P09001|RM03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:4	ms_run[2]:scan=6683	43.409	3	1787.9716	1787.9716	K	Y	117	132
PSM	IFVNDDRHVMAK	947	sp|Q12906-5|ILF3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3269	22.267	2	1443.7293	1443.7293	R	H	6	18
PSM	IHSLTHLDSVTK	948	sp|P46736-4|BRCC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3351	22.755	2	1349.7303	1349.7303	R	I	136	148
PSM	IMLLNHPDKGGSPYIAAK	949	sp|Q96DA6-2|TIM14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	9-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=5758	37.559	2	1936.0643	1936.0643	R	I	60	78
PSM	ISMPDVDLHLKGPK	950	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=7100	46.021	2	1560.8737	1560.8737	K	V	1195	1209
PSM	ISSIQSIVPALEIANAHRK	951	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8976	58.212	2	2046.1586	2046.1586	K	P	251	270
PSM	IWDTTQKEHLLK	952	sp|O75083|WDR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4727	31.212	2	1510.8144	1510.8144	R	Y	84	96
PSM	KAAEAHVDAHYYEQNEQPTGTCAACITGDNR	953	sp|P55263-4|ADK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	22-UNIMOD:4,25-UNIMOD:4	ms_run[2]:scan=4692	30.994	3	3476.511	3476.5110	R	S	84	115
PSM	KADVIPVHYYLIPPPTK	954	sp|P29144|TPP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7640	49.486	3	1950.0979	1950.0979	K	T	983	1000
PSM	KAGQVFLEELGNHK	955	sp|P09543-2|CN37_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=5888	38.373	3	1580.8713	1580.8713	R	A	184	198
PSM	KFDEVLVNHFCEEFGK	956	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:4	ms_run[2]:scan=8745	56.731	3	1996.9353	1996.9353	R	K	235	251
PSM	KGVCDQSFGIHVAELANFPK	957	sp|P43246-2|MSH2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:188,4-UNIMOD:4,20-UNIMOD:188	ms_run[2]:scan=9222	59.871	2	2228.1451	2228.1451	K	H	753	773
PSM	KHFSQAEGSQLDEVR	958	sp|Q7L5Y9-3|MAEA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=2999	20.629	3	1729.8384	1729.8384	R	Q	182	197
PSM	KIHSQEEALR	959	sp|O00764|PDXK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=1007	8.7331	2	1209.6466	1209.6466	R	V	161	171
PSM	KIHTEPQLSAALEYVR	960	sp|P47897|SYQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7180	46.506	3	1853.9999	1853.9999	K	S	80	96
PSM	KITVPGNFQGHSGAQCITCSYK	961	sp|Q08945|SSRP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	16-UNIMOD:4,19-UNIMOD:4	ms_run[2]:scan=5652	36.906	3	2452.1627	2452.1627	R	A	325	347
PSM	KLDPELHLDIK	962	sp|Q12905|ILF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6077	39.557	2	1319.7449	1319.7449	R	V	186	197
PSM	KLVAIVDPHIK	963	sp|Q14697|GANAB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=5014	32.966	2	1243.8055	1243.8055	R	V	462	473
PSM	KTNVTHEEHTAVEK	964	sp|P52757|CHIO_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=673	6.8597	2	1621.806	1621.8060	R	I	179	193
PSM	KTQHGVLSQQFVELINK	965	sp|Q12846-2|STX4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7782	50.38	2	1968.0793	1968.0793	R	C	122	139
PSM	KWDTCAPEVILHAVGGK	966	sp|O95861-3|BPNT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:188,5-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=9034	58.592	2	1892.0017	1892.0017	K	L	190	207
PSM	LDNCHSTPLHVAEYMLDAAR	967	sp|P35573-2|GDE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	4-UNIMOD:4	ms_run[2]:scan=10193	66.382	3	2312.0678	2312.0678	R	N	508	528
PSM	LHHQNQQQIQQQQQQLQR	968	sp|Q96RN5-3|MED15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=1864	13.768	3	2310.169	2310.1690	K	I	152	170
PSM	LHVGNISPTCTNKELR	969	sp|Q9BWF3-3|RBM4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:4	ms_run[2]:scan=4441	29.468	3	1837.9469	1837.9469	K	A	80	96
PSM	LIHPDEDISLEERR	970	sp|O43670-3|ZN207_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5178	33.987	2	1720.8744	1720.8744	K	A	280	294
PSM	LLFGHSTEGDILELVDGHFDTK	971	sp|Q9UHY7-2|ENOPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=11934	78.588	3	2442.2067	2442.2067	K	I	16	38
PSM	LLHDLQIGEKK	972	sp|P49756-2|RBM25_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4103	27.382	2	1292.7452	1292.7452	R	L	146	157
PSM	LLKNHDEESLECLCR	973	sp|Q04637-6|IF4G1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=4857	32.003	3	1914.8928	1914.8928	K	L	727	742
PSM	LLQHGINADDKR	974	sp|Q96P70|IPO9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=1712	12.83	2	1378.7317	1378.7317	K	L	866	878
PSM	LNGHQLENHALK	975	sp|Q9NZI8|IF2B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=2387	16.928	2	1372.7211	1372.7211	K	V	139	151
PSM	LNVHKVTVLTLQDK	976	sp|Q9UBT2-2|SAE2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5684	37.101	3	1606.9406	1606.9406	R	I	358	372
PSM	LQGQKEPGDQGPAHPPGADMSHSL	977	sp|Q9Y399|RT02_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4525	30.002	3	2453.1394	2453.1394	R	-	273	297
PSM	LQGQKEPGDQGPAHPPGADMSHSL	978	sp|Q9Y399|RT02_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	5-UNIMOD:188	ms_run[2]:scan=4544	30.118	3	2459.1595	2459.1595	R	-	273	297
PSM	LVGGTTPGKGGQTHLGLPVFNTVK	979	sp|P53597|SUCA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7428	48.112	3	2377.3118	2377.3118	K	E	82	106
PSM	MIASDSHRPEVK	980	sp|Q9NYF8-2|BCLF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:35	ms_run[2]:scan=989	8.6363	2	1384.6769	1384.6769	K	L	535	547
PSM	NCIVLIDSTPYRQWYESHYALPLGR	981	sp|P62241|RS8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:4	ms_run[2]:scan=10978	71.701	3	3050.5073	3050.5073	K	K	99	124
PSM	NILDFPQHVSPSKDIR	982	sp|P52888|THOP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6879	44.643	2	1864.9795	1864.9795	R	T	80	96
PSM	NLFAEIIEEHLANR	983	sp|Q9NWY4|HPF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	14-UNIMOD:267	ms_run[2]:scan=11710	76.975	2	1677.8714	1677.8714	R	S	323	337
PSM	NRNEQESAVHPR	984	sp|Q9UJU6-5|DBNL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:267,12-UNIMOD:267	ms_run[2]:scan=672	6.854	2	1455.7082	1455.7082	R	E	144	156
PSM	NSQWVPTLPNSSHHLDAVPCSTTINR	985	sp|Q12824-2|SNF5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	20-UNIMOD:4,26-UNIMOD:267	ms_run[2]:scan=7452	48.27	2	2940.4176	2940.4176	R	N	119	145
PSM	NTKEPPLSLTIHLTSPVVR	986	sp|Q12906-5|ILF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8291	53.722	3	2101.1895	2101.1895	K	E	159	178
PSM	QLFHPEQLITGKEDAANNYAR	987	sp|P68363-2|TBA1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7154	46.345	2	2414.1979	2414.1979	R	G	85	106
PSM	RGAPAAATAPAPTAHK	988	sp|Q92522|H1X_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=959	8.4647	2	1486.8005	1486.8005	R	A	128	144
PSM	RLAQDGAHVVVSSR	989	sp|Q9BTZ2-3|DHRS4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:267,14-UNIMOD:267	ms_run[2]:scan=2243	16.067	2	1513.8228	1513.8228	R	K	51	65
PSM	RPEDYEAVFVGNIDDHFR	990	sp|Q68CQ4|DIEXF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9849	64.051	3	2178.013	2178.0130	K	I	409	427
PSM	RSELEEQQMHLNVGLR	991	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=6117	39.82	3	1957.9907	1957.9907	K	K	3191	3207
PSM	SEHSHSTTLPR	992	sp|P16144-4|ITB4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:267	ms_run[2]:scan=906	8.1672	2	1260.6086	1260.6086	R	D	1428	1439
PSM	SHLLNCCPHDVLSGTR	993	sp|Q9Y383-3|LC7L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	6-UNIMOD:4,7-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=4831	31.851	3	1874.8755	1874.8755	K	M	35	51
PSM	SHQGLDRQELSFAAR	994	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	7-UNIMOD:267,15-UNIMOD:267	ms_run[2]:scan=4809	31.713	2	1733.8712	1733.8712	K	S	2407	2422
PSM	SNKLAVIASHIQESR	995	sp|Q13889-2|TF2H3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5605	36.617	3	1651.9006	1651.9006	R	F	13	28
PSM	TCEEHQLCVVAVLPHILDTGAAGR	996	sp|Q15084-3|PDIA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=10489	68.338	3	2645.3054	2645.3054	R	N	287	311
PSM	TCVHTFFDHQDQVWGVK	997	sp|Q9GZS3|WDR61_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=7675	49.705	3	2108.9834	2108.9834	R	Y	265	282
PSM	TFKTVFAEHISDECK	998	sp|P39023|RL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	3-UNIMOD:188,14-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=5804	37.851	3	1822.8962	1822.8962	R	R	101	116
PSM	TGVHHYSGNNIELGTACGK	999	sp|P62888|RL30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	17-UNIMOD:4,19-UNIMOD:188	ms_run[2]:scan=3231	22.047	3	2019.9528	2019.9528	K	Y	69	88
PSM	THINIVVIGHVDSGK	1000	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	15-UNIMOD:188	ms_run[2]:scan=5892	38.396	3	1593.8934	1593.8934	K	S	6	21
PSM	THINIVVIGHVDSGK	1001	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	15-UNIMOD:188	ms_run[2]:scan=7527	48.757	2	1593.8934	1593.8934	K	S	6	21
PSM	THINIVVIGHVDSGK	1002	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7293	47.228	3	1587.8733	1587.8733	K	S	6	21
PSM	THQKFVIATSTK	1003	sp|Q02878|RL6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=2415	17.093	2	1359.751	1359.7510	R	I	189	201
PSM	TPFLLSGTSYKDLMPHDLAR	1004	sp|P55084-2|ECHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10266	66.869	3	2261.1514	2261.1514	R	A	40	60
PSM	TPHYGSQTPLHDGSR	1005	sp|O00267-2|SPT5H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	15-UNIMOD:267	ms_run[2]:scan=2043	14.84	2	1661.7786	1661.7786	R	T	795	810
PSM	VDINAPDVDVHGPDWHLK	1006	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7585	49.135	2	2025.9908	2025.9908	K	M	3584	3602
PSM	VNNNRGNSLTLIDLPGHESLR	1007	sp|Q9Y5M8|SRPRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7381	47.801	3	2318.2091	2318.2091	R	L	105	126
PSM	VTAIHIDPATHR	1008	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:267	ms_run[2]:scan=3194	21.825	2	1339.7236	1339.7236	R	Q	1052	1064
PSM	VVEVLAGHGHLYSR	1009	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4676	30.906	3	1535.8209	1535.8209	K	I	1242	1256
PSM	VWIKPGAEQSFLYGNHVLK	1010	sp|Q9Y221|NIP7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	4-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=8197	53.12	3	2197.2087	2197.2087	K	S	97	116
PSM	YCCEHLLDHITNNQDFKGSAGAPSVENVK	1011	sp|P35813-2|PPM1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:4,3-UNIMOD:4	ms_run[2]:scan=7038	45.631	4	3302.5085	3302.5085	K	N	70	99
PSM	YHTINGHNAEVR	1012	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:267	ms_run[2]:scan=1328	10.545	2	1419.6883	1419.6883	K	K	162	174
PSM	YLSHSEFKDLILPTIQK	1013	sp|Q92616|GCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	8-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=8697	56.427	3	2043.1443	2043.1443	R	S	252	269
PSM	VILHLKEDQTEYLEER	1014	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=6498	42.233376666666665	3	2015.040738	2014.037121	K	R	160	176
PSM	HQAFEAELHANADR	1015	sp|Q13813|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	14-UNIMOD:267	ms_run[1]:scan=3538	23.920316666666665	2	1617.752598	1617.752336	K	I	1592	1606
PSM	MREIVHIQAGQCGNQIGAK	1016	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:1,2-UNIMOD:267,12-UNIMOD:4,19-UNIMOD:188	ms_run[1]:scan=4150	27.671663333333335	3	2168.087983	2167.096125	-	F	1	20
PSM	THINIVVIGHVDSGK	1017	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	15-UNIMOD:188	ms_run[1]:scan=6403	41.64454166666667	3	1594.896382	1593.893419	K	S	6	21
PSM	SHLLDCCPHDILAGTR	1018	sp|Q9NQ29|LUC7L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	6-UNIMOD:4,7-UNIMOD:4,16-UNIMOD:267	ms_run[1]:scan=6191	40.28651	3	1874.883407	1873.880256	K	M	38	54
PSM	QVASHVGLHSASIPGILALDLCPSDTNK	1019	sp|Q9UMS4|PRP19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:28,22-UNIMOD:4	ms_run[1]:scan=11233	73.460215	3	2882.4508	2882.4591	R	I	209	237
PSM	YHTINGHNAEVR	1020	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	12-UNIMOD:267	ms_run[1]:scan=1888	13.914136666666668	2	1420.669451	1419.688279	K	K	174	186
PSM	FQGIKHECQANGPEDLNR	1021	sp|P60981|DEST_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	8-UNIMOD:4	ms_run[1]:scan=3705	24.949831666666668	3	2112.964337	2111.980686	K	A	128	146
PSM	HFILDECDKMLEQLDMR	1022	sp|Q13838|DX39B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	7-UNIMOD:4,9-UNIMOD:188,17-UNIMOD:267	ms_run[1]:scan=10146	66.07152333333333	2	2209.036717	2208.034829	K	R	192	209
PSM	FETEKNNGAGYFLEHLAFK	1023	sp|P31930|QCR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=10569	68.87532833333333	3	2215.057246	2214.074569	R	G	81	100
PSM	HIHITQATETTTTR	1024	sp|Q14677|EPN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=2041	14.829816666666666	3	1608.824422	1608.821983	K	H	261	275
PSM	HIHITQATETTTTR	1025	sp|Q14677|EPN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	14-UNIMOD:267	ms_run[1]:scan=2032	14.776753333333332	3	1618.832668	1618.830252	K	H	261	275
PSM	TFHFNTVEEVHSR	1026	sp|P30740|ILEU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0		ms_run[1]:scan=4973	32.723565	2	1603.8052	1601.7582	K	F	57	70
PSM	QLPDKWQHDLFDSGFGGGAGVETGGK	1027	sp|Q86V81|THOC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:28,5-UNIMOD:188,26-UNIMOD:188	ms_run[1]:scan=10596	69.05785833333334	2	2697.2757	2697.2857	K	L	82	108
PSM	AADHLKPFLDDSTLR	1028	sp|O43395|PRPF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=6420	41.751125	3	1698.879305	1697.873684	K	F	47	62
PSM	YGYTHLSAGELLRDER	1029	sp|P30085|KCY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	13-UNIMOD:267,16-UNIMOD:267	ms_run[1]:scan=6591	42.83790166666667	3	1898.941506	1898.938963	K	K	27	43
PSM	TLNNQFASFIDKVR	1030	sp|Q8N1N4|K2C78_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=8304	53.804143333333336	2	1652.890339	1651.868205	R	F	117	131
PSM	LHVGNISPTCTNQELR	1031	sp|Q9BQ04|RBM4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	10-UNIMOD:4	ms_run[1]:scan=4441	29.46762	3	1837.9412	1837.9102	K	A	80	96
PSM	MKHYEVEILDAK	1032	sp|Q9NZ01|TECR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:35,2-UNIMOD:188,12-UNIMOD:188	ms_run[1]:scan=4841	31.908198333333335	3	1503.784359	1502.784174	-	T	1	13
PSM	PAFQLLVSLQEPEAQGR	1033	sp|Q8IZJ3|CPMD8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=8999	58.363675	2	1882.004708	1881.994862	K	P	1504	1521
PSM	EEKEQHGLQLQSEINQLHSK	1034	sp|Q15075|EEA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=5609	36.64423333333333	3	2374.185833	2374.187701	R	L	403	423
PSM	ALTHIDHSLSR	1035	sp|P56192|SYMC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=2612	18.282	2	1248.6575	1248.6575	R	Q	120	131
PSM	ALVHERDEAAYGELR	1036	sp|Q9UL46|PSME2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4013	26.837	3	1727.8591	1727.8591	R	A	189	204
PSM	AQIHQFREDSLDSVLFLK	1037	sp|Q13620-3|CUL4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	7-UNIMOD:267,18-UNIMOD:188	ms_run[2]:scan=9619	62.527	3	2161.1503	2157.1621	K	K	74	92
PSM	ASITPGTILIILTGR	1038	sp|Q02878|RL6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	15-UNIMOD:267	ms_run[2]:scan=13177	91.537	2	1534.9322	1534.9322	R	H	142	157
PSM	AWGPGLHGGIVGR	1039	sp|O75369-7|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5884	38.346	2	1275.6836	1275.6836	R	S	385	398
PSM	CHLLVEHETQK	1040	sp|O94804|STK10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:4,11-UNIMOD:188	ms_run[2]:scan=1873	13.823	2	1398.7021	1398.7021	K	L	888	899
PSM	DHPHTAAYLQELGR	1041	sp|Q6GMV3|PTRD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	14-UNIMOD:267	ms_run[2]:scan=5251	34.435	3	1616.7935	1616.7935	R	M	64	78
PSM	DLQSSDRLSNHISSLFR	1042	sp|P11413|G6PD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	7-UNIMOD:267,17-UNIMOD:267	ms_run[2]:scan=8149	52.804	2	1994.0084	1994.0084	R	E	176	193
PSM	EHQHEEIQNVR	1043	sp|Q6DD88|ATLA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:267	ms_run[2]:scan=1121	9.3875	2	1427.6781	1427.6781	K	N	240	251
PSM	ELEDFKLQHGSILGFPK	1044	sp|P00367-2|DHE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	6-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=9104	59.088	2	1969.0712	1969.0712	K	A	180	197
PSM	ERELQHAALGGTATR	1045	sp|O14828-2|SCAM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=2238	16.039	2	1608.8332	1608.8332	R	Q	91	106
PSM	EVIELPVKHPELFEALGIAQPK	1046	sp|P62195-2|PRS8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	8-UNIMOD:188,22-UNIMOD:188	ms_run[2]:scan=10852	70.812	3	2468.4082	2468.4082	K	G	155	177
PSM	EVIELPVKHPELFEALGIAQPK	1047	sp|P62195-2|PRS8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10861	70.876	2	2456.3679	2456.3679	K	G	155	177
PSM	FGEYHKDDPSSFR	1048	sp|Q15436-2|SC23A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=3663	24.694	2	1583.7005	1583.7005	K	F	355	368
PSM	FHDPDSAVVAQHLTNTVFVDR	1049	sp|Q05519-2|SRS11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8208	53.195	3	2367.1608	2367.1608	K	A	83	104
PSM	FQAKLEHEYIQNFK	1050	sp|Q15691|MARE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	4-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=5908	38.497	3	1805.9503	1805.9503	K	I	63	77
PSM	FQAKLEHEYIQNFK	1051	sp|Q15691|MARE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5927	38.615	3	1793.9101	1793.9101	K	I	63	77
PSM	GAKEEHGGLIR	1052	sp|P26368-2|U2AF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=1184	9.7422	2	1165.6204	1165.6204	R	S	68	79
PSM	GDAVRDVDIIDHHDNTYTVK	1053	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5411	35.43	3	2282.0927	2282.0927	K	Y	917	937
PSM	GFGFVYFQNHDAADKAAVVK	1054	sp|Q13151|ROA0_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	15-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=7829	50.681	3	2195.1202	2195.1202	R	F	140	160
PSM	GGGGPGGGGPGGGSAGGPSQPPGGGGPGIRK	1055	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=2634	18.421	3	2397.1534	2397.1534	R	D	41	72
PSM	GILTLKYPIEHGIITNWDDMEK	1056	sp|P63267|ACTH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	20-UNIMOD:35	ms_run[2]:scan=9768	63.497	2	2601.3149	2601.3149	R	I	64	86
PSM	GIVKDIIHDPGR	1057	sp|P62917|RL8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4665	30.842	2	1318.7357	1318.7357	K	G	43	55
PSM	GKHCILDVSGNAIK	1058	sp|Q15700-5|DLG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	4-UNIMOD:4	ms_run[2]:scan=4700	31.046	2	1510.7926	1510.7926	R	R	233	247
PSM	GPDAASKLPLVTPHTQCR	1059	sp|P62191|PRS4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	17-UNIMOD:4	ms_run[2]:scan=4858	32.009	3	1946.9996	1946.9996	K	L	42	60
PSM	HFVLDECDKMLEQLDMR	1060	sp|O00148-3|DX39A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	7-UNIMOD:4	ms_run[2]:scan=9581	62.274	3	2177.9908	2177.9908	K	R	191	208
PSM	HGATHVFASK	1061	sp|P28370-2|SMCA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=983	8.6007	2	1053.5356	1053.5356	R	E	659	669
PSM	HGLLVPNNTTDQELQHIR	1062	sp|P56537|IF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	18-UNIMOD:267	ms_run[2]:scan=6151	40.033	4	2094.0846	2094.0846	R	N	68	86
PSM	HHGQEGSILVTK	1063	sp|Q9Y5P6|GMPPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=1892	13.935	2	1304.6837	1304.6837	R	V	126	138
PSM	HKELAPYDENWFYTR	1064	sp|P39019|RS19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7540	48.842	3	1967.9166	1967.9166	K	A	42	57
PSM	HLCICSVDPPGCTDIDDALHCR	1065	sp|Q9Y2L1-2|RRP44_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	3-UNIMOD:4,5-UNIMOD:4,12-UNIMOD:4,21-UNIMOD:4,22-UNIMOD:267	ms_run[2]:scan=7731	50.057	2	2620.1166	2620.1166	R	E	442	464
PSM	HLEINPDHPIVETLR	1066	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	15-UNIMOD:267	ms_run[2]:scan=6505	42.281	3	1791.9507	1791.9507	K	Q	625	640
PSM	HNIICLQNDHK	1067	sp|O00233-2|PSMD9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	5-UNIMOD:4,11-UNIMOD:188	ms_run[2]:scan=2859	19.76	2	1396.6977	1396.6977	R	A	77	88
PSM	HNIICLQNDHK	1068	sp|O00233-2|PSMD9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	5-UNIMOD:4	ms_run[2]:scan=2876	19.863	2	1390.6776	1390.6776	R	A	77	88
PSM	HNIQFSSFDIFSDEEVRQGLK	1069	sp|O76003|GLRX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	17-UNIMOD:267,21-UNIMOD:188	ms_run[2]:scan=10267	66.874	3	2511.2365	2507.2484	K	A	172	193
PSM	HNVFGLDLKDEK	1070	sp|Q13206|DDX10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6080	39.574	2	1413.7252	1413.7252	R	T	641	653
PSM	HQALQAEIAGHEPR	1071	sp|Q13813-2|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	14-UNIMOD:267	ms_run[2]:scan=3670	24.736	2	1565.7938	1565.7938	K	I	826	840
PSM	HQQELLEHQR	1072	sp|P56524-2|HDAC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=1301	10.397	2	1316.6585	1316.6585	K	K	6	16
PSM	HSPSIHQSVVAVSR	1073	sp|P35573-2|GDE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	14-UNIMOD:267	ms_run[2]:scan=2809	19.461	2	1512.8036	1512.8036	R	T	718	732
PSM	HTLDGAACLLNSNKYFPSR	1074	sp|Q9Y3A3-2|PHOCN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	8-UNIMOD:4	ms_run[2]:scan=7741	50.118	3	2163.0531	2163.0531	R	V	95	114
PSM	HTLEQHNWNIEAAVQDR	1075	sp|Q96CS3|FAF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6279	40.848	3	2059.9824	2059.9824	R	L	34	51
PSM	HTNYTMEHIR	1076	sp|P12814-2|ACTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:267	ms_run[2]:scan=2266	16.204	2	1310.6065	1310.6065	K	V	705	715
PSM	HVFCYDCAILHEK	1077	sp|Q75N03-2|HAKAI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	4-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=5910	38.508	3	1690.7596	1690.7596	K	K	126	139
PSM	HVVTLLQVQDCHVLK	1078	sp|P09001|RM03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=6674	43.352	2	1793.9918	1793.9918	K	Y	117	132
PSM	HWILPQDYDHAQAEAR	1079	sp|Q15293-2|RCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5942	38.711	3	1948.918	1948.9180	R	H	220	236
PSM	IAHLAGVKDQLTK	1080	sp|P12270|TPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	8-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=3829	25.721	2	1404.8492	1404.8492	K	E	1564	1577
PSM	IGEEQSAEDAEDGPPELLFIHGGHTAK	1081	sp|Q16576|RBBP7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	27-UNIMOD:188	ms_run[2]:scan=8026	51.95	2	2852.356	2852.3560	K	I	349	376
PSM	IGHKVESESYR	1082	sp|Q9UHY7-2|ENOPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=1025	8.8395	2	1303.6521	1303.6521	K	K	38	49
PSM	IISKIENHEGVR	1083	sp|P14618-3|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:267	ms_run[2]:scan=2129	15.364	2	1403.776	1403.7760	K	R	252	264
PSM	ILFLDPSGKVHPEIINENGNPSYK	1084	sp|O95881|TXD12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8711	56.516	3	2680.3861	2680.3861	R	Y	115	139
PSM	KDVLTAHPAAPGPVSR	1085	sp|O94901-2|SUN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:188,16-UNIMOD:267	ms_run[2]:scan=3272	22.282	2	1630.9126	1626.9244	R	V	195	211
PSM	KHEALMSDLSAYGSSIQALR	1086	sp|Q13813-2|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:188,20-UNIMOD:267	ms_run[2]:scan=9053	58.721	2	2192.123	2188.1349	K	E	931	951
PSM	KHPDASVNFSEFSK	1087	sp|P09429|HMGB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5133	33.703	2	1591.7631	1591.7631	K	K	30	44
PSM	KLFIGGLSFETTDESLR	1088	sp|P09651-3|ROA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9930	64.611	2	1911.9942	1911.9942	R	S	15	32
PSM	KLVAIVDPHIK	1089	sp|Q14697|GANAB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5012	32.956	3	1231.7652	1231.7652	R	V	462	473
PSM	KPAAGLSAAPVPTAPAAGAPLMDFGNDFVPPAPR	1090	sp|Q9NQC3-2|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11049	72.201	2	3270.686	3270.6860	R	G	58	92
PSM	KWENPGLGAESHTDSLR	1091	sp|Q9UHB6|LIMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4791	31.601	2	1895.9126	1895.9126	K	N	75	92
PSM	LDPHNHVLYSNR	1092	sp|P31948-3|STIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:267	ms_run[2]:scan=2688	18.752	2	1473.7352	1473.7352	K	S	33	45
PSM	LENGELEHIRPK	1093	sp|Q15102|PA1B3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=3560	24.052	2	1433.7627	1433.7627	R	I	84	96
PSM	LGVTANDVKNVIIWGNHSSTQYPDVNHAK	1094	sp|P40925-2|MDHC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	9-UNIMOD:188,29-UNIMOD:188	ms_run[2]:scan=8662	56.197	4	3188.6406	3188.6406	K	V	82	111
PSM	LHLSGIDANPNALFPPVEFPAPR	1095	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11337	74.215	3	2471.2961	2471.2961	R	G	803	826
PSM	LLEAQIATGGVIDPVHSHR	1096	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	19-UNIMOD:267	ms_run[2]:scan=6847	44.447	3	2022.0886	2022.0886	R	V	2773	2792
PSM	LLHLLLDDMPVKPYSDGEGGIEDENR	1097	sp|Q92621|NU205_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10149	66.094	4	2924.4226	2924.4226	R	S	1139	1165
PSM	LLHVAVSDVNDDVRR	1098	sp|Q99460-2|PSMD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	14-UNIMOD:267,15-UNIMOD:267	ms_run[2]:scan=5195	34.096	3	1726.9229	1726.9229	R	A	602	617
PSM	LLLETHLPSKK	1099	sp|O00567|NOP56_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4687	30.965	2	1277.7707	1277.7707	R	K	78	89
PSM	LLPEKHEIENLR	1100	sp|Q27J81-2|INF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4330	28.788	2	1489.8253	1489.8253	K	A	678	690
PSM	LNDGHFMPVLGFGTYAPPEVPR	1101	sp|P42330|AK1C3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10991	71.791	3	2413.1889	2413.1889	K	S	10	32
PSM	LNGHQLENHALK	1102	sp|Q9NZI8|IF2B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:188	ms_run[2]:scan=2386	16.922	2	1378.7413	1378.7413	K	V	139	151
PSM	LNSHMNALHLGSQANR	1103	sp|P11413|G6PD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	16-UNIMOD:267	ms_run[2]:scan=4163	27.751	3	1771.8776	1771.8776	R	L	121	137
PSM	LPEYTLSQEGGPAHKR	1104	sp|O75569-3|PRKRA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=3990	26.695	3	1781.906	1781.9060	R	E	117	133
PSM	LRGIEQAVQSHAVAEEEAR	1105	sp|Q16891-3|MIC60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5232	34.319	3	2092.0661	2092.0661	R	K	514	533
PSM	MGYAEEAPYDAIHVGAAAPVVPQALIDQLKPGGR	1106	sp|P22061|PIMT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:35	ms_run[2]:scan=11103	72.578	3	3519.782	3519.7820	R	L	145	179
PSM	MIKNEVDMQVLHLLGPK	1107	sp|P47897|SYQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	3-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=9604	62.426	3	1976.099	1976.0990	K	L	164	181
PSM	MIKNEVDMQVLHLLGPK	1108	sp|P47897|SYQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9606	62.438	3	1964.0587	1964.0587	K	L	164	181
PSM	NAYKTPLLDDPVFIHPSSVLFK	1109	sp|Q8IY37|DHX37_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	4-UNIMOD:188,22-UNIMOD:188	ms_run[2]:scan=11117	72.668	3	2512.3769	2512.3769	R	E	953	975
PSM	NGQTREHALLAYTLGVK	1110	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6875	44.62	3	1870.0061	1870.0061	K	Q	130	147
PSM	QLLHNFPPDQLTSSGAPFWSGPK	1111	sp|P22314-2|UBA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10100	65.743	3	2523.2547	2523.2547	R	R	684	707
PSM	QLYVLGHEAMKR	1112	sp|P22314-2|UBA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4672	30.88	2	1443.7657	1443.7657	R	L	18	30
PSM	QQSHFAMMHGGTGFAGIDSSSPEVK	1113	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6732	43.724	3	2605.169	2605.1690	R	G	244	269
PSM	RAEDGSVIDYELIDQDAR	1114	sp|P07355-2|ANXA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:267,18-UNIMOD:267	ms_run[2]:scan=7660	49.609	2	2083.9925	2083.9925	R	D	197	215
PSM	RGDLPFVVPR	1115	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6742	43.788	2	1154.656	1154.6560	R	R	1923	1933
PSM	RGEQADHFTQTPLDPGSQVLVR	1116	sp|Q9BTE6|AASD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6657	43.241	2	2450.2302	2450.2302	R	V	75	97
PSM	RNTIQFTHTQIEAIR	1117	sp|O60306|AQR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5641	36.838	2	1826.9751	1826.9751	K	A	797	812
PSM	RSELEEQQMHLNVGLR	1118	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6116	39.814	3	1937.9741	1937.9741	K	K	3191	3207
PSM	SCLLHQFTEKK	1119	sp|P61106|RAB14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:4	ms_run[2]:scan=4222	28.114	2	1389.7075	1389.7075	K	F	25	36
PSM	SCLLHQFTEKK	1120	sp|P61106|RAB14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:4,10-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=4229	28.16	2	1401.7477	1401.7477	K	F	25	36
PSM	SGNALFHASTLHR	1121	sp|Q14152-2|EIF3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:267	ms_run[2]:scan=4024	26.9	2	1419.7247	1419.7247	K	L	252	265
PSM	SHIFFWTWSGNSLTR	1122	sp|Q9HC35-2|EMAL4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	15-UNIMOD:267	ms_run[2]:scan=11243	73.539	3	1847.8983	1847.8983	K	K	373	388
PSM	SLSNVIAHEISHSWTGNLVTNK	1123	sp|P09960-3|LKHA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	22-UNIMOD:188	ms_run[2]:scan=10206	66.472	3	2412.2493	2412.2493	K	T	265	287
PSM	SLTELFVKENHELR	1124	sp|Q96Q11-2|TRNT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7226	46.793	2	1713.905	1713.9050	K	I	47	61
PSM	SWHDIDKDNAK	1125	sp|Q15436-2|SC23A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	7-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=2086	15.1	2	1339.6559	1339.6559	R	Y	110	121
PSM	TAWLDGKHVVFGK	1126	sp|P23284|PPIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	7-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=6429	41.805	2	1468.8229	1468.8229	K	V	159	172
PSM	THINIVVIGHVDSGK	1127	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	15-UNIMOD:188	ms_run[2]:scan=6579	42.763	3	1593.8934	1593.8934	K	S	6	21
PSM	THINIVVIGHVDSGK	1128	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	15-UNIMOD:188	ms_run[2]:scan=6744	43.799	3	1593.8934	1593.8934	K	S	6	21
PSM	THINIVVIGHVDSGK	1129	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	15-UNIMOD:188	ms_run[2]:scan=6053	39.406	3	1593.8934	1593.8934	K	S	6	21
PSM	TLLKNDHIQVGR	1130	sp|Q8IXB1-2|DJC10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=3809	25.598	2	1392.7837	1392.7837	K	F	343	355
PSM	TVSTLHHVLQR	1131	sp|O00764|PDXK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=2772	19.243	2	1289.7204	1289.7204	K	T	259	270
PSM	VFLENVIRDAVTYTEHAK	1132	sp|P62805|H4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=12119	80.004	3	2104.0953	2104.0953	K	R	61	79
PSM	VHVGDEDFVHLR	1133	sp|P04080|CYTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:267	ms_run[2]:scan=5762	37.587	3	1431.7134	1431.7134	K	V	57	69
PSM	VIHDNFGIVEGLMTTVHAITATQK	1134	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:35	ms_run[2]:scan=11643	76.468	3	2610.3476	2610.3476	K	T	121	145
PSM	VLRHEEFEEGCK	1135	sp|Q9HC38-3|GLOD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:4	ms_run[2]:scan=2037	14.804	3	1531.7089	1531.7089	K	A	31	43
PSM	VLVPEHEKDVLEWIACVR	1136	sp|P48147|PPCE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	16-UNIMOD:4	ms_run[2]:scan=11003	71.876	3	2191.146	2191.1460	K	S	328	346
PSM	VQLTTCIHHIIK	1137	sp|O95373|IPO7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	6-UNIMOD:4	ms_run[2]:scan=5638	36.821	2	1461.8126	1461.8126	R	H	108	120
PSM	VSLRAPQEFMTSHSEAGSR	1138	sp|Q9BRR6-4|ADPGK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5795	37.795	3	2089.0011	2089.0011	R	I	150	169
PSM	YGYTHLSAGELLRDER	1139	sp|P30085|KCY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6606	42.93	2	1878.9224	1878.9224	K	K	27	43
PSM	YHTINGHNCEVK	1140	sp|P51991-2|ROA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	9-UNIMOD:4,12-UNIMOD:188	ms_run[2]:scan=1161	9.6133	2	1476.6875	1476.6875	K	K	166	178
PSM	KLTATPTPLGGMTGFHMQTEDR	1141	sp|O75533|SF3B1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=7409	47.982425	2	2389.161181	2388.156601	R	T	430	452
PSM	THINIVVIGHVDSGK	1142	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=6633	43.09274166666667	2	1587.873551	1587.873290	K	S	6	21
PSM	THINIVVIGHVDSGK	1143	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	15-UNIMOD:188	ms_run[1]:scan=6238	40.586055	3	1595.894366	1593.893419	K	S	6	21
PSM	HGLLVPNNTTDQELQHIR	1144	sp|P56537|IF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	18-UNIMOD:267	ms_run[1]:scan=6944	45.04951666666667	2	2095.070647	2094.084569	R	N	68	86
PSM	SGKHIGVCISVANNR	1145	sp|O60506|HNRPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:188,8-UNIMOD:4,15-UNIMOD:267	ms_run[1]:scan=3708	24.967933333333335	2	1626.879818	1626.859506	R	L	230	245
PSM	GILTLKYPIEHGIITNWDDMEK	1146	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=10509	68.47023666666666	3	2585.327480	2585.319961	R	I	65	87
PSM	IGHKVESESYR	1147	sp|Q9UHY7|ENOPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:188,11-UNIMOD:267	ms_run[1]:scan=1026	8.844656666666667	2	1320.681453	1319.680462	K	K	184	195
PSM	SNKIFVGGIPHNCGETELR	1148	sp|Q96EP5|DAZP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	13-UNIMOD:4	ms_run[1]:scan=5753	37.52871	3	2127.048342	2127.053122	K	E	112	131
PSM	LPEYTLSQEGGPAHKR	1149	sp|O75569|PRKRA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	15-UNIMOD:188,16-UNIMOD:267	ms_run[1]:scan=4003	26.777938333333335	3	1798.936554	1797.934445	R	E	142	158
PSM	AADHLKPFLDDSTLR	1150	sp|O43395|PRPF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=6423	41.76781666666667	2	1697.877042	1697.873684	K	F	47	62
PSM	HNESVVKEMLELAK	1151	sp|O00487|PSDE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=8595	55.747218333333336	3	1626.848963	1625.844692	K	N	240	254
PSM	LHFDNCVLKPATEGK	1152	sp|Q5T9A4|ATD3B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	6-UNIMOD:4	ms_run[1]:scan=5308	34.78655666666666	2	1728.880319	1727.866491	R	R	487	502
PSM	LIHPTENITFHAVSSVVNNSR	1153	sp|Q96FZ2|HMCES_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	21-UNIMOD:267	ms_run[1]:scan=7621	49.36242	3	2345.220138	2344.216312	K	N	240	261
PSM	LIIWDSYTTNKVHAIPLR	1154	sp|P62873|GBB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=8828	57.263144999999994	3	2140.187191	2139.184060	K	S	79	97
PSM	VVHLGDKEQSNWAK	1155	sp|Q8IZH2|XRN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=3356	22.78775333333333	2	1609.849750	1609.821255	K	E	759	773
PSM	HPEKLATVLSGACDGEVR	1156	sp|Q9NV06|DCA13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:188,13-UNIMOD:4,18-UNIMOD:267	ms_run[1]:scan=5378	35.22279	3	1954.994304	1953.991308	K	I	75	93
PSM	FQGIKHECQANGPEDLNR	1157	sp|P60981|DEST_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	8-UNIMOD:4	ms_run[1]:scan=3426	23.246716666666664	2	2111.976776	2111.980686	K	A	128	146
PSM	AEVQKLQMEAPHIIVGTPGR	1158	sp|P60842-2|IF4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	5-UNIMOD:188,20-UNIMOD:267	ms_run[2]:scan=7001	45.398	2	2189.1962	2185.2080	R	V	142	162
PSM	AGAHLQGGAKR	1159	sp|P04406-2|G3P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=548	6.1669	2	1064.5839	1064.5839	K	V	66	77
PSM	AHAAQVTCVAASPHKDSVFLSCSEDNR	1160	sp|Q9BQA1|MEP50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	8-UNIMOD:4,15-UNIMOD:188,22-UNIMOD:4,27-UNIMOD:267	ms_run[2]:scan=4779	31.527	2	2972.384	2968.3958	R	I	165	192
PSM	AHHCSACDSCILK	1161	sp|Q5W0Z9-4|ZDH20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	4-UNIMOD:4,7-UNIMOD:4,10-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=1895	13.952	3	1563.6688	1563.6688	R	M	139	152
PSM	APGPGLAQGLPQLHSLVLR	1162	sp|Q8N1G4|LRC47_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	19-UNIMOD:267	ms_run[2]:scan=9922	64.559	3	1933.1137	1933.1137	R	R	65	84
PSM	ATHGGRIDYIAGLDSR	1163	sp|P07741-2|APT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5296	34.711	2	1700.8594	1700.8594	K	G	52	68
PSM	AVAHHTDCTFIR	1164	sp|P62195-2|PRS8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	8-UNIMOD:4	ms_run[2]:scan=2350	16.702	2	1426.6776	1426.6776	R	V	194	206
PSM	CHLLVEHETQK	1165	sp|O94804|STK10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:4	ms_run[2]:scan=1874	13.828	2	1392.682	1392.6820	K	L	888	899
PSM	CVDDHMHLIPTMTK	1166	sp|Q96C01|F136A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=6194	40.304	2	1702.7936	1702.7936	K	K	114	128
PSM	DLPIHACSYCGIHDPACVVYCNTSKK	1167	sp|Q92900-2|RENT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	7-UNIMOD:4,10-UNIMOD:4,17-UNIMOD:4,21-UNIMOD:4,25-UNIMOD:188,26-UNIMOD:188	ms_run[2]:scan=6998	45.377	3	3076.4066	3076.4066	K	W	117	143
PSM	DTLYEAVREVLHGNQR	1168	sp|P62906|RL10A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	8-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=10693	69.711	3	1918.9764	1918.9764	R	K	8	24
PSM	EHTALLKIEGVYAR	1169	sp|P18077|RL35A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6168	40.14	2	1598.878	1598.8780	R	D	23	37
PSM	EIHQFNRDVEDEILWVGER	1170	sp|Q01082-3|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9836	63.963	2	2383.1557	2383.1557	K	M	1473	1492
PSM	EQHPTKIPVIIER	1171	sp|Q9GZQ8|MLP3B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=4874	32.11	3	1558.8831	1558.8831	R	Y	25	38
PSM	FGPDTQHLVLNENCASVHNLR	1172	sp|Q9BQ52-2|RNZ2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	14-UNIMOD:4,21-UNIMOD:267	ms_run[2]:scan=6593	42.849	3	2430.1738	2430.1738	R	S	267	288
PSM	FHVEEEGKGK	1173	sp|P00558-2|PGK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=1140	9.4973	2	1158.5669	1158.5669	R	D	96	106
PSM	FIVDGWHEMDAENPLHQPSPSLNK	1174	sp|Q16836|HCDH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8961	58.118	3	2760.2966	2760.2966	K	L	272	296
PSM	FLEEHPGGEEVLREQAGGDATENFEDVGHSTDAR	1175	sp|P00167-2|CYB5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6869	44.582	4	3697.6517	3697.6517	K	E	40	74
PSM	FQIPPNAELKYELHLK	1176	sp|Q02790|FKBP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8421	54.598	2	1939.0567	1939.0567	K	S	235	251
PSM	FSHEEIAMATVTALRR	1177	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7282	47.156	2	1830.9411	1830.9411	K	T	244	260
PSM	FVHSENQHLVSPEALDFLDK	1178	sp|P68400|CSK21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8963	58.134	3	2324.1437	2324.1437	R	L	284	304
PSM	GFGFVTFDDHDPVDKIVLQK	1179	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	15-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=10334	67.319	3	2288.188	2288.1880	R	Y	142	162
PSM	GISHVIVDEIHER	1180	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	13-UNIMOD:267	ms_run[2]:scan=5573	36.418	3	1512.7924	1512.7924	R	D	504	517
PSM	GISHVIVDEIHER	1181	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5576	36.434	3	1502.7841	1502.7841	R	D	504	517
PSM	GMTLVTPLQLLLFASKK	1182	sp|Q08211|DHX9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=13169	91.481	3	1859.0954	1859.0954	K	V	1058	1075
PSM	GRLYPWGVVEVENPEHNDFLK	1183	sp|Q15019|SEPT2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9769	63.503	3	2497.239	2497.2390	R	L	255	276
PSM	GVLKVFLENVIR	1184	sp|P62805|H4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11307	74.009	3	1385.8395	1385.8395	R	D	57	69
PSM	HFDETVNRYK	1185	sp|P04843|RPN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2358	16.752	3	1307.6258	1307.6258	R	Q	495	505
PSM	HHIETGGGQLPAK	1186	sp|Q92616|GCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	13-UNIMOD:188	ms_run[2]:scan=1348	10.659	2	1349.7147	1349.7147	R	L	2538	2551
PSM	HHYESLQTAK	1187	sp|O00499-9|BIN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=1022	8.8242	2	1212.5887	1212.5887	R	K	155	165
PSM	HKLDVVSCGK	1188	sp|Q14562|DHX8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	8-UNIMOD:4	ms_run[2]:scan=1367	10.774	2	1141.5914	1141.5914	R	S	1089	1099
PSM	HKLDVVSCGK	1189	sp|Q14562|DHX8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:188,8-UNIMOD:4,10-UNIMOD:188	ms_run[2]:scan=1377	10.838	2	1153.6316	1153.6316	R	S	1089	1099
PSM	HLEEIVHVEQGR	1190	sp|Q01433-3|AMPD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=3875	25.99	2	1444.7423	1444.7423	R	E	322	334
PSM	HLGYKPEEYK	1191	sp|O00159-2|MYO1C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2295	16.374	2	1262.6295	1262.6295	R	M	665	675
PSM	HLPSTEPDPHVVR	1192	sp|Q9BUJ2-4|HNRL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=3085	21.165	3	1482.7579	1482.7579	K	I	171	184
PSM	HLQTHSNTIVVSLQSK	1193	sp|Q13190-3|STX5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=4368	29.004	3	1790.9639	1790.9639	R	L	113	129
PSM	HTNYTMEHIR	1194	sp|P12814-2|ACTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2271	16.228	2	1300.5983	1300.5983	K	V	705	715
PSM	HVDNIMFENHTVADR	1195	sp|Q8TAT6|NPL4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	15-UNIMOD:267	ms_run[2]:scan=4971	32.707	3	1806.8347	1806.8347	R	F	222	237
PSM	HVEVSQAPLPPAPAYLSSPLALPSQR	1196	sp|Q9Y6K9-3|NEMO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	26-UNIMOD:267	ms_run[2]:scan=9746	63.351	3	2734.4682	2734.4682	R	R	261	287
PSM	HVFGQPVKNDQCYEDIR	1197	sp|Q9BR76|COR1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:4	ms_run[2]:scan=4655	30.786	3	2103.9796	2103.9796	R	V	14	31
PSM	HYGEHVCTAK	1198	sp|Q9BQG0|MBB1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	7-UNIMOD:4,10-UNIMOD:188	ms_run[2]:scan=760	7.3558	2	1206.5547	1206.5547	R	L	332	342
PSM	IAHLAGVKDQLTK	1199	sp|P12270|TPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=3828	25.716	2	1392.8089	1392.8089	K	E	1564	1577
PSM	IANFKIEPPGLFR	1200	sp|P11387|TOP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9219	59.854	2	1500.8453	1500.8453	R	G	350	363
PSM	ICKGDHWTTR	1201	sp|O75821|EIF3G_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:4	ms_run[2]:scan=1433	11.175	2	1272.6033	1272.6033	R	C	159	169
PSM	IKGEHPGLSIGDVAK	1202	sp|P09429|HMGB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=4352	28.919	3	1531.8761	1531.8761	K	K	113	128
PSM	IMGLDLPDGGHLTHGYMSDVK	1203	sp|P34897-3|GLYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8785	56.99	3	2255.0715	2255.0715	R	R	140	161
PSM	IPLPVSNILWEHCIR	1204	sp|Q96JG6-3|VPS50_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	13-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=10746	70.064	3	1856.0006	1856.0006	R	L	809	824
PSM	IQCVPKEPHSFQSR	1205	sp|Q9HB07|MYG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	3-UNIMOD:4	ms_run[2]:scan=3148	21.55	3	1711.8464	1711.8464	R	L	303	317
PSM	KHEALMSDLSAYGSSIQALR	1206	sp|Q13813-2|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9071	58.834	3	2176.0947	2176.0947	K	E	931	951
PSM	KHGLEVIYMIEPIDEYCVQQLK	1207	sp|P07900-2|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:188,17-UNIMOD:4,22-UNIMOD:188	ms_run[2]:scan=10791	70.36	2	2716.4007	2716.4007	R	E	635	657
PSM	KHPNEICVPMSVEFEELLK	1208	sp|Q12874|SF3A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:188,7-UNIMOD:4,19-UNIMOD:188	ms_run[2]:scan=11156	72.931	3	2310.1791	2310.1791	R	A	97	116
PSM	KLDPELHLDIK	1209	sp|Q12905|ILF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=6098	39.698	2	1331.7852	1331.7852	R	V	186	197
PSM	KLFIGGLSFETTDESLR	1210	sp|P09651-3|ROA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9903	64.427	3	1911.9942	1911.9942	R	S	15	32
PSM	KNHEEEISTLR	1211	sp|P08727|K1C19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2110	15.244	2	1354.6841	1354.6841	K	G	216	227
PSM	KPQGVDPASFHFLDTPIAK	1212	sp|Q969G9|NKD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8572	55.605	3	2067.0789	2067.0789	R	V	309	328
PSM	KQMVIDVLHPGK	1213	sp|P62847-2|RS24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=5423	35.5	3	1375.8048	1375.8048	R	A	21	33
PSM	KVDPMAIVVFHQADIGEYVR	1214	sp|Q9Y221|NIP7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10253	66.783	3	2286.1831	2286.1831	R	H	155	175
PSM	KVEAAHCAACDLFIPMQFGIIQK	1215	sp|Q9ULX6-2|AKP8L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	7-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=10838	70.705	3	2646.3121	2646.3121	K	H	417	440
PSM	KVLCLAVAVGHVK	1216	sp|P62906|RL10A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	4-UNIMOD:4	ms_run[2]:scan=5584	36.485	3	1392.8275	1392.8275	K	M	161	174
PSM	KWENPGLGAESHTDSLR	1217	sp|Q9UHB6|LIMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:188,17-UNIMOD:267	ms_run[2]:scan=4778	31.521	2	1911.941	1907.9528	K	N	75	92
PSM	LATDKNDPHLCDFIETHYLNEQVK	1218	sp|P02794|FRIH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	5-UNIMOD:188,11-UNIMOD:4,24-UNIMOD:188	ms_run[2]:scan=8339	54.03	3	2911.4213	2911.4213	K	A	121	145
PSM	LDNCHSTPLHVAEYMLDAAR	1219	sp|P35573-2|GDE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	4-UNIMOD:4,20-UNIMOD:267	ms_run[2]:scan=10212	66.509	3	2322.0761	2322.0761	R	N	508	528
PSM	LDPHNHVLYSNR	1220	sp|P31948-3|STIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2691	18.768	2	1463.727	1463.7270	K	S	33	45
PSM	LERLDHLAEK	1221	sp|P12814-2|ACTN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=3241	22.109	2	1222.667	1222.6670	R	F	389	399
PSM	LGKHDVTCTVSGGGR	1222	sp|P82933|RT09_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	3-UNIMOD:188,8-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=1656	12.498	2	1558.7857	1554.7975	R	S	323	338
PSM	LGVTANDVKNVIIWGNHSSTQYPDVNHAK	1223	sp|P40925-2|MDHC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	9-UNIMOD:188,29-UNIMOD:188	ms_run[2]:scan=8652	56.131	3	3188.6406	3188.6406	K	V	82	111
PSM	LHQLDAEKER	1224	sp|P29144|TPP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=1179	9.713	2	1237.6415	1237.6415	R	M	1060	1070
PSM	LHRTELATQEK	1225	sp|Q15149-7|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=1023	8.8289	2	1324.7099	1324.7099	K	V	2385	2396
PSM	LKGIEEEEILPGFILCDPNNLCHSGR	1226	sp|P15170|ERF3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:188,16-UNIMOD:4,22-UNIMOD:4,26-UNIMOD:267	ms_run[2]:scan=10851	70.806	3	3025.4972	3021.5091	R	T	366	392
PSM	LLEAQIATGGVIDPVHSHR	1227	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6856	44.503	3	2012.0803	2012.0803	R	V	2773	2792
PSM	LLLPGWCHLTVEDGPR	1228	sp|Q9UBB6-2|NCDN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	7-UNIMOD:4	ms_run[2]:scan=9733	63.263	2	1861.9509	1861.9509	R	E	446	462
PSM	LNVHKVTVLTLQDK	1229	sp|Q9UBT2-2|SAE2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	5-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=5676	37.055	3	1618.9809	1618.9809	R	I	358	372
PSM	LREQLQLLEEQHR	1230	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:267,13-UNIMOD:267	ms_run[2]:scan=5456	35.698	3	1710.928	1710.9280	R	A	2562	2575
PSM	LREQLQLLEEQHR	1231	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5460	35.719	3	1690.9115	1690.9115	R	A	2562	2575
PSM	LRQEIYSSHNQPSTGGR	1232	sp|Q8WVV4-1|POF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2138	15.42	2	1928.9453	1928.9453	K	T	527	544
PSM	LVNHFVEEFKR	1233	sp|P0DMV8-2|HS71A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5440	35.599	2	1416.7514	1416.7514	R	K	182	193
PSM	MGYAEEAPYDAIHVGAAAPVVPQALIDQLKPGGR	1234	sp|P22061|PIMT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:35,30-UNIMOD:188,34-UNIMOD:267	ms_run[2]:scan=11110	72.626	4	3535.8104	3531.8223	R	L	145	179
PSM	MKHYEVEILDAK	1235	sp|Q9NZ01-2|TECR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=5352	35.059	2	1486.7893	1486.7893	-	T	1	13
PSM	NLSTVMDEIHTVLKK	1236	sp|Q8IX12-2|CCAR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10641	69.354	2	1726.9288	1726.9288	R	D	1102	1117
PSM	PKHEFSVDMTCGGCAEAVSR	1237	sp|O00244|ATOX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:188,11-UNIMOD:4,14-UNIMOD:4,20-UNIMOD:267	ms_run[2]:scan=5010	32.946	3	2252.9948	2249.0066	M	V	2	22
PSM	PPSGFFLFCSEFRPK	1238	sp|O15347|HMGB3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	9-UNIMOD:4	ms_run[2]:scan=11023	72.021	2	1814.8814	1814.8814	R	I	96	111
PSM	RDPHLACVAYER	1239	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:267,7-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=3203	21.88	2	1505.7312	1505.7312	K	G	912	924
PSM	RELHGQNPVVTPCNK	1240	sp|Q16630-3|CPSF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	13-UNIMOD:4	ms_run[2]:scan=1893	13.941	3	1747.8788	1747.8788	K	Q	147	162
PSM	RFTAQGLPDLNHSQVYAVK	1241	sp|Q92900-2|RENT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6769	43.951	3	2143.1174	2143.1174	K	T	462	481
PSM	RIEPADAHVLQK	1242	sp|Q9GZZ1-2|NAA50_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2842	19.657	2	1375.7572	1375.7572	K	N	53	65
PSM	RVHVTQEDFEMAVAK	1243	sp|P62195-2|PRS8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:35	ms_run[2]:scan=4802	31.675	3	1774.8672	1774.8672	R	V	367	382
PSM	SEHSHSTTLPR	1244	sp|P16144-4|ITB4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=908	8.1773	2	1250.6004	1250.6004	R	D	1428	1439
PSM	SHTGERPFQCSLCSYASR	1245	sp|P49711-2|CTCF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=5034	33.086	3	2141.9371	2141.9371	R	D	44	62
PSM	SLHDALCVVKR	1246	sp|P17987|TCPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	7-UNIMOD:4	ms_run[2]:scan=4346	28.881	2	1296.6972	1296.6972	R	V	391	402
PSM	STANKYQVFFFGTHETAFLGPK	1247	sp|P51858-2|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	5-UNIMOD:188,22-UNIMOD:188	ms_run[2]:scan=10073	65.561	3	2501.2782	2501.2782	K	D	33	55
PSM	TEHAEFLHCK	1248	sp|P50570-3|DYN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	9-UNIMOD:4,10-UNIMOD:188	ms_run[2]:scan=2208	15.852	2	1276.5966	1276.5966	K	S	78	88
PSM	TFKTVFAEHISDECK	1249	sp|P39023|RL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	14-UNIMOD:4	ms_run[2]:scan=5808	37.879	3	1810.856	1810.8560	R	R	101	116
PSM	THDLTLASHEENPAWLPLYGSVCCR	1250	sp|Q9BST9-3|RTKN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	23-UNIMOD:4,24-UNIMOD:4	ms_run[2]:scan=9552	62.08	4	2925.3538	2925.3538	R	L	225	250
PSM	THNDIIHNENMR	1251	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:35	ms_run[2]:scan=1123	9.3987	2	1508.679	1508.6790	R	Q	548	560
PSM	TKGVDEVTIVNILTNR	1252	sp|P07355-2|ANXA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:188,16-UNIMOD:267	ms_run[2]:scan=10242	66.712	2	1787.0124	1783.0242	K	S	66	82
PSM	TPHYGSQTPLHDGSR	1253	sp|O00267-2|SPT5H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2044	14.846	2	1651.7703	1651.7703	R	T	795	810
PSM	TTEILHHLSER	1254	sp|Q96CS2|HAUS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=3503	23.72	2	1334.6943	1334.6943	R	N	33	44
PSM	TYFPHFDLSHGSAQVK	1255	sp|P69905|HBA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7117	46.121	3	1832.8846	1832.8846	K	G	42	58
PSM	VAPEEHPVLLTEAPLNPK	1256	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	18-UNIMOD:188	ms_run[2]:scan=7049	45.701	2	1959.0773	1959.0773	R	A	96	114
PSM	VEPFLPGHYEVLDLKPNGK	1257	sp|P08243-3|ASNS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	15-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=8762	56.837	3	2163.1767	2163.1767	K	V	94	113
PSM	VHELNEEIGKLLAK	1258	sp|Q9Y383-3|LC7L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=7705	49.895	3	1603.9336	1603.9336	R	V	123	137
PSM	VHSPSGAVEECHVSELEPDKYAVR	1259	sp|O75369-7|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:4	ms_run[2]:scan=5451	35.666	3	2694.2708	2694.2708	K	F	2143	2167
PSM	VILHLKEDQTEYLEER	1260	sp|P07900-2|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	6-UNIMOD:188,16-UNIMOD:267	ms_run[2]:scan=6207	40.386	2	2030.0655	2026.0774	K	R	308	324
PSM	VKEFLHNQGK	1261	sp|Q9H4A4|AMPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=1436	11.197	2	1198.6459	1198.6459	K	Q	591	601
PSM	VLSFTHPTSFHSAETYESLLQCLR	1262	sp|Q29RF7|PDS5A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	22-UNIMOD:4	ms_run[2]:scan=10832	70.639	3	2822.3698	2822.3698	K	M	665	689
PSM	VLTFLDSHCECNEHWLEPLLER	1263	sp|Q10471-2|GALT2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	9-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=11279	73.803	3	2796.3	2796.3000	K	V	129	151
PSM	VNCLDKFWHK	1264	sp|Q14847|LASP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	3-UNIMOD:4	ms_run[2]:scan=5845	38.11	2	1345.6601	1345.6601	K	A	18	28
PSM	VQLTTCIHHIIK	1265	sp|O95373|IPO7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	6-UNIMOD:4,12-UNIMOD:188	ms_run[2]:scan=5634	36.795	2	1467.8327	1467.8327	R	H	108	120
PSM	YGDGGSSFQSTTGHCVHMR	1266	sp|P55795|HNRH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	15-UNIMOD:4	ms_run[2]:scan=3693	24.876	3	2082.8636	2082.8636	R	G	276	295
PSM	YQRGECQACDQLHFCR	1267	sp|Q96H79|ZCCHL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	6-UNIMOD:4,9-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=4170	27.795	3	2126.8833	2126.8833	R	R	94	110
PSM	YSHLQPGDHLTDITLK	1268	sp|Q15046|SYK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6146	40.006	3	1836.937	1836.9370	K	V	112	128
PSM	MREIVHIQAGQCGNQIGAK	1269	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:1,12-UNIMOD:4	ms_run[1]:scan=4147	27.653190000000002	3	2152.059001	2151.067727	-	F	1	20
PSM	MGYAEEAPYDAIHVGAAAPVVPQALIDQLKPGGR	1270	sp|P22061|PIMT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:35	ms_run[1]:scan=11094	72.51828833333333	4	3519.771457	3519.782040	R	L	145	179
PSM	LQIRHEQISDLER	1271	sp|P29144|TPP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=4804	31.685834999999997	3	1635.861460	1635.869268	R	L	890	903
PSM	NTKHEISEMNR	1272	sp|P13647|K2C5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:188,11-UNIMOD:267	ms_run[1]:scan=1095	9.242623333333334	2	1373.670510	1373.669245	R	M	381	392
PSM	QHADHLALNEEIVNR	1273	sp|Q9UPN3-2|MACF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	15-UNIMOD:267	ms_run[1]:scan=4878	32.131785	2	1767.897501	1767.889164	R	K	3534	3549
PSM	KHPNEICVPMSVEFEELLK	1274	sp|Q12874|SF3A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	7-UNIMOD:4	ms_run[1]:scan=11151	72.89455166666667	3	2300.143875	2298.138826	R	A	97	116
PSM	KNGGLGHMNIALLSDLTK	1275	sp|P30048|PRDX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=10275	66.92841333333332	3	1881.995291	1881.014217	R	Q	149	167
PSM	HQASINELKR	1276	sp|Q9H4G0|E41L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	9-UNIMOD:188,10-UNIMOD:267	ms_run[1]:scan=1616	12.265880000000001	2	1210.677190	1210.675317	K	T	507	517
PSM	HQASINELKR	1277	sp|Q9H4G0|E41L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	9-UNIMOD:188,10-UNIMOD:267	ms_run[1]:scan=1628	12.333163333333333	3	1210.675247	1210.675317	K	T	507	517
PSM	QGCKNEEVLAVLGHELGHWK	1278	sp|O75844|FACE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28,3-UNIMOD:4	ms_run[1]:scan=10958	71.56371166666666	3	2287.1312	2286.1212	K	L	322	342
PSM	HSGNITFDEIVNIAR	1279	sp|P30050|RL12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	15-UNIMOD:267	ms_run[1]:scan=9667	62.837075	2	1694.838952	1694.861552	K	Q	100	115
PSM	FQAKLEHEYIQNFK	1280	sp|Q15691|MARE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=5916	38.54673833333334	3	1793.911689	1793.910070	K	I	63	77
PSM	LPSGEDYNLKLELLHPIIPEQSTFK	1281	sp|Q9Y2Z0|SGT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=10613	69.16926833333333	3	2881.524786	2880.527312	K	V	212	237
PSM	MREIVHIQAGQCGNQIGAK	1282	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	2-UNIMOD:267,12-UNIMOD:4,19-UNIMOD:188	ms_run[1]:scan=4685	30.955516666666668	4	2125.082222	2125.085560	-	F	1	20
PSM	AGHFDKEIVPVLVSTR	1283	sp|Q9BWD1|THIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	6-UNIMOD:188,16-UNIMOD:267	ms_run[2]:scan=6876	44.625	2	1782.9963	1779.0082	K	K	195	211
PSM	AHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLR	1284	sp|P46937-5|YAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=8280	53.653	4	3533.859	3533.8590	R	Q	125	162
PSM	APSHVPFLLIGGGTAAFAAAR	1285	sp|O95831-6|AIFM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10809	70.478	3	2023.1003	2023.1003	K	S	41	62
PSM	AVAHHTDCTFIR	1286	sp|P62195-2|PRS8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	8-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=2346	16.68	3	1436.6858	1436.6858	R	V	194	206
PSM	AVAHHTDCTFIR	1287	sp|P62195-2|PRS8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	8-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=2347	16.685	2	1436.6858	1436.6858	R	V	194	206
PSM	AVAHHTDCTFIR	1288	sp|P62195-2|PRS8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	8-UNIMOD:4	ms_run[2]:scan=2356	16.74	3	1426.6776	1426.6776	R	V	194	206
PSM	AWHLAETEHCGATPSNR	1289	sp|P36941-2|TNR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:4	ms_run[2]:scan=3752	25.244	3	1935.8646	1935.8646	K	G	390	407
PSM	CSYQPTMEGVHTVHVTFAGVPIPR	1290	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:4,24-UNIMOD:267	ms_run[2]:scan=8925	57.895	3	2692.3129	2692.3129	R	S	444	468
PSM	CTKEEAIEHNYGGHDDDLSVR	1291	sp|Q93009-3|UBP7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:4	ms_run[2]:scan=4058	27.104	3	2444.0663	2444.0663	R	H	472	493
PSM	DGQVHLFEHILNGYCK	1292	sp|Q15061|WDR43_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	15-UNIMOD:4	ms_run[2]:scan=8898	57.718	3	1928.9203	1928.9203	R	K	293	309
PSM	DHRPPCAQEAPR	1293	sp|Q13501-2|SQSTM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:267,6-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=905	8.162	2	1452.6795	1452.6795	R	N	24	36
PSM	DIIHDPGRGAPLAK	1294	sp|P62917|RL8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4273	28.436	2	1458.7943	1458.7943	K	V	47	61
PSM	DRLLASTLVHSVK	1295	sp|Q9NYF8-2|BCLF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6000	39.073	2	1437.8304	1437.8304	K	K	566	579
PSM	DTGQLYAALHHR	1296	sp|Q9H6Z4-3|RANB3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4977	32.745	2	1380.6898	1380.6898	K	I	428	440
PSM	EHEHVVECISWAPESSYSSISEATGSETKK	1297	sp|P43034|LIS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	8-UNIMOD:4	ms_run[2]:scan=7427	48.106	3	3363.5201	3363.5201	R	S	274	304
PSM	EHLGHESDNLLFVQITGK	1298	sp|Q6FI81-3|CPIN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=8076	52.278	3	2036.0327	2036.0327	R	K	132	150
PSM	EIAVHIGDRDNAVR	1299	sp|Q14008-2|CKAP5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:267,14-UNIMOD:267	ms_run[2]:scan=3979	26.624	2	1583.8283	1583.8283	K	N	1370	1384
PSM	ESGLQAAHPNSIFLIDHAWTCR	1300	sp|Q14166|TTL12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	21-UNIMOD:4,22-UNIMOD:267	ms_run[2]:scan=9416	61.181	3	2532.2207	2532.2207	R	V	106	128
PSM	FGPDTQHLVLNENCASVHNLR	1301	sp|Q9BQ52-2|RNZ2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	14-UNIMOD:4,21-UNIMOD:267	ms_run[2]:scan=6624	43.035	4	2430.1738	2430.1738	R	S	267	288
PSM	FNGTHIPGSPFK	1302	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:188	ms_run[2]:scan=5912	38.52	2	1306.6765	1306.6765	K	I	2398	2410
PSM	FVLQDGAHHMVDSNEISFIR	1303	sp|Q96RP9|EFGM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	20-UNIMOD:267	ms_run[2]:scan=8598	55.768	3	2324.1247	2324.1247	R	A	609	629
PSM	GAIQFVTHYQHSSTQR	1304	sp|Q15437|SC23B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4822	31.796	3	1858.9074	1858.9074	R	R	479	495
PSM	GHYTEGAELVDSVLDVVR	1305	sp|P68371|TBB4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11883	78.22	3	1957.9745	1957.9745	K	K	104	122
PSM	GHYTEGAELVDSVLDVVRK	1306	sp|P68371|TBB4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	18-UNIMOD:267,19-UNIMOD:188	ms_run[2]:scan=11141	72.83	2	2102.0979	2098.1097	K	E	104	123
PSM	GIGTLHLKPTANQK	1307	sp|Q9UKX7-2|NUP50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	8-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=3320	22.573	2	1488.8815	1488.8815	K	T	349	363
PSM	GILTLKYPIEHGIITNWDDMEK	1308	sp|P63267|ACTH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	6-UNIMOD:188,20-UNIMOD:35,22-UNIMOD:188	ms_run[2]:scan=9749	63.369	2	2613.3551	2613.3551	R	I	64	86
PSM	GKLNHLCGADFVK	1309	sp|O95394|AGM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:188,7-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=4564	30.238	2	1469.7852	1469.7852	K	S	243	256
PSM	GQKIPIFSAAGLPHNEIAAQICR	1310	sp|P15313|VATB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	22-UNIMOD:4	ms_run[2]:scan=8879	57.596	4	2490.3165	2490.3165	R	Q	180	203
PSM	GVDEVTIVNILTNR	1311	sp|P07355-2|ANXA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	14-UNIMOD:267	ms_run[2]:scan=11439	74.984	2	1551.8496	1551.8496	K	S	68	82
PSM	HAYGLGEHYNSVTR	1312	sp|Q8N6M0-2|OTU6B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=3188	21.79	3	1602.7539	1602.7539	R	L	169	183
PSM	HCLQTVWNKPTVK	1313	sp|P07602|SAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:4	ms_run[2]:scan=4051	27.061	3	1609.8399	1609.8399	K	S	47	60
PSM	HFAGDVLGYVTPWNSHGYDVTK	1314	sp|Q9BWS9-3|CHID1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9624	62.556	3	2462.1655	2462.1655	R	V	76	98
PSM	HFDETVNRYK	1315	sp|P04843|RPN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2365	16.795	2	1307.6258	1307.6258	R	Q	495	505
PSM	HFSEHPSTSK	1316	sp|O43719|HTSF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=711	7.0725	2	1155.5309	1155.5309	R	M	401	411
PSM	HFSISGCPLYHNLSADECK	1317	sp|O95251-3|KAT7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	7-UNIMOD:4,18-UNIMOD:4	ms_run[2]:scan=6857	44.509	3	2233.9885	2233.9885	R	A	64	83
PSM	HGGYKFSAPVVPSSFNFGGPAPGMN	1318	sp|O95373|IPO7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	5-UNIMOD:188	ms_run[2]:scan=9911	64.481	2	2527.205	2527.2050	K	-	1014	1039
PSM	HHIETGGGQLPAK	1319	sp|Q92616|GCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=1363	10.751	2	1343.6946	1343.6946	R	L	2538	2551
PSM	HIELHTDGNNIYVK	1320	sp|Q2TB10|ZN800_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	14-UNIMOD:188	ms_run[2]:scan=4941	32.526	2	1657.8519	1657.8519	K	F	504	518
PSM	HKELAPYDENWFYTR	1321	sp|P39019|RS19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:188,15-UNIMOD:267	ms_run[2]:scan=7548	48.894	2	1983.945	1979.9569	K	A	42	57
PSM	HLLIGLPSGAILSLPK	1322	sp|Q8N766-4|EMC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	16-UNIMOD:188	ms_run[2]:scan=11175	73.058	2	1634.0226	1634.0226	R	A	838	854
PSM	HLPSTEPDPHVVR	1323	sp|Q9BUJ2-4|HNRL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	13-UNIMOD:267	ms_run[2]:scan=3079	21.127	2	1492.7662	1492.7662	K	I	171	184
PSM	HLPSTEPDPHVVR	1324	sp|Q9BUJ2-4|HNRL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=3094	21.218	2	1482.7579	1482.7579	K	I	171	184
PSM	HNIICLQNDHK	1325	sp|O00233-2|PSMD9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	5-UNIMOD:4	ms_run[2]:scan=2867	19.81	3	1390.6776	1390.6776	R	A	77	88
PSM	HSTPHAAFQPNSQIGEEMSQNSFIK	1326	sp|Q9UKV3-5|ACINU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	25-UNIMOD:188	ms_run[2]:scan=7520	48.711	2	2790.3127	2790.3127	K	Q	114	139
PSM	HTTDHPMQCILTR	1327	sp|Q9P0J7|KCMF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:4	ms_run[2]:scan=4053	27.071	2	1608.7501	1608.7501	R	V	46	59
PSM	HVAEDLGKVFGER	1328	sp|P40939|ECHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	8-UNIMOD:188,13-UNIMOD:267	ms_run[2]:scan=5879	38.322	2	1471.7754	1467.7873	K	F	598	611
PSM	HVTDYKTSESTGSLPSPFLR	1329	sp|O95456-2|PSMG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6698	43.507	3	2221.1015	2221.1015	R	A	150	170
PSM	HWILPQDYDHAQAEAR	1330	sp|Q15293-2|RCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	16-UNIMOD:267	ms_run[2]:scan=5933	38.655	3	1958.9263	1958.9263	R	H	220	236
PSM	IAELLENVTLIHKPVSLQPR	1331	sp|Q14694|UBP10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9312	60.492	4	2269.3158	2269.3158	K	G	396	416
PSM	IGKPHTVPCK	1332	sp|P15880|RS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:188,9-UNIMOD:4,10-UNIMOD:188	ms_run[2]:scan=834	7.7703	2	1147.6575	1147.6575	K	V	174	184
PSM	IHVLEAQDLIAKDR	1333	sp|Q9BSJ8|ESYT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:188,14-UNIMOD:267	ms_run[2]:scan=6422	41.762	2	1635.9279	1631.9398	R	F	651	665
PSM	IIAHAQLLEQHR	1334	sp|P27708|PYR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:267	ms_run[2]:scan=3661	24.683	3	1437.808	1437.8080	R	G	843	855
PSM	IKGEHPGLSIGDVAK	1335	sp|P09429|HMGB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4354	28.927	3	1519.8358	1519.8358	K	K	113	128
PSM	IKSEHPGLSIGDTAK	1336	sp|P26583|HMGB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=3112	21.329	3	1551.8257	1551.8257	K	K	113	128
PSM	ILPGNMKDNFWEMGDTGPCGPCSEIHYDR	1337	sp|P49588|SYAC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	19-UNIMOD:4,22-UNIMOD:4	ms_run[2]:scan=9353	60.762	3	3395.4468	3395.4468	K	I	166	195
PSM	ISIEMHGTLEDQLSHLR	1338	sp|P12814-2|ACTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	5-UNIMOD:35,17-UNIMOD:267	ms_run[2]:scan=7678	49.722	3	2003.9974	2003.9974	R	Q	656	673
PSM	IVGAPMHDLLLWNNATVTTCHSK	1339	sp|P11586|C1TC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	20-UNIMOD:4	ms_run[2]:scan=9528	61.922	4	2577.2832	2577.2832	K	T	176	199
PSM	KFDEVLVNHFCEEFGK	1340	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:188,11-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=8754	56.788	3	2008.9756	2008.9756	R	K	235	251
PSM	KFNHDGEEEEEDDDYGSR	1341	sp|Q6PJT7-10|ZC3HE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=1993	14.539	3	2169.8359	2169.8359	K	T	270	288
PSM	KHDSGAADLER	1342	sp|Q9NX55|HYPK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=897	8.1159	2	1197.5738	1197.5738	R	V	35	46
PSM	KHSQFIGYPITLYLEK	1343	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=9580	62.268	3	1948.0861	1948.0861	K	E	204	220
PSM	KISSIQSIVPALEIANAHR	1344	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:188,19-UNIMOD:267	ms_run[2]:scan=9127	59.245	3	2062.187	2058.1988	K	K	250	269
PSM	KLDALCNIHENIR	1345	sp|P53621|COPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	6-UNIMOD:4	ms_run[2]:scan=5200	34.124	3	1594.825	1594.8250	R	V	517	530
PSM	KLDYGQHVVAGTPGR	1346	sp|P38919|IF4A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=3254	22.182	3	1596.8372	1596.8372	R	V	152	167
PSM	KLVAIVDPHIK	1347	sp|Q14697|GANAB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=5006	32.92	3	1243.8055	1243.8055	R	V	462	473
PSM	KLVAIVDPHIK	1348	sp|Q14697|GANAB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5013	32.961	2	1231.7652	1231.7652	R	V	462	473
PSM	KPHTESLELQVR	1349	sp|Q9BSJ8|ESYT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=3535	23.906	3	1435.7783	1435.7783	R	G	855	867
PSM	KVPEFQFLIGDEAATHLK	1350	sp|P34949|MPI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=9632	62.61	3	2054.1239	2054.1239	K	Q	163	181
PSM	KVPEFQFLIGDEAATHLK	1351	sp|P34949|MPI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9634	62.622	3	2042.0837	2042.0837	K	Q	163	181
PSM	LDHKFDLMYAK	1352	sp|P68363-2|TBA1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	4-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=5732	37.392	2	1391.731	1391.7310	R	R	275	286
PSM	LDHKFDLMYAK	1353	sp|P68363-2|TBA1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5736	37.418	2	1379.6908	1379.6908	R	R	275	286
PSM	LEGLTDEINFLR	1354	sp|P05787|K2C8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:267	ms_run[2]:scan=10677	69.599	2	1428.7488	1428.7488	R	Q	214	226
PSM	LEHAFCTETRPYNQGAR	1355	sp|Q9BV20|MTNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	6-UNIMOD:4	ms_run[2]:scan=3556	24.025	2	2048.9487	2048.9487	R	L	194	211
PSM	LHLSGIDANPNALFPPVEFPAPR	1356	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	23-UNIMOD:267	ms_run[2]:scan=11333	74.185	3	2481.3044	2481.3044	R	G	803	826
PSM	LHLSGIDANPNALFPPVEFPAPR	1357	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11371	74.455	4	2471.2961	2471.2961	R	G	803	826
PSM	LLFGHSTEGDILELVDGHFDTK	1358	sp|Q9UHY7-2|ENOPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	22-UNIMOD:188	ms_run[2]:scan=11952	78.726	2	2448.2268	2448.2268	K	I	16	38
PSM	LLHVAVSDVNDDVRR	1359	sp|Q99460-2|PSMD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5201	34.13	3	1706.9064	1706.9064	R	A	602	617
PSM	LLKNHDEESLECLCR	1360	sp|Q04637-6|IF4G1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:188,12-UNIMOD:4,14-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=4824	31.807	2	1930.9212	1926.9330	K	L	727	742
PSM	LNCQVIGASVDSHFCHLAWVNTPK	1361	sp|Q06830|PRDX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=9250	60.056	3	2752.3214	2752.3214	K	K	69	93
PSM	LNEQYEHASIHLWDLLEGK	1362	sp|Q14444-2|CAPR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11217	73.341	3	2294.1331	2294.1331	R	E	203	222
PSM	LNSHMNALHLGSQANR	1363	sp|P11413|G6PD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4158	27.721	3	1761.8693	1761.8693	R	L	121	137
PSM	LPSGEDYNLKLELLHPIIPEQSTFK	1364	sp|Q9Y2Z0-2|SGT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:188,25-UNIMOD:188	ms_run[2]:scan=10623	69.235	3	2892.5676	2892.5676	K	V	180	205
PSM	LQAEIEGLKGQR	1365	sp|P05787|K2C8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4320	28.731	2	1340.7412	1340.7412	R	A	317	329
PSM	LREAGLAPVPMIIFAK	1366	sp|P06132|DCUP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10763	70.177	2	1725.0011	1725.0011	R	D	248	264
PSM	MHLAGKTEQAK	1367	sp|Q13442|HAP28_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	6-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=889	8.073	2	1224.6687	1224.6687	K	A	127	138
PSM	NCIVLIDSTPYRQWYESHYALPLGR	1368	sp|P62241|RS8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:4,12-UNIMOD:267,25-UNIMOD:267	ms_run[2]:scan=10983	71.736	3	3070.5238	3070.5238	K	K	99	124
PSM	NKHEAMITDLEER	1369	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4364	28.984	3	1584.7566	1584.7566	K	L	1023	1036
PSM	QIDQNWYEGEHHGR	1370	sp|Q9BX66-4|SRBS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	14-UNIMOD:267	ms_run[2]:scan=3811	25.609	2	1777.7796	1777.7796	K	V	475	489
PSM	QIRHESGASIK	1371	sp|P61978-3|HNRPK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=785	7.4893	2	1224.6575	1224.6575	K	I	388	399
PSM	QLFHPEQLITGKEDAANNYAR	1372	sp|P68363-2|TBA1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7133	46.218	3	2414.1979	2414.1979	R	G	85	106
PSM	QSVENDIHGLRK	1373	sp|P05783|K1C18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=3098	21.238	2	1394.7266	1394.7266	R	V	176	188
PSM	RDPHLACVAYER	1374	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:267,7-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=3181	21.746	2	1505.7312	1505.7312	K	G	912	924
PSM	RDQALTEEHAR	1375	sp|P12814-2|ACTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=852	7.8657	3	1324.6484	1324.6484	R	Q	614	625
PSM	RGPGPVDLLLCCGDFQAVR	1376	sp|Q9UK59|DBR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:267,11-UNIMOD:4,12-UNIMOD:4,19-UNIMOD:267	ms_run[2]:scan=10376	67.598	3	2149.0676	2149.0676	R	N	26	45
PSM	RLGPLLLDPSLAVR	1377	sp|Q7Z4Q2|HEAT3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9743	63.328	2	1518.9246	1518.9246	R	E	83	97
PSM	SEVQQPVHPKPLSPDSR	1378	sp|Q9UHB6|LIMA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:188,17-UNIMOD:267	ms_run[2]:scan=2984	20.536	2	1916.0087	1912.0205	K	A	350	367
PSM	SGGASHSELIHNLR	1379	sp|P22061|PIMT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	14-UNIMOD:267	ms_run[2]:scan=3047	20.927	3	1486.7516	1486.7516	K	K	5	19
PSM	SGNALFHASTLHR	1380	sp|Q14152-2|EIF3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4025	26.905	2	1409.7164	1409.7164	K	L	252	265
PSM	SHLEVPLEENVNRR	1381	sp|Q96CT7|CC124_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	13-UNIMOD:267,14-UNIMOD:267	ms_run[2]:scan=4843	31.917	2	1710.8916	1710.8916	K	V	122	136
PSM	SHLLNCCPHDVLSGTR	1382	sp|Q9Y383-3|LC7L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	6-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=4829	31.841	3	1864.8672	1864.8672	K	M	35	51
PSM	SHVVREDLNPR	1383	sp|Q9BSJ8|ESYT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	5-UNIMOD:267,11-UNIMOD:267	ms_run[2]:scan=1693	12.718	2	1340.7064	1340.7064	R	W	689	700
PSM	STPHRTPIITPNTK	1384	sp|Q9NQW6-2|ANLN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2213	15.884	2	1561.8576	1561.8576	R	A	392	406
PSM	SWHDIEKDNAR	1385	sp|Q15437|SC23B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2576	18.072	2	1369.6375	1369.6375	R	F	314	325
PSM	SWHPEEFNCAHCK	1386	sp|Q96HC4-7|PDLI5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=3951	26.449	2	1700.6824	1700.6824	K	N	335	348
PSM	SYDVPPPPMEPDHPFYSNISKDR	1387	sp|Q8N0Y7|PGAM4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7247	46.929	2	2687.2326	2687.2326	R	R	118	141
PSM	TAWLDGKHVVFGK	1388	sp|P23284|PPIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	7-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=6432	41.821	3	1468.8229	1468.8229	K	V	159	172
PSM	TFRNWMNSLGVNPR	1389	sp|P13796|PLSL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=8731	56.641	3	1690.8362	1690.8362	R	V	399	413
PSM	TGTITTFEHAHNMR	1390	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=3870	25.965	3	1614.7573	1614.7573	K	V	482	496
PSM	THIETVINALKTER	1391	sp|O94973-3|AP2A2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6743	43.793	3	1623.8944	1623.8944	K	D	368	382
PSM	THNDIIHNENMR	1392	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2168	15.609	3	1492.6841	1492.6841	R	Q	548	560
PSM	TKDGLEVAVLPHNIR	1393	sp|Q14690|RRP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6089	39.636	3	1660.9261	1660.9261	K	A	647	662
PSM	TLPAHSDPVSAVHFNR	1394	sp|P61964|WDR5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	16-UNIMOD:267	ms_run[2]:scan=5111	33.567	2	1756.8884	1756.8884	K	D	166	182
PSM	TVAPMPPAQDHKR	1395	sp|P22102|PUR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=1343	10.627	2	1446.7402	1446.7402	K	L	208	221
PSM	TVSTLHHVLQR	1396	sp|O00764|PDXK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:267	ms_run[2]:scan=2762	19.188	2	1299.7287	1299.7287	K	T	259	270
PSM	VANDNAPEHALRPGFLSTFALATDQGSK	1397	sp|Q9UHA4|LTOR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:267,28-UNIMOD:188	ms_run[2]:scan=9596	62.374	3	2942.4857	2938.4976	K	L	35	63
PSM	VCEIHFHEINNK	1398	sp|Q96DH6-3|MSI2H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:4	ms_run[2]:scan=3971	26.575	2	1538.73	1538.7300	K	M	63	75
PSM	VHNGMDDLILDGHNILDGLR	1399	sp|O14653-3|GOSR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11562	75.877	3	2216.1008	2216.1008	K	T	133	153
PSM	VHSPSGAVEECHVSELEPDKYAVR	1400	sp|O75369-7|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:4,20-UNIMOD:188,24-UNIMOD:267	ms_run[2]:scan=5448	35.648	2	2710.2992	2706.3110	K	F	2143	2167
PSM	VKGGGHVAQIYAIR	1401	sp|P62249|RS16_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:188,14-UNIMOD:267	ms_run[2]:scan=3842	25.803	2	1483.8594	1479.8713	R	Q	72	86
PSM	VLRHEEFEEGCK	1402	sp|Q9HC38-3|GLOD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:4	ms_run[2]:scan=2036	14.799	2	1531.7089	1531.7089	K	A	31	43
PSM	VLVAQHDVYKGLLPEELTPLILATQK	1403	sp|P13804-2|ETFA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11824	77.802	3	2887.6423	2887.6423	K	Q	27	53
PSM	VTAIHIDPATHR	1404	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=3195	21.83	2	1329.7153	1329.7153	R	Q	1052	1064
PSM	YADLSHNRLNDYIFSFDK	1405	sp|P54136-2|SYRC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9732	63.257	2	2217.0491	2217.0491	K	M	433	451
PSM	YGDGGSSFQSTTGHCVHMR	1406	sp|P55795|HNRH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	15-UNIMOD:4,19-UNIMOD:267	ms_run[2]:scan=3696	24.892	3	2092.8719	2092.8719	R	G	276	295
PSM	YGDGGSTFQSTTGHCVHMR	1407	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	15-UNIMOD:4,19-UNIMOD:267	ms_run[2]:scan=3855	25.879	3	2106.8875	2106.8875	R	G	276	295
PSM	YHIEVNRVPAGNWVLIEGVDQPIVK	1408	sp|Q15029|U5S1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	7-UNIMOD:267,25-UNIMOD:188	ms_run[2]:scan=10290	67.025	3	2860.557	2856.5689	R	T	537	562
PSM	YLSHSEFKDLILPTIQK	1409	sp|Q92616|GCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=8704	56.472	3	2031.1041	2031.1041	R	S	252	269
PSM	GISHVIVDEIHER	1410	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=5566	36.372805	3	1502.785912	1502.784141	R	D	504	517
PSM	QLFHPEQLITGKEDAANNYAR	1411	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:28	ms_run[1]:scan=9317	60.525438333333334	3	2398.1582	2397.1712	R	G	85	106
PSM	RMEELHNQEMQK	1412	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:267,12-UNIMOD:188	ms_run[1]:scan=1700	12.760781666666666	3	1587.737845	1587.746844	R	R	548	560
PSM	YAEIVHLTLPDGTKR	1413	sp|P21281|VATB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	14-UNIMOD:188,15-UNIMOD:267	ms_run[1]:scan=6988	45.31827166666667	3	1728.975165	1727.954118	R	S	68	83
PSM	ANGTTVHVGIHPSK	1414	sp|Q9UNX3|RL26L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	14-UNIMOD:188	ms_run[1]:scan=2124	15.335538333333334	2	1422.760851	1422.767490	K	V	90	104
PSM	YHQIGSGKCEIK	1415	sp|O14979|HNRDL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	9-UNIMOD:4	ms_run[1]:scan=1590	12.107475	3	1418.699054	1418.697634	R	V	295	307
PSM	NICVLAHVDHGK	1416	sp|Q7Z2Z2|EFL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:4	ms_run[1]:scan=3866	25.94090333333333	2	1361.683892	1361.687404	R	T	21	33
PSM	AGHRTPLSDSGVTQR	1417	sp|Q9NPF4|OSGEP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1938	14.20854	3	1581.823414	1580.801916	R	Y	309	324
PSM	HMVMSFRVSELQVLLGFAGR	1418	sp|Q9Y6X2|PIAS3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	2-UNIMOD:35	ms_run[1]:scan=9809	63.769466666666666	3	2292.190044	2292.187114	K	N	9	29
PSM	YHTINGHNAEVR	1419	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1884	13.887538333333334	2	1410.659472	1409.680010	K	K	174	186
PSM	AAKDLVLGPSGVLQGIR	1420	sp|Q49A26|GLYR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=5043	33.139425	2	1692.998801	1692.988654	K	P	336	353
PSM	QRMDILDVLTLAAQELSR	1421	sp|Q9Y4R8|TELO2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	18-UNIMOD:267	ms_run[1]:scan=5823	37.97170166666667	2	2083.164663	2081.117843	R	P	608	626
PSM	HGLLVPNNTTDQELQHIR	1422	sp|P56537|IF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	18-UNIMOD:267	ms_run[1]:scan=6585	42.79851666666667	3	2097.076180	2094.084569	R	N	68	86