MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000208 -- new
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220618\20220618002634800212^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\111222_HL17.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220618\20220618002634800212^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\111222_HL17.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Acetyl (Protein N-term),Label:13C(6) (K),Label:13C(6)15N(4) (R),Oxidation (M)
MTD	software[1]-setting	maxMissedCleavages=1
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=40
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Label:13C(6) (K),Label:13C(6)15N(4) (R),Acetyl (Protein N-term)
MTD	software[2]-setting	TOL(-)=20
MTD	software[2]-setting	TOL(+)=20
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=1000
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=1
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Acetyl (Protein N-term),Label:13C(6) (K),Label:13C(6)15N(4) (R),Oxidation (M)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=1
MTD	software[3]-setting	peptide_mass_tolerance=20
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:1, Acetyl,]
MTD	variable_mod[1]-site	N-term
MTD	variable_mod[1]-position	Protein N-term
MTD	variable_mod[2]	[UNIMOD, UNIMOD:188, Label:13C(6),]
MTD	variable_mod[2]-site	K
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:267, Label:13C(6)15N(4),]
MTD	variable_mod[3]-site	R
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[4]-site	M
MTD	variable_mod[4]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|Q96DI7|SNR40_HUMAN	U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens OX=9606 GN=SNRNP40 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	53.0	null	20-UNIMOD:28,21-UNIMOD:267,51-UNIMOD:267	0.09	53.0	2	1	0
PRT	sp|P40926|MDHM_HUMAN	Malate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=MDH2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	47.0	null	165-UNIMOD:188,176-UNIMOD:267	0.06	47.0	4	1	0
PRT	sp|Q13885|TBB2A_HUMAN	Tubulin beta-2A chain OS=Homo sapiens OX=9606 GN=TUBB2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45.0	null	1-UNIMOD:35,12-UNIMOD:4,2-UNIMOD:267,19-UNIMOD:188	0.04	45.0	11	1	0
PRT	sp|P49257|LMAN1_HUMAN	Protein ERGIC-53 OS=Homo sapiens OX=9606 GN=LMAN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	81-UNIMOD:267	0.06	44.0	3	1	0
PRT	sp|Q8N573-6|OXR1_HUMAN	Isoform 6 of Oxidation resistance protein 1 OS=Homo sapiens OX=9606 GN=OXR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	22-UNIMOD:188,37-UNIMOD:188	0.06	44.0	2	1	0
PRT	sp|Q7L0Y3|TM10C_HUMAN	tRNA methyltransferase 10 homolog C OS=Homo sapiens OX=9606 GN=TRMT10C PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	397-UNIMOD:267	0.04	44.0	4	1	0
PRT	sp|P21964-2|COMT_HUMAN	Isoform Soluble of Catechol O-methyltransferase OS=Homo sapiens OX=9606 GN=COMT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	173-UNIMOD:4	0.11	44.0	1	1	0
PRT	sp|P30048-2|PRDX3_HUMAN	Isoform 2 of Thioredoxin-dependent peroxide reductase, mitochondrial OS=Homo sapiens OX=9606 GN=PRDX3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	131-UNIMOD:188,148-UNIMOD:188,138-UNIMOD:35	0.08	44.0	6	1	0
PRT	sp|P60981-2|DEST_HUMAN	Isoform 2 of Destrin OS=Homo sapiens OX=9606 GN=DSTN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	118-UNIMOD:4,63-UNIMOD:4,115-UNIMOD:188,128-UNIMOD:267	0.22	43.0	4	2	1
PRT	sp|Q9Y230-2|RUVB2_HUMAN	Isoform 2 of RuvB-like 2 OS=Homo sapiens OX=9606 GN=RUVBL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	291-UNIMOD:267,308-UNIMOD:267	0.09	43.0	5	2	0
PRT	sp|O00571-2|DDX3X_HUMAN	Isoform 2 of ATP-dependent RNA helicase DDX3X OS=Homo sapiens OX=9606 GN=DDX3X	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	452-UNIMOD:4	0.04	43.0	5	1	0
PRT	sp|P68371|TBB4B_HUMAN	Tubulin beta-4B chain OS=Homo sapiens OX=9606 GN=TUBB4B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	12-UNIMOD:4	0.09	43.0	3	2	1
PRT	sp|P34897-3|GLYM_HUMAN	Isoform 3 of Serine hydroxymethyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=SHMT2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	241-UNIMOD:188	0.04	42.0	4	1	0
PRT	sp|P08195-2|4F2_HUMAN	Isoform 2 of 4F2 cell-surface antigen heavy chain OS=Homo sapiens OX=9606 GN=SLC3A2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.07	42.0	4	2	0
PRT	sp|P24752|THIL_HUMAN	Acetyl-CoA acetyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=ACAT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	366-UNIMOD:35,403-UNIMOD:188	0.09	42.0	4	2	0
PRT	sp|O15372|EIF3H_HUMAN	Eukaryotic translation initiation factor 3 subunit H OS=Homo sapiens OX=9606 GN=EIF3H PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	42.0	null	227-UNIMOD:188,241-UNIMOD:188,220-UNIMOD:188,221-UNIMOD:188	0.10	42.0	5	2	1
PRT	sp|P62826|RAN_HUMAN	GTP-binding nuclear protein Ran OS=Homo sapiens OX=9606 GN=RAN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	56-UNIMOD:267	0.09	42.0	3	1	0
PRT	sp|O75369|FLNB_HUMAN	Filamin-B OS=Homo sapiens OX=9606 GN=FLNB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	null	2195-UNIMOD:188	0.01	42.0	1	1	0
PRT	sp|Q969V3-2|NCLN_HUMAN	Isoform 2 of Nicalin OS=Homo sapiens OX=9606 GN=NCLN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.04	41.0	2	1	0
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	41.0	null	647-UNIMOD:267,209-UNIMOD:188,224-UNIMOD:188,226-UNIMOD:267	0.11	41.0	16	6	3
PRT	sp|Q15293-2|RCN1_HUMAN	Isoform 2 of Reticulocalbin-1 OS=Homo sapiens OX=9606 GN=RCN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	235-UNIMOD:267	0.06	41.0	3	1	0
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	41-UNIMOD:4,32-UNIMOD:188,42-UNIMOD:188,495-UNIMOD:267	0.07	41.0	6	3	1
PRT	sp|Q9NUP9|LIN7C_HUMAN	Protein lin-7 homolog C OS=Homo sapiens OX=9606 GN=LIN7C PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.11	41.0	2	1	0
PRT	sp|Q01082-3|SPTB2_HUMAN	Isoform 2 of Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	686-UNIMOD:188,701-UNIMOD:188,1832-UNIMOD:35,1848-UNIMOD:267	0.02	41.0	5	2	1
PRT	sp|P43034|LIS1_HUMAN	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens OX=9606 GN=PAFAH1B1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	147-UNIMOD:188,163-UNIMOD:188	0.05	41.0	3	1	0
PRT	sp|Q6IQ49-3|SDE2_HUMAN	Isoform 3 of Replication stress response regulator SDE2 OS=Homo sapiens OX=9606 GN=SDE2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	203-UNIMOD:4	0.06	40.0	1	1	1
PRT	sp|P12955-3|PEPD_HUMAN	Isoform 3 of Xaa-Pro dipeptidase OS=Homo sapiens OX=9606 GN=PEPD	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	179-UNIMOD:4,181-UNIMOD:4,201-UNIMOD:267	0.07	40.0	6	1	0
PRT	sp|P07910-4|HNRPC_HUMAN	Isoform 4 of Heterogeneous nuclear ribonucleoproteins C1/C2 OS=Homo sapiens OX=9606 GN=HNRNPC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	46-UNIMOD:4,50-UNIMOD:188,61-UNIMOD:267	0.08	40.0	3	1	0
PRT	sp|P62979|RS27A_HUMAN	Ubiquitin-40S ribosomal protein S27a OS=Homo sapiens OX=9606 GN=RPS27A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	119-UNIMOD:267,121-UNIMOD:4,126-UNIMOD:4,138-UNIMOD:267	0.13	40.0	2	1	0
PRT	sp|Q96I24|FUBP3_HUMAN	Far upstream element-binding protein 3 OS=Homo sapiens OX=9606 GN=FUBP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	58-UNIMOD:267,75-UNIMOD:267	0.03	40.0	4	1	0
PRT	sp|P46063|RECQ1_HUMAN	ATP-dependent DNA helicase Q1 OS=Homo sapiens OX=9606 GN=RECQL PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	471-UNIMOD:4,223-UNIMOD:4,224-UNIMOD:4	0.06	40.0	3	2	1
PRT	sp|P21964|COMT_HUMAN	Catechol O-methyltransferase OS=Homo sapiens OX=9606 GN=COMT PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	223-UNIMOD:4,212-UNIMOD:188,234-UNIMOD:267	0.09	40.0	2	1	0
PRT	sp|P06733|ENOA_HUMAN	Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	162-UNIMOD:188	0.07	40.0	6	1	0
PRT	sp|Q14204|DYHC1_HUMAN	Cytoplasmic dynein 1 heavy chain 1 OS=Homo sapiens OX=9606 GN=DYNC1H1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	39.0	null	2451-UNIMOD:267	0.00	39.0	3	1	0
PRT	sp|Q9BZK7|TBL1R_HUMAN	F-box-like/WD repeat-containing protein TBL1XR1 OS=Homo sapiens OX=9606 GN=TBL1XR1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	465-UNIMOD:4,481-UNIMOD:267	0.04	39.0	1	1	1
PRT	sp|Q8WUJ3|CEMIP_HUMAN	Cell migration-inducing and hyaluronan-binding protein OS=Homo sapiens OX=9606 GN=CEMIP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.01	39.0	1	1	1
PRT	sp|P43243|MATR3_HUMAN	Matrin-3 OS=Homo sapiens OX=9606 GN=MATR3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	102-UNIMOD:267,120-UNIMOD:267	0.03	39.0	2	1	0
PRT	sp|P39019|RS19_HUMAN	40S ribosomal protein S19 OS=Homo sapiens OX=9606 GN=RPS19 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	43-UNIMOD:188,56-UNIMOD:267	0.11	39.0	3	1	0
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	639-UNIMOD:267	0.04	39.0	5	2	1
PRT	sp|P50990-3|TCPQ_HUMAN	Isoform 3 of T-complex protein 1 subunit theta OS=Homo sapiens OX=9606 GN=CCT8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	151-UNIMOD:188,152-UNIMOD:188	0.04	39.0	2	1	0
PRT	sp|P06493-2|CDK1_HUMAN	Isoform 2 of Cyclin-dependent kinase 1 OS=Homo sapiens OX=9606 GN=CDK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.07	39.0	2	1	0
PRT	sp|Q9H074-3|PAIP1_HUMAN	Isoform 3 of Polyadenylate-binding protein-interacting protein 1 OS=Homo sapiens OX=9606 GN=PAIP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	110-UNIMOD:4	0.05	39.0	2	1	0
PRT	sp|P43246|MSH2_HUMAN	DNA mismatch repair protein Msh2 OS=Homo sapiens OX=9606 GN=MSH2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	39-UNIMOD:267,55-UNIMOD:267	0.02	39.0	3	1	0
PRT	sp|Q8IZP2|ST134_HUMAN	Putative protein FAM10A4 OS=Homo sapiens OX=9606 GN=ST13P4 PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	205-UNIMOD:4,206-UNIMOD:188	0.08	39.0	5	1	0
PRT	sp|P40938-2|RFC3_HUMAN	Isoform 2 of Replication factor C subunit 3 OS=Homo sapiens OX=9606 GN=RFC3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	32-UNIMOD:4,48-UNIMOD:188,49-UNIMOD:188	0.08	39.0	2	1	0
PRT	sp|Q9BXW7-2|HDHD5_HUMAN	Isoform 1 of Haloacid dehalogenase-like hydrolase domain-containing 5 OS=Homo sapiens OX=9606 GN=HDHD5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	359-UNIMOD:267	0.05	39.0	3	1	0
PRT	sp|Q9H4A4|AMPB_HUMAN	Aminopeptidase B OS=Homo sapiens OX=9606 GN=RNPEP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.03	39.0	1	1	1
PRT	sp|Q96FC7-2|PHIPL_HUMAN	Isoform 2 of Phytanoyl-CoA hydroxylase-interacting protein-like OS=Homo sapiens OX=9606 GN=PHYHIPL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.05	39.0	1	1	1
PRT	sp|P35637|FUS_HUMAN	RNA-binding protein FUS OS=Homo sapiens OX=9606 GN=FUS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	451-UNIMOD:188,472-UNIMOD:267	0.05	39.0	3	1	0
PRT	sp|Q15365|PCBP1_HUMAN	Poly(rC)-binding protein 1 OS=Homo sapiens OX=9606 GN=PCBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	201-UNIMOD:4,237-UNIMOD:188,23-UNIMOD:188,31-UNIMOD:188	0.15	38.0	5	2	1
PRT	sp|Q12872|SFSWA_HUMAN	Splicing factor, suppressor of white-apricot homolog OS=Homo sapiens OX=9606 GN=SFSWAP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.02	38.0	1	1	1
PRT	sp|P54886-2|P5CS_HUMAN	Isoform Short of Delta-1-pyrroline-5-carboxylate synthase OS=Homo sapiens OX=9606 GN=ALDH18A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	765-UNIMOD:188,779-UNIMOD:188,582-UNIMOD:4,528-UNIMOD:188	0.08	38.0	8	3	1
PRT	sp|Q00610-2|CLH1_HUMAN	Isoform 2 of Clathrin heavy chain 1 OS=Homo sapiens OX=9606 GN=CLTC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	912-UNIMOD:267,918-UNIMOD:4,923-UNIMOD:267,227-UNIMOD:188,245-UNIMOD:188	0.02	38.0	5	2	1
PRT	sp|P56537|IF6_HUMAN	Eukaryotic translation initiation factor 6 OS=Homo sapiens OX=9606 GN=EIF6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	85-UNIMOD:267	0.08	38.0	2	1	0
PRT	sp|Q15393|SF3B3_HUMAN	Splicing factor 3B subunit 3 OS=Homo sapiens OX=9606 GN=SF3B3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	787-UNIMOD:188,812-UNIMOD:188	0.04	38.0	6	2	0
PRT	sp|Q8TCJ2|STT3B_HUMAN	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Homo sapiens OX=9606 GN=STT3B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	768-UNIMOD:267	0.02	38.0	4	1	0
PRT	sp|Q9HB07|MYG1_HUMAN	UPF0160 protein MYG1, mitochondrial OS=Homo sapiens OX=9606 GN=C12orf10 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	56-UNIMOD:4,62-UNIMOD:4,66-UNIMOD:267	0.06	38.0	4	1	0
PRT	sp|Q14692|BMS1_HUMAN	Ribosome biogenesis protein BMS1 homolog OS=Homo sapiens OX=9606 GN=BMS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	1206-UNIMOD:188,1221-UNIMOD:188	0.01	38.0	4	1	0
PRT	sp|P00813|ADA_HUMAN	Adenosine deaminase OS=Homo sapiens OX=9606 GN=ADA PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	251-UNIMOD:267	0.05	38.0	4	1	0
PRT	sp|Q92616|GCN1_HUMAN	eIF-2-alpha kinase activator GCN1 OS=Homo sapiens OX=9606 GN=GCN1 PE=1 SV=6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	2247-UNIMOD:188,2255-UNIMOD:4,2258-UNIMOD:188	0.01	38.0	2	1	0
PRT	sp|P00338-4|LDHA_HUMAN	Isoform 4 of L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.06	38.0	1	1	1
PRT	sp|Q02790|FKBP4_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Homo sapiens OX=9606 GN=FKBP4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	359-UNIMOD:267,373-UNIMOD:267	0.03	38.0	4	1	0
PRT	sp|P15104|GLNA_HUMAN	Glutamine synthetase OS=Homo sapiens OX=9606 GN=GLUL PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null	299-UNIMOD:267,319-UNIMOD:267	0.06	38.0	3	1	0
PRT	sp|O00487|PSDE_HUMAN	26S proteasome non-ATPase regulatory subunit 14 OS=Homo sapiens OX=9606 GN=PSMD14 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null	238-UNIMOD:4,239-UNIMOD:188,246-UNIMOD:188	0.08	38.0	2	1	0
PRT	sp|P12268|IMDH2_HUMAN	Inosine-5'-monophosphate dehydrogenase 2 OS=Homo sapiens OX=9606 GN=IMPDH2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.04	38.0	3	2	1
PRT	sp|Q9UGI8|TES_HUMAN	Testin OS=Homo sapiens OX=9606 GN=TES PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	9-UNIMOD:188,22-UNIMOD:4,24-UNIMOD:188	0.04	38.0	2	1	0
PRT	sp|O15143|ARC1B_HUMAN	Actin-related protein 2/3 complex subunit 1B OS=Homo sapiens OX=9606 GN=ARPC1B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null	2-UNIMOD:1,13-UNIMOD:4,49-UNIMOD:188,66-UNIMOD:267	0.12	37.0	4	2	0
PRT	sp|Q15029-2|U5S1_HUMAN	Isoform 2 of 116 kDa U5 small nuclear ribonucleoprotein component OS=Homo sapiens OX=9606 GN=EFTUD2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.04	37.0	3	2	1
PRT	sp|Q9UHD1-2|CHRD1_HUMAN	Isoform 2 of Cysteine and histidine-rich domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CHORDC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	82-UNIMOD:188,88-UNIMOD:188	0.05	37.0	4	1	0
PRT	sp|P0DPI2|GAL3A_HUMAN	Glutamine amidotransferase-like class 1 domain-containing protein 3A, mitochondrial OS=Homo sapiens OX=9606 GN=GATD3A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	221-UNIMOD:4,223-UNIMOD:188,233-UNIMOD:188,176-UNIMOD:4,177-UNIMOD:4	0.14	37.0	4	2	1
PRT	sp|Q8NFH3-2|NUP43_HUMAN	Isoform 2 of Nucleoporin Nup43 OS=Homo sapiens OX=9606 GN=NUP43	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	87-UNIMOD:267	0.06	37.0	1	1	1
PRT	sp|Q14677|EPN4_HUMAN	Clathrin interactor 1 OS=Homo sapiens OX=9606 GN=CLINT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	274-UNIMOD:267	0.06	37.0	5	2	0
PRT	sp|P11413|G6PD_HUMAN	Glucose-6-phosphate 1-dehydrogenase OS=Homo sapiens OX=9606 GN=G6PD PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	136-UNIMOD:267,385-UNIMOD:4,386-UNIMOD:188	0.13	37.0	7	4	3
PRT	sp|Q99536|VAT1_HUMAN	Synaptic vesicle membrane protein VAT-1 homolog OS=Homo sapiens OX=9606 GN=VAT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	67-UNIMOD:267,82-UNIMOD:267	0.05	37.0	3	1	0
PRT	sp|P53618|COPB_HUMAN	Coatomer subunit beta OS=Homo sapiens OX=9606 GN=COPB1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	771-UNIMOD:188,786-UNIMOD:188	0.02	37.0	2	1	0
PRT	sp|P53597|SUCA_HUMAN	Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=SUCLG1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	90-UNIMOD:188,105-UNIMOD:188	0.07	37.0	2	1	0
PRT	sp|Q9UN86-2|G3BP2_HUMAN	Isoform B of Ras GTPase-activating protein-binding protein 2 OS=Homo sapiens OX=9606 GN=G3BP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.06	37.0	1	1	1
PRT	sp|P68363-2|TBA1B_HUMAN	Isoform 2 of Tubulin alpha-1B chain OS=Homo sapiens OX=9606 GN=TUBA1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.18	37.0	4	3	2
PRT	sp|Q8NBN7-2|RDH13_HUMAN	Isoform 2 of Retinol dehydrogenase 13 OS=Homo sapiens OX=9606 GN=RDH13	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.07	37.0	2	1	0
PRT	sp|P62081|RS7_HUMAN	40S ribosomal protein S7 OS=Homo sapiens OX=9606 GN=RPS7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	37.0	null	160-UNIMOD:188,169-UNIMOD:188	0.08	37.0	2	1	0
PRT	sp|P02794|FRIH_HUMAN	Ferritin heavy chain OS=Homo sapiens OX=9606 GN=FTH1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	125-UNIMOD:188,131-UNIMOD:4,144-UNIMOD:188	0.14	37.0	1	1	1
PRT	sp|Q14344-2|GNA13_HUMAN	Isoform 2 of Guanine nucleotide-binding protein subunit alpha-13 OS=Homo sapiens OX=9606 GN=GNA13	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.08	36.0	2	1	0
PRT	sp|P21281|VATB2_HUMAN	V-type proton ATPase subunit B, brain isoform OS=Homo sapiens OX=9606 GN=ATP6V1B2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	207-UNIMOD:4,188-UNIMOD:188,208-UNIMOD:267	0.05	36.0	3	1	0
PRT	sp|Q9BT78-2|CSN4_HUMAN	Isoform 2 of COP9 signalosome complex subunit 4 OS=Homo sapiens OX=9606 GN=COPS4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	232-UNIMOD:4,242-UNIMOD:267	0.05	36.0	2	1	0
PRT	sp|Q8TEM1|PO210_HUMAN	Nuclear pore membrane glycoprotein 210 OS=Homo sapiens OX=9606 GN=NUP210 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	1576-UNIMOD:188	0.01	36.0	3	1	0
PRT	sp|Q99878|H2A1J_HUMAN	Histone H2A type 1-J OS=Homo sapiens OX=9606 GN=H2AC14 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.12	36.0	1	1	1
PRT	sp|Q8IUE6|H2A2B_HUMAN	Histone H2A type 2-B OS=Homo sapiens OX=9606 GN=HIST2H2AB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.12	36.0	1	1	1
PRT	sp|P62937|PPIA_HUMAN	Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	115-UNIMOD:4,118-UNIMOD:188,125-UNIMOD:188,131-UNIMOD:188	0.25	36.0	5	2	0
PRT	sp|Q9H6Y2|WDR55_HUMAN	WD repeat-containing protein 55 OS=Homo sapiens OX=9606 GN=WDR55 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	29-UNIMOD:267,50-UNIMOD:267	0.06	36.0	4	1	0
PRT	sp|P61106|RAB14_HUMAN	Ras-related protein Rab-14 OS=Homo sapiens OX=9606 GN=RAB14 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	40-UNIMOD:4,35-UNIMOD:188,51-UNIMOD:267	0.16	36.0	3	2	1
PRT	sp|Q9UQ80-2|PA2G4_HUMAN	Isoform 2 of Proliferation-associated protein 2G4 OS=Homo sapiens OX=9606 GN=PA2G4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	31-UNIMOD:4,33-UNIMOD:4	0.07	36.0	1	1	0
PRT	sp|Q5H9R7-6|PP6R3_HUMAN	Isoform 6 of Serine/threonine-protein phosphatase 6 regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PPP6R3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	207-UNIMOD:267,216-UNIMOD:4,220-UNIMOD:267	0.03	36.0	1	1	1
PRT	sp|P49589-2|SYCC_HUMAN	Isoform 2 of Cysteine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=CARS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	405-UNIMOD:4,406-UNIMOD:188	0.02	36.0	2	1	0
PRT	sp|P68104|EF1A1_HUMAN	Elongation factor 1-alpha 1 OS=Homo sapiens OX=9606 GN=EEF1A1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	20-UNIMOD:188	0.03	36.0	2	1	0
PRT	sp|P30566-2|PUR8_HUMAN	Isoform 2 of Adenylosuccinate lyase OS=Homo sapiens OX=9606 GN=ADSL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.05	35.0	1	1	1
PRT	sp|P06748-3|NPM_HUMAN	Isoform 3 of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.07	35.0	1	1	1
PRT	sp|Q14166|TTL12_HUMAN	Tubulin--tyrosine ligase-like protein 12 OS=Homo sapiens OX=9606 GN=TTLL12 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	126-UNIMOD:4	0.04	35.0	1	1	1
PRT	sp|Q8NE71-2|ABCF1_HUMAN	Isoform 2 of ATP-binding cassette sub-family F member 1 OS=Homo sapiens OX=9606 GN=ABCF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	703-UNIMOD:4,704-UNIMOD:188	0.02	35.0	2	1	0
PRT	sp|Q9NTZ6|RBM12_HUMAN	RNA-binding protein 12 OS=Homo sapiens OX=9606 GN=RBM12 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	444-UNIMOD:188,451-UNIMOD:188	0.02	35.0	2	1	0
PRT	sp|O75369-7|FLNB_HUMAN	Isoform 7 of Filamin-B OS=Homo sapiens OX=9606 GN=FLNB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	2180-UNIMOD:188,247-UNIMOD:4,250-UNIMOD:188,260-UNIMOD:188,1717-UNIMOD:188,1727-UNIMOD:188	0.03	35.0	4	4	3
PRT	sp|Q15185-3|TEBP_HUMAN	Isoform 3 of Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	58-UNIMOD:4,65-UNIMOD:188	0.14	35.0	4	1	0
PRT	sp|P84085|ARF5_HUMAN	ADP-ribosylation factor 5 OS=Homo sapiens OX=9606 GN=ARF5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	97-UNIMOD:267,99-UNIMOD:267	0.12	35.0	3	1	0
PRT	sp|Q93034|CUL5_HUMAN	Cullin-5 OS=Homo sapiens OX=9606 GN=CUL5 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	66-UNIMOD:188,74-UNIMOD:188	0.02	35.0	2	1	0
PRT	sp|P21333-2|FLNA_HUMAN	Isoform 2 of Filamin-A OS=Homo sapiens OX=9606 GN=FLNA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	2325-UNIMOD:267,2326-UNIMOD:267,664-UNIMOD:267,674-UNIMOD:267	0.03	35.0	3	3	3
PRT	sp|Q08J23-3|NSUN2_HUMAN	Isoform 3 of RNA cytosine C(5)-methyltransferase NSUN2 OS=Homo sapiens OX=9606 GN=NSUN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.03	35.0	1	1	1
PRT	sp|O60568|PLOD3_HUMAN	Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3 OS=Homo sapiens OX=9606 GN=PLOD3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	729-UNIMOD:267	0.02	35.0	2	1	0
PRT	sp|P53621|COPA_HUMAN	Coatomer subunit alpha OS=Homo sapiens OX=9606 GN=COPA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	40-UNIMOD:35,41-UNIMOD:4	0.01	35.0	1	1	1
PRT	sp|O00411|RPOM_HUMAN	DNA-directed RNA polymerase, mitochondrial OS=Homo sapiens OX=9606 GN=POLRMT PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	1	1	1
PRT	sp|P78371-2|TCPB_HUMAN	Isoform 2 of T-complex protein 1 subunit beta OS=Homo sapiens OX=9606 GN=CCT2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	348-UNIMOD:4,355-UNIMOD:188,358-UNIMOD:267	0.04	35.0	3	1	0
PRT	sp|Q9NZ08|ERAP1_HUMAN	Endoplasmic reticulum aminopeptidase 1 OS=Homo sapiens OX=9606 GN=ERAP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	518-UNIMOD:188	0.02	35.0	1	1	1
PRT	sp|Q58FF8|H90B2_HUMAN	Putative heat shock protein HSP 90-beta 2 OS=Homo sapiens OX=9606 GN=HSP90AB2P PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	35.0	null	141-UNIMOD:188,143-UNIMOD:267	0.05	35.0	3	1	0
PRT	sp|P56192|SYMC_HUMAN	Methionine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=MARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	35.0	null	333-UNIMOD:4,726-UNIMOD:188,727-UNIMOD:267	0.04	35.0	4	2	1
PRT	sp|P69905|HBA_HUMAN	Hemoglobin subunit alpha OS=Homo sapiens OX=9606 GN=HBA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null		0.12	35.0	1	1	1
PRT	sp|O75083-3|WDR1_HUMAN	Isoform 2 of WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=WDR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	116-UNIMOD:188,119-UNIMOD:188	0.06	34.0	3	1	0
PRT	sp|Q96EY7|PTCD3_HUMAN	Pentatricopeptide repeat domain-containing protein 3, mitochondrial OS=Homo sapiens OX=9606 GN=PTCD3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	1	1	1
PRT	sp|P26640|SYVC_HUMAN	Valine--tRNA ligase OS=Homo sapiens OX=9606 GN=VARS1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	2	1	0
PRT	sp|Q16629-3|SRSF7_HUMAN	Isoform 3 of Serine/arginine-rich splicing factor 7 OS=Homo sapiens OX=9606 GN=SRSF7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	106-UNIMOD:4,109-UNIMOD:4,119-UNIMOD:4	0.13	34.0	2	1	0
PRT	sp|P09001|RM03_HUMAN	39S ribosomal protein L3, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	127-UNIMOD:4	0.06	34.0	2	1	0
PRT	sp|P12270|TPR_HUMAN	Nucleoprotein TPR OS=Homo sapiens OX=9606 GN=TPR PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.01	34.0	1	1	1
PRT	sp|O15067|PUR4_HUMAN	Phosphoribosylformylglycinamidine synthase OS=Homo sapiens OX=9606 GN=PFAS PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null	318-UNIMOD:4,330-UNIMOD:267	0.03	34.0	4	2	1
PRT	sp|P09429|HMGB1_HUMAN	High mobility group protein B1 OS=Homo sapiens OX=9606 GN=HMGB1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	114-UNIMOD:188,127-UNIMOD:188,30-UNIMOD:188,43-UNIMOD:188	0.14	34.0	6	2	0
PRT	sp|Q9NTJ3|SMC4_HUMAN	Structural maintenance of chromosomes protein 4 OS=Homo sapiens OX=9606 GN=SMC4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null	1017-UNIMOD:188,1031-UNIMOD:188,582-UNIMOD:188,587-UNIMOD:188	0.03	34.0	8	3	1
PRT	sp|P60174-4|TPIS_HUMAN	Isoform 4 of Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	18-UNIMOD:267,31-UNIMOD:188	0.09	34.0	3	1	0
PRT	sp|Q9Y383-3|LC7L2_HUMAN	Isoform 3 of Putative RNA-binding protein Luc7-like 2 OS=Homo sapiens OX=9606 GN=LUC7L2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	40-UNIMOD:4,41-UNIMOD:4,51-UNIMOD:35,56-UNIMOD:4	0.08	34.0	2	2	2
PRT	sp|P68104-2|EF1A1_HUMAN	Isoform 2 of Elongation factor 1-alpha 1 OS=Homo sapiens OX=9606 GN=EEF1A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	20-UNIMOD:188	0.07	34.0	5	2	1
PRT	sp|P24928|RPB1_HUMAN	DNA-directed RNA polymerase II subunit RPB1 OS=Homo sapiens OX=9606 GN=POLR2A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.01	34.0	1	1	1
PRT	sp|P78406|RAE1L_HUMAN	mRNA export factor OS=Homo sapiens OX=9606 GN=RAE1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	252-UNIMOD:188,258-UNIMOD:188	0.05	34.0	3	1	0
PRT	sp|Q9GZV4|IF5A2_HUMAN	Eukaryotic translation initiation factor 5A-2 OS=Homo sapiens OX=9606 GN=EIF5A2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	67-UNIMOD:188,68-UNIMOD:188	0.09	34.0	4	1	0
PRT	sp|O43684-2|BUB3_HUMAN	Isoform 2 of Mitotic checkpoint protein BUB3 OS=Homo sapiens OX=9606 GN=BUB3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	62-UNIMOD:4,80-UNIMOD:188	0.09	34.0	2	1	0
PRT	sp|Q71U36|TBA1A_HUMAN	Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	null	85-UNIMOD:28,96-UNIMOD:188,105-UNIMOD:267	0.05	34.0	2	1	0
PRT	sp|Q9UQ80|PA2G4_HUMAN	Proliferation-associated protein 2G4 OS=Homo sapiens OX=9606 GN=PA2G4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	72-UNIMOD:188,85-UNIMOD:4,87-UNIMOD:4,93-UNIMOD:188	0.06	34.0	1	1	0
PRT	sp|Q13263-2|TIF1B_HUMAN	Isoform 2 of Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	150-UNIMOD:4	0.03	33.0	2	1	0
PRT	sp|O94832|MYO1D_HUMAN	Unconventional myosin-Id OS=Homo sapiens OX=9606 GN=MYO1D PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	1	1	1
PRT	sp|P17480-2|UBF1_HUMAN	Isoform UBF2 of Nucleolar transcription factor 1 OS=Homo sapiens OX=9606 GN=UBTF	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	1	1	1
PRT	sp|Q8IVT2|MISP_HUMAN	Mitotic interactor and substrate of PLK1 OS=Homo sapiens OX=9606 GN=MISP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	87-UNIMOD:267,96-UNIMOD:267	0.03	33.0	2	1	0
PRT	sp|P07858|CATB_HUMAN	Cathepsin B OS=Homo sapiens OX=9606 GN=CTSB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	319-UNIMOD:4,314-UNIMOD:267,331-UNIMOD:267	0.06	33.0	2	1	0
PRT	sp|Q15428|SF3A2_HUMAN	Splicing factor 3A subunit 2 OS=Homo sapiens OX=9606 GN=SF3A2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	59-UNIMOD:4	0.05	33.0	2	1	0
PRT	sp|O14908|GIPC1_HUMAN	PDZ domain-containing protein GIPC1 OS=Homo sapiens OX=9606 GN=GIPC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	72-UNIMOD:267	0.05	33.0	3	1	0
PRT	sp|Q9H3K6|BOLA2_HUMAN	BolA-like protein 2 OS=Homo sapiens OX=9606 GN=BOLA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	59-UNIMOD:4,73-UNIMOD:188	0.23	33.0	2	1	0
PRT	sp|Q9UMS4|PRP19_HUMAN	Pre-mRNA-processing factor 19 OS=Homo sapiens OX=9606 GN=PRPF19 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	114-UNIMOD:4	0.05	33.0	1	1	1
PRT	sp|P09651-3|ROA1_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	175-UNIMOD:4	0.11	33.0	3	2	1
PRT	sp|P22626-2|ROA2_HUMAN	Isoform A2 of Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	173-UNIMOD:267	0.09	33.0	4	2	0
PRT	sp|Q9BWE0|REPI1_HUMAN	Replication initiator 1 OS=Homo sapiens OX=9606 GN=REPIN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	1	1	1
PRT	sp|Q9NZL4|HPBP1_HUMAN	Hsp70-binding protein 1 OS=Homo sapiens OX=9606 GN=HSPBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	265-UNIMOD:188	0.05	33.0	2	1	0
PRT	sp|Q00688|FKBP3_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP3 OS=Homo sapiens OX=9606 GN=FKBP3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	56-UNIMOD:188,70-UNIMOD:188	0.08	33.0	4	1	0
PRT	sp|Q9P0M9|RM27_HUMAN	39S ribosomal protein L27, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL27 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	137-UNIMOD:188,143-UNIMOD:188	0.11	33.0	3	1	0
PRT	sp|Q14247-3|SRC8_HUMAN	Isoform 3 of Src substrate cortactin OS=Homo sapiens OX=9606 GN=CTTN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	57-UNIMOD:188	0.03	33.0	2	1	0
PRT	sp|P55039|DRG2_HUMAN	Developmentally-regulated GTP-binding protein 2 OS=Homo sapiens OX=9606 GN=DRG2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	363-UNIMOD:188,364-UNIMOD:188	0.05	33.0	1	1	1
PRT	sp|Q13423|NNTM_HUMAN	NAD(P) transhydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=NNT PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	2	1	0
PRT	sp|Q9H074|PAIP1_HUMAN	Polyadenylate-binding protein-interacting protein 1 OS=Homo sapiens OX=9606 GN=PAIP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	222-UNIMOD:4,239-UNIMOD:267	0.04	33.0	1	1	0
PRT	sp|P14678-2|RSMB_HUMAN	Isoform SM-B of Small nuclear ribonucleoprotein-associated proteins B and B' OS=Homo sapiens OX=9606 GN=SNRPB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	43-UNIMOD:4,45-UNIMOD:4	0.08	32.0	1	1	1
PRT	sp|Q9BWD1|THIC_HUMAN	Acetyl-CoA acetyltransferase, cytosolic OS=Homo sapiens OX=9606 GN=ACAT2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	1	1	1
PRT	sp|P00387-2|NB5R3_HUMAN	Isoform 2 of NADH-cytochrome b5 reductase 3 OS=Homo sapiens OX=9606 GN=CYB5R3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	181-UNIMOD:4	0.08	32.0	1	1	1
PRT	sp|Q14571|ITPR2_HUMAN	Inositol 1,4,5-trisphosphate receptor type 2 OS=Homo sapiens OX=9606 GN=ITPR2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.01	32.0	2	1	0
PRT	sp|P09960-3|LKHA4_HUMAN	Isoform 3 of Leukotriene A-4 hydrolase OS=Homo sapiens OX=9606 GN=LTA4H	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	112-UNIMOD:4,117-UNIMOD:4,118-UNIMOD:267	0.03	32.0	2	1	0
PRT	sp|O60869-2|EDF1_HUMAN	Isoform 2 of Endothelial differentiation-related factor 1 OS=Homo sapiens OX=9606 GN=EDF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.12	32.0	1	1	1
PRT	sp|Q8WXA9-2|SREK1_HUMAN	Isoform 2 of Splicing regulatory glutamine/lysine-rich protein 1 OS=Homo sapiens OX=9606 GN=SREK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	70-UNIMOD:267,89-UNIMOD:267	0.04	32.0	3	1	0
PRT	sp|P61313-2|RL15_HUMAN	Isoform 2 of 60S ribosomal protein L15 OS=Homo sapiens OX=9606 GN=RPL15	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	83-UNIMOD:188,93-UNIMOD:188	0.12	32.0	2	1	0
PRT	sp|Q9Y570-2|PPME1_HUMAN	Isoform 2 of Protein phosphatase methylesterase 1 OS=Homo sapiens OX=9606 GN=PPME1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	194-UNIMOD:4,199-UNIMOD:4	0.09	32.0	1	1	1
PRT	sp|P62136-3|PP1A_HUMAN	Isoform 3 of Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Homo sapiens OX=9606 GN=PPP1CA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	127-UNIMOD:4,128-UNIMOD:4,143-UNIMOD:267,144-UNIMOD:267	0.07	32.0	3	1	0
PRT	sp|P14618-3|KPYM_HUMAN	Isoform 3 of Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|P46776|RL27A_HUMAN	60S ribosomal protein L27a OS=Homo sapiens OX=9606 GN=RPL27A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	47-UNIMOD:188,55-UNIMOD:188	0.09	32.0	2	1	0
PRT	sp|Q9BUF5|TBB6_HUMAN	Tubulin beta-6 chain OS=Homo sapiens OX=9606 GN=TUBB6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	122-UNIMOD:188,124-UNIMOD:4,127-UNIMOD:4,129-UNIMOD:4,154-UNIMOD:188,1-UNIMOD:35,2-UNIMOD:267,12-UNIMOD:4,19-UNIMOD:188	0.12	32.0	2	2	2
PRT	sp|Q14690|RRP5_HUMAN	Protein RRP5 homolog OS=Homo sapiens OX=9606 GN=PDCD11 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	924-UNIMOD:188,937-UNIMOD:188	0.01	32.0	2	1	0
PRT	sp|P38919|IF4A3_HUMAN	Eukaryotic initiation factor 4A-III OS=Homo sapiens OX=9606 GN=EIF4A3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	1	1	1
PRT	sp|Q969G9|NKD1_HUMAN	Protein naked cuticle homolog 1 OS=Homo sapiens OX=9606 GN=NKD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null	244-UNIMOD:4,248-UNIMOD:4	0.08	32.0	3	2	1
PRT	sp|Q15149-7|PLEC_HUMAN	Isoform 7 of Plectin OS=Homo sapiens OX=9606 GN=PLEC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	2563-UNIMOD:267,2574-UNIMOD:267,906-UNIMOD:267,796-UNIMOD:4,3126-UNIMOD:4	0.02	32.0	8	6	4
PRT	sp|Q9UBQ7|GRHPR_HUMAN	Glyoxylate reductase/hydroxypyruvate reductase OS=Homo sapiens OX=9606 GN=GRHPR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	288-UNIMOD:4,300-UNIMOD:267	0.05	32.0	2	1	0
PRT	sp|P58557|YBEY_HUMAN	Endoribonuclease YbeY OS=Homo sapiens OX=9606 GN=YBEY PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	73-UNIMOD:188	0.10	32.0	2	1	0
PRT	sp|P33991|MCM4_HUMAN	DNA replication licensing factor MCM4 OS=Homo sapiens OX=9606 GN=MCM4 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	2	1	0
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null	2413-UNIMOD:267,2421-UNIMOD:267,825-UNIMOD:267,1255-UNIMOD:267,1275-UNIMOD:267	0.04	32.0	8	5	3
PRT	sp|P43155-2|CACP_HUMAN	Isoform 2 of Carnitine O-acetyltransferase OS=Homo sapiens OX=9606 GN=CRAT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	294-UNIMOD:267	0.02	32.0	2	1	0
PRT	sp|P30740|ILEU_HUMAN	Leukocyte elastase inhibitor OS=Homo sapiens OX=9606 GN=SERPINB1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	69-UNIMOD:267	0.04	32.0	4	1	0
PRT	sp|P43405-2|KSYK_HUMAN	Isoform Short of Tyrosine-protein kinase SYK OS=Homo sapiens OX=9606 GN=SYK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	89-UNIMOD:4,101-UNIMOD:4,273-UNIMOD:267,290-UNIMOD:267	0.09	32.0	2	2	2
PRT	sp|P04080|CYTB_HUMAN	Cystatin-B OS=Homo sapiens OX=9606 GN=CSTB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	68-UNIMOD:267	0.13	32.0	4	1	0
PRT	sp|Q9Y5K3-2|PCY1B_HUMAN	Isoform 1 of Choline-phosphate cytidylyltransferase B OS=Homo sapiens OX=9606 GN=PCYT1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	94-UNIMOD:267	0.05	32.0	2	1	0
PRT	sp|P51991-2|ROA3_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens OX=9606 GN=HNRNPA3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	174-UNIMOD:4	0.04	32.0	1	1	0
PRT	sp|P05023-2|AT1A1_HUMAN	Isoform 2 of Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens OX=9606 GN=ATP1A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	494-UNIMOD:188,508-UNIMOD:188	0.03	32.0	1	1	1
PRT	sp|Q8N1G4|LRC47_HUMAN	Leucine-rich repeat-containing protein 47 OS=Homo sapiens OX=9606 GN=LRRC47 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	32.0	null	83-UNIMOD:267	0.07	32.0	2	2	2
PRT	sp|P11216|PYGB_HUMAN	Glycogen phosphorylase, brain form OS=Homo sapiens OX=9606 GN=PYGB PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	32.0	null	446-UNIMOD:4,458-UNIMOD:267	0.02	32.0	2	1	0
PRT	sp|Q9HCD5|NCOA5_HUMAN	Nuclear receptor coactivator 5 OS=Homo sapiens OX=9606 GN=NCOA5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	1	1	1
PRT	sp|Q92499-3|DDX1_HUMAN	Isoform 3 of ATP-dependent RNA helicase DDX1 OS=Homo sapiens OX=9606 GN=DDX1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	414-UNIMOD:4,416-UNIMOD:4,421-UNIMOD:267	0.02	31.0	2	1	0
PRT	sp|Q9ULC4-2|MCTS1_HUMAN	Isoform 2 of Malignant T-cell-amplified sequence 1 OS=Homo sapiens OX=9606 GN=MCTS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	166-UNIMOD:188,165-UNIMOD:35	0.11	31.0	4	1	0
PRT	sp|Q9HCK8-2|CHD8_HUMAN	Isoform 2 of Chromodomain-helicase-DNA-binding protein 8 OS=Homo sapiens OX=9606 GN=CHD8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.01	31.0	1	1	1
PRT	sp|P26358-3|DNMT1_HUMAN	Isoform 3 of DNA (cytosine-5)-methyltransferase 1 OS=Homo sapiens OX=9606 GN=DNMT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	84-UNIMOD:4,93-UNIMOD:188	0.01	31.0	2	1	0
PRT	sp|P17844|DDX5_HUMAN	Probable ATP-dependent RNA helicase DDX5 OS=Homo sapiens OX=9606 GN=DDX5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	67-UNIMOD:267,68-UNIMOD:267	0.05	31.0	2	2	2
PRT	sp|Q8TDD1|DDX54_HUMAN	ATP-dependent RNA helicase DDX54 OS=Homo sapiens OX=9606 GN=DDX54 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|O43143|DHX15_HUMAN	Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 OS=Homo sapiens OX=9606 GN=DHX15 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|O60341|KDM1A_HUMAN	Lysine-specific histone demethylase 1A OS=Homo sapiens OX=9606 GN=KDM1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	568-UNIMOD:267	0.02	31.0	1	1	1
PRT	sp|Q7KZF4|SND1_HUMAN	Staphylococcal nuclease domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SND1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	769-UNIMOD:267,776-UNIMOD:267	0.04	31.0	4	2	1
PRT	sp|Q16851-2|UGPA_HUMAN	Isoform 2 of UTP--glucose-1-phosphate uridylyltransferase OS=Homo sapiens OX=9606 GN=UGP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	41-UNIMOD:188,42-UNIMOD:188	0.03	31.0	2	1	0
PRT	sp|O14802|RPC1_HUMAN	DNA-directed RNA polymerase III subunit RPC1 OS=Homo sapiens OX=9606 GN=POLR3A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.01	31.0	1	1	1
PRT	sp|O43390-4|HNRPR_HUMAN	Isoform 4 of Heterogeneous nuclear ribonucleoprotein R OS=Homo sapiens OX=9606 GN=HNRNPR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	2	1	0
PRT	sp|Q9Y224|RTRAF_HUMAN	RNA transcription, translation and transport factor protein OS=Homo sapiens OX=9606 GN=RTRAF PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.06	31.0	1	1	1
PRT	sp|Q9Y653-5|AGRG1_HUMAN	Isoform 5 of Adhesion G-protein coupled receptor G1 OS=Homo sapiens OX=9606 GN=ADGRG1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.06	31.0	2	2	2
PRT	sp|P30085-2|KCY_HUMAN	Isoform 2 of UMP-CMP kinase OS=Homo sapiens OX=9606 GN=CMPK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	1-UNIMOD:35,2-UNIMOD:188,16-UNIMOD:188	0.12	31.0	1	1	1
PRT	sp|P04406-2|G3P_HUMAN	Isoform 2 of Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	88-UNIMOD:35	0.08	31.0	2	1	0
PRT	sp|Q96HE7|ERO1A_HUMAN	ERO1-like protein alpha OS=Homo sapiens OX=9606 GN=ERO1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.04	31.0	1	1	1
PRT	sp|O43660-2|PLRG1_HUMAN	Isoform 2 of Pleiotropic regulator 1 OS=Homo sapiens OX=9606 GN=PLRG1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.07	31.0	2	2	2
PRT	sp|Q15046|SYK_HUMAN	Lysine--tRNA ligase OS=Homo sapiens OX=9606 GN=KARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.04	31.0	1	1	1
PRT	sp|P51991|ROA3_HUMAN	Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens OX=9606 GN=HNRNPA3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	null	196-UNIMOD:4,199-UNIMOD:188,200-UNIMOD:188	0.04	31.0	2	1	0
PRT	sp|Q8N766|EMC1_HUMAN	ER membrane protein complex subunit 1 OS=Homo sapiens OX=9606 GN=EMC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	875-UNIMOD:188	0.02	31.0	3	1	0
PRT	sp|O15321|TM9S1_HUMAN	Transmembrane 9 superfamily member 1 OS=Homo sapiens OX=9606 GN=TM9SF1 PE=2 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	75-UNIMOD:188,87-UNIMOD:267	0.02	31.0	1	1	1
PRT	sp|P62906|RL10A_HUMAN	60S ribosomal protein L10a OS=Homo sapiens OX=9606 GN=RPL10A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	133-UNIMOD:188,147-UNIMOD:188	0.08	30.0	2	1	0
PRT	sp|P35580|MYH10_HUMAN	Myosin-10 OS=Homo sapiens OX=9606 GN=MYH10 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|Q9UL46|PSME2_HUMAN	Proteasome activator complex subunit 2 OS=Homo sapiens OX=9606 GN=PSME2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.07	30.0	2	1	0
PRT	sp|P35637-2|FUS_HUMAN	Isoform Short of RNA-binding protein FUS OS=Homo sapiens OX=9606 GN=FUS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	463-UNIMOD:35	0.05	30.0	1	1	0
PRT	sp|Q9NTI5-3|PDS5B_HUMAN	Isoform 3 of Sister chromatid cohesion protein PDS5 homolog B OS=Homo sapiens OX=9606 GN=PDS5B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	340-UNIMOD:4,349-UNIMOD:188	0.03	30.0	2	1	0
PRT	sp|Q7Z2K6|ERMP1_HUMAN	Endoplasmic reticulum metallopeptidase 1 OS=Homo sapiens OX=9606 GN=ERMP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	104-UNIMOD:267,113-UNIMOD:267	0.02	30.0	4	1	0
PRT	sp|Q9P253|VPS18_HUMAN	Vacuolar protein sorting-associated protein 18 homolog OS=Homo sapiens OX=9606 GN=VPS18 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	675-UNIMOD:267,692-UNIMOD:267	0.02	30.0	3	1	0
PRT	sp|P35579-2|MYH9_HUMAN	Isoform 2 of Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|Q8N766-4|EMC1_HUMAN	Isoform 4 of ER membrane protein complex subunit 1 OS=Homo sapiens OX=9606 GN=EMC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	1	1	0
PRT	sp|Q71UI9-3|H2AV_HUMAN	Isoform 3 of Histone H2A.V OS=Homo sapiens OX=9606 GN=H2AFV	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	78-UNIMOD:188	0.36	30.0	3	2	1
PRT	sp|Q15758-3|AAAT_HUMAN	Isoform 3 of Neutral amino acid transporter B(0) OS=Homo sapiens OX=9606 GN=SLC1A5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.05	30.0	1	1	1
PRT	sp|Q09666|AHNK_HUMAN	Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	2589-UNIMOD:188,2592-UNIMOD:188,5407-UNIMOD:188,5425-UNIMOD:188	0.03	30.0	3	3	3
PRT	sp|Q8TC12-2|RDH11_HUMAN	Isoform 2 of Retinol dehydrogenase 11 OS=Homo sapiens OX=9606 GN=RDH11	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	171-UNIMOD:267	0.05	30.0	1	1	1
PRT	sp|Q16891-3|MIC60_HUMAN	Isoform 3 of MICOS complex subunit MIC60 OS=Homo sapiens OX=9606 GN=IMMT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	533-UNIMOD:188,545-UNIMOD:188	0.02	30.0	2	1	0
PRT	sp|Q8IYB8|SUV3_HUMAN	ATP-dependent RNA helicase SUPV3L1, mitochondrial OS=Homo sapiens OX=9606 GN=SUPV3L1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	2	1	0
PRT	sp|P29144|TPP2_HUMAN	Tripeptidyl-peptidase 2 OS=Homo sapiens OX=9606 GN=TPP2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	893-UNIMOD:267,902-UNIMOD:267	0.01	30.0	3	1	0
PRT	sp|P35998-2|PRS7_HUMAN	Isoform 2 of 26S proteasome regulatory subunit 7 OS=Homo sapiens OX=9606 GN=PSMC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	51-UNIMOD:267,63-UNIMOD:267	0.05	30.0	3	1	0
PRT	sp|O95861-3|BPNT1_HUMAN	Isoform 3 of 3'(2'),5'-bisphosphate nucleotidase 1 OS=Homo sapiens OX=9606 GN=BPNT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.07	30.0	1	1	1
PRT	sp|Q14566|MCM6_HUMAN	DNA replication licensing factor MCM6 OS=Homo sapiens OX=9606 GN=MCM6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	796-UNIMOD:188	0.02	30.0	3	1	0
PRT	sp|Q14974-2|IMB1_HUMAN	Isoform 2 of Importin subunit beta-1 OS=Homo sapiens OX=9606 GN=KPNB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	695-UNIMOD:267,706-UNIMOD:267	0.02	30.0	2	1	0
PRT	sp|Q10713-2|MPPA_HUMAN	Isoform 2 of Mitochondrial-processing peptidase subunit alpha OS=Homo sapiens OX=9606 GN=PMPCA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	120-UNIMOD:35,135-UNIMOD:4,137-UNIMOD:267	0.05	30.0	2	1	0
PRT	sp|P46459-2|NSF_HUMAN	Isoform 2 of Vesicle-fusing ATPase OS=Homo sapiens OX=9606 GN=NSF	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	1	1	1
PRT	sp|Q53HC9|EIPR1_HUMAN	EARP and GARP complex-interacting protein 1 OS=Homo sapiens OX=9606 GN=EIPR1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	77-UNIMOD:267	0.05	30.0	2	1	0
PRT	sp|Q99460-2|PSMD1_HUMAN	Isoform 2 of 26S proteasome non-ATPase regulatory subunit 1 OS=Homo sapiens OX=9606 GN=PSMD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	601-UNIMOD:267,615-UNIMOD:267	0.02	30.0	1	1	1
PRT	sp|P18206-2|VINC_HUMAN	Isoform 1 of Vinculin OS=Homo sapiens OX=9606 GN=VCL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	832-UNIMOD:267,853-UNIMOD:267	0.02	30.0	4	1	0
PRT	sp|P52209-2|6PGD_HUMAN	Isoform 2 of 6-phosphogluconate dehydrogenase, decarboxylating OS=Homo sapiens OX=9606 GN=PGD	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	134-UNIMOD:188,141-UNIMOD:188	0.04	30.0	2	1	0
PRT	sp|Q9Y2R9|RT07_HUMAN	28S ribosomal protein S7, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	30.0	null		0.17	30.0	2	2	2
PRT	sp|P18669|PGAM1_HUMAN	Phosphoglycerate mutase 1 OS=Homo sapiens OX=9606 GN=PGAM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	30.0	null		0.09	30.0	5	1	0
PRT	sp|P49750|YLPM1_HUMAN	YLP motif-containing protein 1 OS=Homo sapiens OX=9606 GN=YLPM1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	null	382-UNIMOD:28,397-UNIMOD:267	0.01	30.0	2	1	0
PRT	sp|P07814|SYEP_HUMAN	Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens OX=9606 GN=EPRS1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	1	1	1
PRT	sp|Q07157-2|ZO1_HUMAN	Isoform Short of Tight junction protein ZO-1 OS=Homo sapiens OX=9606 GN=TJP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	1076-UNIMOD:267,1090-UNIMOD:267	0.01	29.0	1	1	1
PRT	sp|P12956-2|XRCC6_HUMAN	Isoform 2 of X-ray repair cross-complementing protein 6 OS=Homo sapiens OX=9606 GN=XRCC6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	433-UNIMOD:267,447-UNIMOD:267	0.03	29.0	4	1	0
PRT	sp|O95573|ACSL3_HUMAN	Long-chain-fatty-acid--CoA ligase 3 OS=Homo sapiens OX=9606 GN=ACSL3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	240-UNIMOD:188,249-UNIMOD:188	0.03	29.0	1	1	1
PRT	sp|Q13177|PAK2_HUMAN	Serine/threonine-protein kinase PAK 2 OS=Homo sapiens OX=9606 GN=PAK2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	52-UNIMOD:188,62-UNIMOD:188	0.02	29.0	2	1	0
PRT	sp|P55263-3|ADK_HUMAN	Isoform 3 of Adenosine kinase OS=Homo sapiens OX=9606 GN=ADK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	171-UNIMOD:188,178-UNIMOD:188	0.05	29.0	1	1	1
PRT	sp|Q96A22|CK052_HUMAN	Uncharacterized protein C11orf52 OS=Homo sapiens OX=9606 GN=C11orf52 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.12	29.0	1	1	1
PRT	sp|Q92945|FUBP2_HUMAN	Far upstream element-binding protein 2 OS=Homo sapiens OX=9606 GN=KHSRP PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	1	1	1
PRT	sp|Q06203|PUR1_HUMAN	Amidophosphoribosyltransferase OS=Homo sapiens OX=9606 GN=PPAT PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	1	1	1
PRT	sp|Q9NQC3-2|RTN4_HUMAN	Isoform B of Reticulon-4 OS=Homo sapiens OX=9606 GN=RTN4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	79-UNIMOD:35	0.09	29.0	2	1	0
PRT	sp|Q13813-2|SPTN1_HUMAN	Isoform 2 of Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	871-UNIMOD:188,876-UNIMOD:188,1066-UNIMOD:35,1067-UNIMOD:188,1082-UNIMOD:188,2230-UNIMOD:267	0.02	29.0	6	3	1
PRT	sp|O75165|DJC13_HUMAN	DnaJ homolog subfamily C member 13 OS=Homo sapiens OX=9606 GN=DNAJC13 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	1	1	1
PRT	sp|Q9NYU2-2|UGGG1_HUMAN	Isoform 2 of UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	1	1	1
PRT	sp|P48163|MAOX_HUMAN	NADP-dependent malic enzyme OS=Homo sapiens OX=9606 GN=ME1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	1	1	1
PRT	sp|O43707|ACTN4_HUMAN	Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null	643-UNIMOD:188,633-UNIMOD:267	0.01	29.0	4	1	0
PRT	sp|O15371-2|EIF3D_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit D OS=Homo sapiens OX=9606 GN=EIF3D	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	2	1	0
PRT	sp|P78347-2|GTF2I_HUMAN	Isoform 2 of General transcription factor II-I OS=Homo sapiens OX=9606 GN=GTF2I	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	499-UNIMOD:267,514-UNIMOD:267	0.02	29.0	2	1	0
PRT	sp|O00231|PSD11_HUMAN	26S proteasome non-ATPase regulatory subunit 11 OS=Homo sapiens OX=9606 GN=PSMD11 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	142-UNIMOD:267,155-UNIMOD:267	0.04	29.0	4	1	0
PRT	sp|O14776-2|TCRG1_HUMAN	Isoform 2 of Transcription elongation regulator 1 OS=Homo sapiens OX=9606 GN=TCERG1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|Q9P021|CRIPT_HUMAN	Cysteine-rich PDZ-binding protein OS=Homo sapiens OX=9606 GN=CRIPT PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	73-UNIMOD:4,76-UNIMOD:4,79-UNIMOD:188,80-UNIMOD:188	0.19	29.0	1	1	1
PRT	sp|O43242|PSMD3_HUMAN	26S proteasome non-ATPase regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PSMD3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	241-UNIMOD:267,256-UNIMOD:267	0.08	29.0	2	2	2
PRT	sp|P09622-2|DLDH_HUMAN	Isoform 2 of Dihydrolipoyl dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=DLD	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	385-UNIMOD:4,396-UNIMOD:267	0.03	29.0	2	1	0
PRT	sp|Q5EBL8|PDZ11_HUMAN	PDZ domain-containing protein 11 OS=Homo sapiens OX=9606 GN=PDZD11 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.12	29.0	1	1	1
PRT	sp|Q16576|RBBP7_HUMAN	Histone-binding protein RBBP7 OS=Homo sapiens OX=9606 GN=RBBP7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	97-UNIMOD:4,101-UNIMOD:188,113-UNIMOD:188,166-UNIMOD:4	0.12	29.0	2	2	2
PRT	sp|Q9UIG0-2|BAZ1B_HUMAN	Isoform 2 of Tyrosine-protein kinase BAZ1B OS=Homo sapiens OX=9606 GN=BAZ1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	1032-UNIMOD:267	0.01	29.0	1	1	1
PRT	sp|P53041|PPP5_HUMAN	Serine/threonine-protein phosphatase 5 OS=Homo sapiens OX=9606 GN=PPP5C PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	29.0	null	430-UNIMOD:188,441-UNIMOD:267	0.03	29.0	3	1	0
PRT	sp|Q8N2F6|ARM10_HUMAN	Armadillo repeat-containing protein 10 OS=Homo sapiens OX=9606 GN=ARMC10 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	333-UNIMOD:188,335-UNIMOD:188	0.04	29.0	1	1	1
PRT	sp|Q9UBE0|SAE1_HUMAN	SUMO-activating enzyme subunit 1 OS=Homo sapiens OX=9606 GN=SAE1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.06	28.0	1	1	1
PRT	sp|Q16836|HCDH_HUMAN	Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=HADH PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.05	28.0	1	1	1
PRT	sp|Q9UG63|ABCF2_HUMAN	ATP-binding cassette sub-family F member 2 OS=Homo sapiens OX=9606 GN=ABCF2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	339-UNIMOD:188	0.02	28.0	2	1	0
PRT	sp|P42345|MTOR_HUMAN	Serine/threonine-protein kinase mTOR OS=Homo sapiens OX=9606 GN=MTOR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|P10619-2|PPGB_HUMAN	Isoform 2 of Lysosomal protective protein OS=Homo sapiens OX=9606 GN=CTSA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.05	28.0	2	1	0
PRT	sp|P62244|RS15A_HUMAN	40S ribosomal protein S15a OS=Homo sapiens OX=9606 GN=RPS15A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	57-UNIMOD:267	0.12	28.0	1	1	1
PRT	sp|Q9Y5P6|GMPPB_HUMAN	Mannose-1-phosphate guanyltransferase beta OS=Homo sapiens OX=9606 GN=GMPPB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	137-UNIMOD:188	0.04	28.0	2	1	0
PRT	sp|Q8WVM8-2|SCFD1_HUMAN	Isoform 2 of Sec1 family domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SCFD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.04	28.0	1	1	1
PRT	sp|Q9BV38|WDR18_HUMAN	WD repeat-containing protein 18 OS=Homo sapiens OX=9606 GN=WDR18 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|P16435|NCPR_HUMAN	NADPH--cytochrome P450 reductase OS=Homo sapiens OX=9606 GN=POR PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	311-UNIMOD:188	0.02	28.0	1	1	1
PRT	sp|O00267-2|SPT5H_HUMAN	Isoform 2 of Transcription elongation factor SPT5 OS=Homo sapiens OX=9606 GN=SUPT5H	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|Q96T60-2|PNKP_HUMAN	Isoform 2 of Bifunctional polynucleotide phosphatase/kinase OS=Homo sapiens OX=9606 GN=PNKP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|O14617-3|AP3D1_HUMAN	Isoform 3 of AP-3 complex subunit delta-1 OS=Homo sapiens OX=9606 GN=AP3D1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	2	1	0
PRT	sp|P05198|IF2A_HUMAN	Eukaryotic translation initiation factor 2 subunit 1 OS=Homo sapiens OX=9606 GN=EIF2S1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.07	28.0	1	1	1
PRT	sp|Q9Y6I4|UBP3_HUMAN	Ubiquitin carboxyl-terminal hydrolase 3 OS=Homo sapiens OX=9606 GN=USP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|Q96FJ2|DYL2_HUMAN	Dynein light chain 2, cytoplasmic OS=Homo sapiens OX=9606 GN=DYNLL2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	56-UNIMOD:4	0.15	28.0	1	1	1
PRT	sp|Q03252|LMNB2_HUMAN	Lamin-B2 OS=Homo sapiens OX=9606 GN=LMNB2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	256-UNIMOD:35	0.03	28.0	2	1	0
PRT	sp|P06744|G6PI_HUMAN	Glucose-6-phosphate isomerase OS=Homo sapiens OX=9606 GN=GPI PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	401-UNIMOD:35,404-UNIMOD:4	0.03	28.0	2	1	0
PRT	sp|O75607|NPM3_HUMAN	Nucleoplasmin-3 OS=Homo sapiens OX=9606 GN=NPM3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	102-UNIMOD:188	0.09	28.0	1	1	1
PRT	sp|Q14738-3|2A5D_HUMAN	Isoform Delta-3 of Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform OS=Homo sapiens OX=9606 GN=PPP2R5D	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	40-UNIMOD:267,54-UNIMOD:267	0.03	28.0	2	1	0
PRT	sp|P31040-2|SDHA_HUMAN	Isoform 2 of Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Homo sapiens OX=9606 GN=SDHA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	159-UNIMOD:267	0.02	28.0	2	1	0
PRT	sp|Q9Y6Y8-2|S23IP_HUMAN	Isoform 2 of SEC23-interacting protein OS=Homo sapiens OX=9606 GN=SEC23IP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	515-UNIMOD:267	0.02	28.0	1	1	1
PRT	sp|P51151|RAB9A_HUMAN	Ras-related protein Rab-9A OS=Homo sapiens OX=9606 GN=RAB9A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	178-UNIMOD:267,192-UNIMOD:267	0.11	28.0	2	1	0
PRT	sp|Q9Y230|RUVB2_HUMAN	RuvB-like 2 OS=Homo sapiens OX=9606 GN=RUVBL2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null		0.04	28.0	1	1	0
PRT	sp|P63241|IF5A1_HUMAN	Eukaryotic translation initiation factor 5A-1 OS=Homo sapiens OX=9606 GN=EIF5A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null		0.09	28.0	1	1	0
PRT	sp|P31689|DNJA1_HUMAN	DnaJ homolog subfamily A member 1 OS=Homo sapiens OX=9606 GN=DNAJA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null		0.04	28.0	2	1	0
PRT	sp|O95757|HS74L_HUMAN	Heat shock 70 kDa protein 4L OS=Homo sapiens OX=9606 GN=HSPA4L PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	28.0	null	540-UNIMOD:4	0.02	28.0	2	1	0
PRT	sp|Q9H0U6|RM18_HUMAN	39S ribosomal protein L18, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL18 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	100-UNIMOD:188	0.09	28.0	1	1	1
PRT	sp|P07355|ANXA2_HUMAN	Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	49-UNIMOD:188,63-UNIMOD:267	0.05	28.0	2	1	0
PRT	sp|P22392|NDKB_HUMAN	Nucleoside diphosphate kinase B OS=Homo sapiens OX=9606 GN=NME2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	49-UNIMOD:188,56-UNIMOD:188	0.10	27.0	2	1	0
PRT	sp|Q9Y676|RT18B_HUMAN	28S ribosomal protein S18b, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS18B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.06	27.0	1	1	1
PRT	sp|P46926|GNPI1_HUMAN	Glucosamine-6-phosphate isomerase 1 OS=Homo sapiens OX=9606 GN=GNPDA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.06	27.0	1	1	1
PRT	sp|Q14134-2|TRI29_HUMAN	Isoform Beta of Tripartite motif-containing protein 29 OS=Homo sapiens OX=9606 GN=TRIM29	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	218-UNIMOD:267,223-UNIMOD:267	0.03	27.0	1	1	1
PRT	sp|Q14192-2|FHL2_HUMAN	Isoform 2 of Four and a half LIM domains protein 2 OS=Homo sapiens OX=9606 GN=FHL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	7-UNIMOD:4,10-UNIMOD:4,17-UNIMOD:188	0.09	27.0	1	1	1
PRT	sp|P56556|NDUA6_HUMAN	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 OS=Homo sapiens OX=9606 GN=NDUFA6 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.09	27.0	1	1	1
PRT	sp|P49711-2|CTCF_HUMAN	Isoform 2 of Transcriptional repressor CTCF OS=Homo sapiens OX=9606 GN=CTCF	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	111-UNIMOD:4,114-UNIMOD:4,120-UNIMOD:267	0.03	27.0	1	1	1
PRT	sp|Q07352|TISB_HUMAN	mRNA decay activator protein ZFP36L1 OS=Homo sapiens OX=9606 GN=ZFP36L1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	72-UNIMOD:188,82-UNIMOD:267	0.07	27.0	1	1	1
PRT	sp|P49748-2|ACADV_HUMAN	Isoform 2 of Very long-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ACADVL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	276-UNIMOD:188,277-UNIMOD:188	0.02	27.0	2	1	0
PRT	sp|P62917|RL8_HUMAN	60S ribosomal protein L8 OS=Homo sapiens OX=9606 GN=RPL8 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.05	27.0	1	1	1
PRT	sp|Q9BRR8|GPTC1_HUMAN	G patch domain-containing protein 1 OS=Homo sapiens OX=9606 GN=GPATCH1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	264-UNIMOD:267	0.03	27.0	1	1	1
PRT	sp|Q7Z3C6-3|ATG9A_HUMAN	Isoform 3 of Autophagy-related protein 9A OS=Homo sapiens OX=9606 GN=ATG9A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	353-UNIMOD:267	0.02	27.0	2	1	0
PRT	sp|Q5JPE7-3|NOMO2_HUMAN	Isoform 3 of Nodal modulator 2 OS=Homo sapiens OX=9606 GN=NOMO2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|O75153|CLU_HUMAN	Clustered mitochondria protein homolog OS=Homo sapiens OX=9606 GN=CLUH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	953-UNIMOD:188,969-UNIMOD:188	0.01	27.0	2	1	0
PRT	sp|P62701|RS4X_HUMAN	40S ribosomal protein S4, X isoform OS=Homo sapiens OX=9606 GN=RPS4X PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	211-UNIMOD:188	0.05	27.0	4	1	0
PRT	sp|P51553-2|IDH3G_HUMAN	Isoform 2 of Isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial OS=Homo sapiens OX=9606 GN=IDH3G	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	74-UNIMOD:188	0.06	27.0	1	1	1
PRT	sp|Q9Y617-2|SERC_HUMAN	Isoform 2 of Phosphoserine aminotransferase OS=Homo sapiens OX=9606 GN=PSAT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	117-UNIMOD:188,127-UNIMOD:188	0.04	27.0	2	1	0
PRT	sp|P62266|RS23_HUMAN	40S ribosomal protein S23 OS=Homo sapiens OX=9606 GN=RPS23 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.09	27.0	1	1	1
PRT	sp|P46777|RL5_HUMAN	60S ribosomal protein L5 OS=Homo sapiens OX=9606 GN=RPL5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.05	27.0	1	1	1
PRT	sp|Q6NXS1|IPP2B_HUMAN	Protein phosphatase inhibitor 2 family member B OS=Homo sapiens OX=9606 GN=PPP1R2B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	145-UNIMOD:188,155-UNIMOD:188	0.06	27.0	2	1	0
PRT	sp|O60506-5|HNRPQ_HUMAN	Isoform 5 of Heterogeneous nuclear ribonucleoprotein Q OS=Homo sapiens OX=9606 GN=SYNCRIP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|Q12800-2|TFCP2_HUMAN	Isoform 2 of Alpha-globin transcription factor CP2 OS=Homo sapiens OX=9606 GN=TFCP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|Q92747|ARC1A_HUMAN	Actin-related protein 2/3 complex subunit 1A OS=Homo sapiens OX=9606 GN=ARPC1A PE=2 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.05	27.0	1	1	1
PRT	sp|Q9Y6B6|SAR1B_HUMAN	GTP-binding protein SAR1b OS=Homo sapiens OX=9606 GN=SAR1B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.06	27.0	1	1	1
PRT	sp|Q9HC38-3|GLOD4_HUMAN	Isoform 3 of Glyoxalase domain-containing protein 4 OS=Homo sapiens OX=9606 GN=GLOD4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	41-UNIMOD:4	0.07	27.0	1	1	1
PRT	sp|Q16891|MIC60_HUMAN	MICOS complex subunit MIC60 OS=Homo sapiens OX=9606 GN=IMMT PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	565-UNIMOD:188,577-UNIMOD:188	0.02	27.0	1	1	0
PRT	sp|P62195|PRS8_HUMAN	26S proteasome regulatory subunit 8 OS=Homo sapiens OX=9606 GN=PSMC5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.06	27.0	1	1	0
PRT	sp|Q9UI12|VATH_HUMAN	V-type proton ATPase subunit H OS=Homo sapiens OX=9606 GN=ATP6V1H PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	null	435-UNIMOD:28,449-UNIMOD:267	0.03	27.0	1	1	1
PRT	sp|Q9NVI7-3|ATD3A_HUMAN	Isoform 3 of ATPase family AAA domain-containing protein 3A OS=Homo sapiens OX=9606 GN=ATAD3A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|P78417|GSTO1_HUMAN	Glutathione S-transferase omega-1 OS=Homo sapiens OX=9606 GN=GSTO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	48-UNIMOD:267,57-UNIMOD:188	0.05	27.0	1	1	0
PRT	sp|O15234|CASC3_HUMAN	Protein CASC3 OS=Homo sapiens OX=9606 GN=CASC3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	327-UNIMOD:267,338-UNIMOD:267	0.02	26.0	2	1	0
PRT	sp|Q99447-2|PCY2_HUMAN	Isoform 2 of Ethanolamine-phosphate cytidylyltransferase OS=Homo sapiens OX=9606 GN=PCYT2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.07	26.0	1	1	1
PRT	sp|Q92572|AP3S1_HUMAN	AP-3 complex subunit sigma-1 OS=Homo sapiens OX=9606 GN=AP3S1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.07	26.0	1	1	1
PRT	sp|P04066|FUCO_HUMAN	Tissue alpha-L-fucosidase OS=Homo sapiens OX=9606 GN=FUCA1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	162-UNIMOD:267,173-UNIMOD:267	0.04	26.0	1	1	1
PRT	sp|P07384|CAN1_HUMAN	Calpain-1 catalytic subunit OS=Homo sapiens OX=9606 GN=CAPN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|P30876|RPB2_HUMAN	DNA-directed RNA polymerase II subunit RPB2 OS=Homo sapiens OX=9606 GN=POLR2B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|Q6RFH5-2|WDR74_HUMAN	Isoform 2 of WD repeat-containing protein 74 OS=Homo sapiens OX=9606 GN=WDR74	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	277-UNIMOD:4,287-UNIMOD:4	0.05	26.0	1	1	1
PRT	sp|Q9BYD1|RM13_HUMAN	39S ribosomal protein L13, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL13 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	71-UNIMOD:188,75-UNIMOD:188	0.07	26.0	2	1	0
PRT	sp|Q00534|CDK6_HUMAN	Cyclin-dependent kinase 6 OS=Homo sapiens OX=9606 GN=CDK6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.04	26.0	2	1	0
PRT	sp|Q96FX7|TRM61_HUMAN	tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRMT61A OS=Homo sapiens OX=9606 GN=TRMT61A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.05	26.0	1	1	1
PRT	sp|P31689-2|DNJA1_HUMAN	Isoform 2 of DnaJ homolog subfamily A member 1 OS=Homo sapiens OX=9606 GN=DNAJA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	177-UNIMOD:4,180-UNIMOD:4,186-UNIMOD:267	0.08	26.0	2	1	0
PRT	sp|Q99426-2|TBCB_HUMAN	Isoform 2 of Tubulin-folding cofactor B OS=Homo sapiens OX=9606 GN=TBCB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.06	26.0	1	1	1
PRT	sp|O00461|GOLI4_HUMAN	Golgi integral membrane protein 4 OS=Homo sapiens OX=9606 GN=GOLIM4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q92878-3|RAD50_HUMAN	Isoform 3 of DNA repair protein RAD50 OS=Homo sapiens OX=9606 GN=RAD50	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|P18621-2|RL17_HUMAN	Isoform 2 of 60S ribosomal protein L17 OS=Homo sapiens OX=9606 GN=RPL17	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	48-UNIMOD:188,58-UNIMOD:188	0.08	26.0	1	1	1
PRT	sp|Q6L8Q7-2|PDE12_HUMAN	Isoform 2 of 2',5'-phosphodiesterase 12 OS=Homo sapiens OX=9606 GN=PDE12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	250-UNIMOD:4	0.02	26.0	1	1	1
PRT	sp|P0DJD0|RGPD1_HUMAN	RANBP2-like and GRIP domain-containing protein 1 OS=Homo sapiens OX=9606 GN=RGPD1 PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|P05787|K2C8_HUMAN	Keratin, type II cytoskeletal 8 OS=Homo sapiens OX=9606 GN=KRT8 PE=1 SV=7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	264-UNIMOD:188	0.05	26.0	2	2	2
PRT	sp|Q6UX04-2|CWC27_HUMAN	Isoform 2 of Spliceosome-associated protein CWC27 homolog OS=Homo sapiens OX=9606 GN=CWC27	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.05	26.0	1	1	1
PRT	sp|Q9NZ01-2|TECR_HUMAN	Isoform 2 of Very-long-chain enoyl-CoA reductase OS=Homo sapiens OX=9606 GN=TECR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	1-UNIMOD:35	0.08	26.0	2	1	0
PRT	sp|O43278-2|SPIT1_HUMAN	Isoform 2 of Kunitz-type protease inhibitor 1 OS=Homo sapiens OX=9606 GN=SPINT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	311-UNIMOD:267,315-UNIMOD:4,319-UNIMOD:4,325-UNIMOD:267	0.03	26.0	2	1	0
PRT	sp|O75431-2|MTX2_HUMAN	Isoform 2 of Metaxin-2 OS=Homo sapiens OX=9606 GN=MTX2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	238-UNIMOD:267,247-UNIMOD:267	0.04	26.0	1	1	1
PRT	sp|Q99717|SMAD5_HUMAN	Mothers against decapentaplegic homolog 5 OS=Homo sapiens OX=9606 GN=SMAD5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q9UNX4|WDR3_HUMAN	WD repeat-containing protein 3 OS=Homo sapiens OX=9606 GN=WDR3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	379-UNIMOD:188	0.01	26.0	1	1	1
PRT	sp|Q13427|PPIG_HUMAN	Peptidyl-prolyl cis-trans isomerase G OS=Homo sapiens OX=9606 GN=PPIG PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	726-UNIMOD:188,736-UNIMOD:188	0.02	26.0	1	1	1
PRT	sp|Q53GS9|SNUT2_HUMAN	U4/U6.U5 tri-snRNP-associated protein 2 OS=Homo sapiens OX=9606 GN=USP39 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	103-UNIMOD:267,105-UNIMOD:4,113-UNIMOD:267	0.02	26.0	1	1	1
PRT	sp|P07355-2|ANXA2_HUMAN	Isoform 2 of Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	67-UNIMOD:188,81-UNIMOD:267	0.05	26.0	3	2	0
PRT	sp|P08559-3|ODPA_HUMAN	Isoform 3 of Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial OS=Homo sapiens OX=9606 GN=PDHA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.04	26.0	1	1	1
PRT	sp|P55010|IF5_HUMAN	Eukaryotic translation initiation factor 5 OS=Homo sapiens OX=9606 GN=EIF5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	320-UNIMOD:4,332-UNIMOD:188	0.05	26.0	1	1	1
PRT	sp|P49458-2|SRP09_HUMAN	Isoform 2 of Signal recognition particle 9 kDa protein OS=Homo sapiens OX=9606 GN=SRP9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	39-UNIMOD:4	0.15	26.0	1	1	1
PRT	sp|Q5SSJ5|HP1B3_HUMAN	Heterochromatin protein 1-binding protein 3 OS=Homo sapiens OX=9606 GN=HP1BP3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	385-UNIMOD:188,386-UNIMOD:188	0.04	26.0	1	1	1
PRT	sp|Q15149|PLEC_HUMAN	Plectin OS=Homo sapiens OX=9606 GN=PLEC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.00	26.0	1	1	0
PRT	sp|P22314|UBA1_HUMAN	Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	null	724-UNIMOD:28	0.02	26.0	1	1	1
PRT	sp|Q9HCU5|PREB_HUMAN	Prolactin regulatory element-binding protein OS=Homo sapiens OX=9606 GN=PREB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.05	26.0	1	1	1
PRT	sp|P08514|ITA2B_HUMAN	Integrin alpha-IIb OS=Homo sapiens OX=9606 GN=ITGA2B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q9UJX2-2|CDC23_HUMAN	Isoform 2 of Cell division cycle protein 23 homolog OS=Homo sapiens OX=9606 GN=CDC23	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	109-UNIMOD:4	0.08	25.0	1	1	1
PRT	sp|Q9Y490|TLN1_HUMAN	Talin-1 OS=Homo sapiens OX=9606 GN=TLN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	1625-UNIMOD:267,1638-UNIMOD:267	0.01	25.0	1	1	1
PRT	sp|Q9Y2G1-2|MYRF_HUMAN	Isoform 2 of Myelin regulatory factor OS=Homo sapiens OX=9606 GN=MYRF	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|P23246-2|SFPQ_HUMAN	Isoform Short of Splicing factor, proline- and glutamine-rich OS=Homo sapiens OX=9606 GN=SFPQ	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	2	1	0
PRT	sp|Q9UNX3|RL26L_HUMAN	60S ribosomal protein L26-like 1 OS=Homo sapiens OX=9606 GN=RPL26L1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.12	25.0	1	1	1
PRT	sp|Q9Y4L1-2|HYOU1_HUMAN	Isoform 2 of Hypoxia up-regulated protein 1 OS=Homo sapiens OX=9606 GN=HYOU1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	376-UNIMOD:188,379-UNIMOD:188	0.03	25.0	1	1	1
PRT	sp|P62195-2|PRS8_HUMAN	Isoform 2 of 26S proteasome regulatory subunit 8 OS=Homo sapiens OX=9606 GN=PSMC5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	162-UNIMOD:188,176-UNIMOD:188	0.06	25.0	1	1	0
PRT	sp|P78417-2|GSTO1_HUMAN	Isoform 2 of Glutathione S-transferase omega-1 OS=Homo sapiens OX=9606 GN=GSTO1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.06	25.0	1	1	0
PRT	sp|O60488-2|ACSL4_HUMAN	Isoform Short of Long-chain-fatty-acid--CoA ligase 4 OS=Homo sapiens OX=9606 GN=ACSL4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	262-UNIMOD:4	0.03	25.0	1	1	1
PRT	sp|Q8TAQ2-2|SMRC2_HUMAN	Isoform 2 of SWI/SNF complex subunit SMARCC2 OS=Homo sapiens OX=9606 GN=SMARCC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|Q14839|CHD4_HUMAN	Chromodomain-helicase-DNA-binding protein 4 OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|Q12931-2|TRAP1_HUMAN	Isoform 2 of Heat shock protein 75 kDa, mitochondrial OS=Homo sapiens OX=9606 GN=TRAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.04	25.0	1	1	1
PRT	sp|Q9BUJ2-4|HNRL1_HUMAN	Isoform 4 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 OS=Homo sapiens OX=9606 GN=HNRNPUL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|P40939|ECHA_HUMAN	Trifunctional enzyme subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=HADHA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|P49736|MCM2_HUMAN	DNA replication licensing factor MCM2 OS=Homo sapiens OX=9606 GN=MCM2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	783-UNIMOD:267,793-UNIMOD:35,796-UNIMOD:267	0.02	25.0	1	1	1
PRT	sp|P42765|THIM_HUMAN	3-ketoacyl-CoA thiolase, mitochondrial OS=Homo sapiens OX=9606 GN=ACAA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q9Y2L1-2|RRP44_HUMAN	Isoform 2 of Exosome complex exonuclease RRP44 OS=Homo sapiens OX=9606 GN=DIS3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	660-UNIMOD:188,674-UNIMOD:188	0.02	25.0	3	1	0
PRT	sp|P62333|PRS10_HUMAN	26S proteasome regulatory subunit 10B OS=Homo sapiens OX=9606 GN=PSMC6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q13838|DX39B_HUMAN	Spliceosome RNA helicase DDX39B OS=Homo sapiens OX=9606 GN=DDX39B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	165-UNIMOD:4	0.03	25.0	1	1	1
PRT	sp|Q92925-3|SMRD2_HUMAN	Isoform 3 of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2 OS=Homo sapiens OX=9606 GN=SMARCD2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.05	25.0	1	1	0
PRT	sp|P14314-2|GLU2B_HUMAN	Isoform 2 of Glucosidase 2 subunit beta OS=Homo sapiens OX=9606 GN=PRKCSH	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.05	25.0	2	1	0
PRT	sp|P08708|RS17_HUMAN	40S ribosomal protein S17 OS=Homo sapiens OX=9606 GN=RPS17 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.08	25.0	1	1	1
PRT	sp|Q9Y520-2|PRC2C_HUMAN	Isoform 2 of Protein PRRC2C OS=Homo sapiens OX=9606 GN=PRRC2C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|Q15785|TOM34_HUMAN	Mitochondrial import receptor subunit TOM34 OS=Homo sapiens OX=9606 GN=TOMM34 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.05	25.0	1	1	1
PRT	sp|P53396|ACLY_HUMAN	ATP-citrate synthase OS=Homo sapiens OX=9606 GN=ACLY PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	58-UNIMOD:188,64-UNIMOD:188	0.02	25.0	2	1	0
PRT	sp|Q6P2Q9|PRP8_HUMAN	Pre-mRNA-processing-splicing factor 8 OS=Homo sapiens OX=9606 GN=PRPF8 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.00	25.0	1	1	1
PRT	sp|P41227-2|NAA10_HUMAN	Isoform 2 of N-alpha-acetyltransferase 10 OS=Homo sapiens OX=9606 GN=NAA10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	60-UNIMOD:35	0.10	25.0	1	1	1
PRT	sp|O15027-2|SC16A_HUMAN	Isoform 2 of Protein transport protein Sec16A OS=Homo sapiens OX=9606 GN=SEC16A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|P55884|EIF3B_HUMAN	Eukaryotic translation initiation factor 3 subunit B OS=Homo sapiens OX=9606 GN=EIF3B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	515-UNIMOD:4	0.02	25.0	1	1	1
PRT	sp|P15559-3|NQO1_HUMAN	Isoform 3 of NAD(P)H dehydrogenase [quinone] 1 OS=Homo sapiens OX=9606 GN=NQO1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.05	25.0	1	1	1
PRT	sp|Q13085-3|ACACA_HUMAN	Isoform 3 of Acetyl-CoA carboxylase 1 OS=Homo sapiens OX=9606 GN=ACACA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|P52597|HNRPF_HUMAN	Heterogeneous nuclear ribonucleoprotein F OS=Homo sapiens OX=9606 GN=HNRNPF PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.05	25.0	1	1	1
PRT	sp|O75306-2|NDUS2_HUMAN	Isoform 2 of NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFS2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|O00443|P3C2A_HUMAN	Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha OS=Homo sapiens OX=9606 GN=PIK3C2A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	475-UNIMOD:4,486-UNIMOD:4,496-UNIMOD:4,497-UNIMOD:267	0.01	25.0	1	1	1
PRT	sp|P35606-2|COPB2_HUMAN	Isoform 2 of Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|Q13131|AAPK1_HUMAN	5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Homo sapiens OX=9606 GN=PRKAA1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.04	25.0	1	1	1
PRT	sp|Q96FW1|OTUB1_HUMAN	Ubiquitin thioesterase OTUB1 OS=Homo sapiens OX=9606 GN=OTUB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.06	25.0	1	1	1
PRT	sp|P60953-1|CDC42_HUMAN	Isoform 1 of Cell division control protein 42 homolog OS=Homo sapiens OX=9606 GN=CDC42	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	105-UNIMOD:4,107-UNIMOD:188	0.06	25.0	1	1	1
PRT	sp|P04181|OAT_HUMAN	Ornithine aminotransferase, mitochondrial OS=Homo sapiens OX=9606 GN=OAT PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.04	25.0	1	1	1
PRT	sp|P09622|DLDH_HUMAN	Dihydrolipoyl dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=DLD PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|P27824|CALX_HUMAN	Calnexin OS=Homo sapiens OX=9606 GN=CANX PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	25.0	null	194-UNIMOD:4,199-UNIMOD:188,205-UNIMOD:267,194-UNIMOD:385	0.02	25.0	2	1	0
PRT	sp|Q8NBN7|RDH13_HUMAN	Retinol dehydrogenase 13 OS=Homo sapiens OX=9606 GN=RDH13 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	217-UNIMOD:267,234-UNIMOD:267	0.06	25.0	1	1	0
PRT	sp|Q92925|SMRD2_HUMAN	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2 OS=Homo sapiens OX=9606 GN=SMARCD2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.05	25.0	1	1	0
PRT	sp|Q06830|PRDX1_HUMAN	Peroxiredoxin-1 OS=Homo sapiens OX=9606 GN=PRDX1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	null	93-UNIMOD:188	0.08	25.0	2	1	0
PRT	sp|Q01518|CAP1_HUMAN	Adenylyl cyclase-associated protein 1 OS=Homo sapiens OX=9606 GN=CAP1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.04	25.0	1	1	1
PRT	sp|P49356|FNTB_HUMAN	Protein farnesyltransferase subunit beta OS=Homo sapiens OX=9606 GN=FNTB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.04	25.0	1	1	1
PRT	sp|Q14980-4|NUMA1_HUMAN	Isoform 4 of Nuclear mitotic apparatus protein 1 OS=Homo sapiens OX=9606 GN=NUMA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q92530|PSMF1_HUMAN	Proteasome inhibitor PI31 subunit OS=Homo sapiens OX=9606 GN=PSMF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	231-UNIMOD:267,242-UNIMOD:267	0.09	24.0	1	1	1
PRT	sp|Q9HAV7|GRPE1_HUMAN	GrpE protein homolog 1, mitochondrial OS=Homo sapiens OX=9606 GN=GRPEL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	186-UNIMOD:188,196-UNIMOD:188	0.13	24.0	2	1	0
PRT	sp|Q13451-2|FKBP5_HUMAN	Isoform 2 of Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Homo sapiens OX=9606 GN=FKBP5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.07	24.0	1	1	1
PRT	sp|P52701-2|MSH6_HUMAN	Isoform GTBP-alt of DNA mismatch repair protein Msh6 OS=Homo sapiens OX=9606 GN=MSH6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|O43824|GTPB6_HUMAN	Putative GTP-binding protein 6 OS=Homo sapiens OX=9606 GN=GTPBP6 PE=2 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q13057|COASY_HUMAN	Bifunctional coenzyme A synthase OS=Homo sapiens OX=9606 GN=COASY PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|P39748-2|FEN1_HUMAN	Isoform FENMIT of Flap endonuclease 1 OS=Homo sapiens OX=9606 GN=FEN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q9UPN4-3|CP131_HUMAN	Isoform 3 of Centrosomal protein of 131 kDa OS=Homo sapiens OX=9606 GN=CEP131	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q9NR45|SIAS_HUMAN	Sialic acid synthase OS=Homo sapiens OX=9606 GN=NANS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	96-UNIMOD:267	0.03	24.0	1	1	1
PRT	sp|P08670|VIME_HUMAN	Vimentin OS=Homo sapiens OX=9606 GN=VIM PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q12874|SF3A3_HUMAN	Splicing factor 3A subunit 3 OS=Homo sapiens OX=9606 GN=SF3A3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	24.0	null	347-UNIMOD:267	0.02	24.0	2	1	0
PRT	sp|Q9NR12-5|PDLI7_HUMAN	Isoform 5 of PDZ and LIM domain protein 7 OS=Homo sapiens OX=9606 GN=PDLIM7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	188-UNIMOD:188,189-UNIMOD:188	0.12	24.0	1	1	1
PRT	sp|P07954-2|FUMH_HUMAN	Isoform Cytoplasmic of Fumarate hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=FH	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	140-UNIMOD:188	0.03	24.0	2	1	0
PRT	sp|P26038|MOES_HUMAN	Moesin OS=Homo sapiens OX=9606 GN=MSN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	180-UNIMOD:267	0.02	24.0	2	1	0
PRT	sp|Q8TEQ6|GEMI5_HUMAN	Gem-associated protein 5 OS=Homo sapiens OX=9606 GN=GEMIN5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	654-UNIMOD:267	0.01	24.0	1	1	1
PRT	sp|P63279|UBC9_HUMAN	SUMO-conjugating enzyme UBC9 OS=Homo sapiens OX=9606 GN=UBE2I PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.09	24.0	1	1	1
PRT	sp|P0DMV8-2|HS71A_HUMAN	Isoform 2 of Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|P15374|UCHL3_HUMAN	Ubiquitin carboxyl-terminal hydrolase isozyme L3 OS=Homo sapiens OX=9606 GN=UCHL3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	111-UNIMOD:35	0.05	24.0	1	1	1
PRT	sp|P29350-2|PTN6_HUMAN	Isoform 3 of Tyrosine-protein phosphatase non-receptor type 6 OS=Homo sapiens OX=9606 GN=PTPN6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	414-UNIMOD:4	0.04	24.0	1	1	1
PRT	sp|Q7Z4I7-4|LIMS2_HUMAN	Isoform 4 of LIM and senescent cell antigen-like-containing domain protein 2 OS=Homo sapiens OX=9606 GN=LIMS2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	72-UNIMOD:4,74-UNIMOD:188	0.06	24.0	1	1	1
PRT	sp|Q99959-2|PKP2_HUMAN	Isoform 1 of Plakophilin-2 OS=Homo sapiens OX=9606 GN=PKP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q08499-7|PDE4D_HUMAN	Isoform N3 of cAMP-specific 3',5'-cyclic phosphodiesterase 4D OS=Homo sapiens OX=9606 GN=PDE4D	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	88-UNIMOD:4	0.09	24.0	1	1	1
PRT	sp|Q96SY0-4|INT14_HUMAN	Isoform 4 of Integrator complex subunit 14 OS=Homo sapiens OX=9606 GN=INTS14	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|P08133|ANXA6_HUMAN	Annexin A6 OS=Homo sapiens OX=9606 GN=ANXA6 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	498-UNIMOD:267,499-UNIMOD:267	0.03	24.0	1	1	1
PRT	sp|Q92900-2|RENT1_HUMAN	Isoform 2 of Regulator of nonsense transcripts 1 OS=Homo sapiens OX=9606 GN=UPF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q96DG6|CMBL_HUMAN	Carboxymethylenebutenolidase homolog OS=Homo sapiens OX=9606 GN=CMBL PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.05	24.0	1	1	1
PRT	sp|Q14562|DHX8_HUMAN	ATP-dependent RNA helicase DHX8 OS=Homo sapiens OX=9606 GN=DHX8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	702-UNIMOD:188,703-UNIMOD:188	0.01	24.0	1	1	1
PRT	sp|Q5SW79-2|CE170_HUMAN	Isoform 2 of Centrosomal protein of 170 kDa OS=Homo sapiens OX=9606 GN=CEP170	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|P15880|RS2_HUMAN	40S ribosomal protein S2 OS=Homo sapiens OX=9606 GN=RPS2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	182-UNIMOD:4	0.04	24.0	1	1	1
PRT	sp|P48147|PPCE_HUMAN	Prolyl endopeptidase OS=Homo sapiens OX=9606 GN=PREP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	343-UNIMOD:4	0.03	24.0	1	1	1
PRT	sp|P54136|SYRC_HUMAN	Arginine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=RARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	570-UNIMOD:188,573-UNIMOD:188	0.02	24.0	1	1	1
PRT	sp|O75821|EIF3G_HUMAN	Eukaryotic translation initiation factor 3 subunit G OS=Homo sapiens OX=9606 GN=EIF3G PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	160-UNIMOD:4,161-UNIMOD:188,168-UNIMOD:267	0.03	24.0	1	1	1
PRT	sp|P00739|HPTR_HUMAN	Haptoglobin-related protein OS=Homo sapiens OX=9606 GN=HPR PE=2 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.06	24.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	QRHELLLGAGSGPGAGQQQATPGALLQAGPPR	1	sp|Q96DI7|SNR40_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	53.0	1-UNIMOD:28,2-UNIMOD:267,32-UNIMOD:267	ms_run[1]:scan=8391	55.442073333333326	3	3135.6453	3135.6435	R	C	20	52
PSM	QRHELLLGAGSGPGAGQQQATPGALLQAGPPR	2	sp|Q96DI7|SNR40_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	49.0	1-UNIMOD:28	ms_run[1]:scan=8363	55.258358333333334	3	3115.6312	3115.6270	R	C	20	52
PSM	HGVYNPNKIFGVTTLDIVR	3	sp|P40926|MDHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0		ms_run[2]:scan=9118	60.363	2	2142.1586	2142.1586	K	A	158	177
PSM	MREIVHIQAGQCGNQIGAK	4	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45.0	1-UNIMOD:35,12-UNIMOD:4	ms_run[1]:scan=3850	26.199603333333332	2	2125.050680	2125.052077	-	F	1	20
PSM	GPHLVQSDGTVPFWAHAGNAIPSSDQIR	5	sp|P49257|LMAN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	28-UNIMOD:267	ms_run[2]:scan=8723	57.641	3	2966.4663	2966.4663	K	V	54	82
PSM	HKITSADGHIESSALLK	6	sp|Q8N573-6|OXR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	2-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=3822	26.037	2	1818.0038	1818.0038	K	E	21	38
PSM	HTGFLEISQHSQEFINR	7	sp|Q7L0Y3|TM10C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=6824	45.057	2	2041.997	2041.9970	K	L	381	398
PSM	KGTVLLADNVICPGAPDFLAHVR	8	sp|P21964-2|COMT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	12-UNIMOD:4	ms_run[2]:scan=9949	65.969	3	2462.3104	2462.3104	R	G	162	185
PSM	KNGGLGHMNIALLSDLTK	9	sp|P30048-2|PRDX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	1-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=9344	61.869	2	1893.0545	1893.0545	R	Q	131	149
PSM	FQGIKHECQANGPEDLNR	10	sp|P60981-2|DEST_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	8-UNIMOD:4	ms_run[2]:scan=3393	23.394	2	2111.9807	2111.9807	K	A	111	129
PSM	IRGTSYQSPHGIPIDLLDR	11	sp|Q9Y230-2|RUVB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	2-UNIMOD:267,19-UNIMOD:267	ms_run[2]:scan=7901	52.237	2	2157.1445	2157.1445	R	L	290	309
PSM	KEVVHTVSLHEIDVINSR	12	sp|Q9Y230-2|RUVB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=6008	39.742	2	2074.1171	2074.1171	R	T	191	209
PSM	KGADSLEDFLYHEGYACTSIHGDR	13	sp|O00571-2|DDX3X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	17-UNIMOD:4	ms_run[2]:scan=8806	58.188	3	2740.2187	2740.2187	K	S	436	460
PSM	MREIVHLQAGQCGNQIGAK	14	sp|P68371|TBB4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	12-UNIMOD:4	ms_run[2]:scan=4649	31.202	2	2109.0572	2109.0572	-	F	1	20
PSM	AHLLADMAHISGLVAAK	15	sp|P34897-3|GLYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	17-UNIMOD:188	ms_run[2]:scan=8786	58.048	2	1722.9546	1722.9546	K	V	225	242
PSM	IGDLQAFQGHGAGNLAGLKGR	16	sp|P08195-2|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=6670	44.084	2	2079.0974	2079.0974	R	L	126	147
PSM	KNGGLGHMNIALLSDLTK	17	sp|P30048-2|PRDX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=9343	61.863	2	1881.0142	1881.0142	R	Q	131	149
PSM	MLEIDPQKVNINGGAVSLGHPIGMSGAR	18	sp|P24752|THIL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:35	ms_run[2]:scan=8429	55.694	3	2876.4637	2876.4637	K	I	366	394
PSM	SAVADKHELLSLASSNHLGK	19	sp|O15372|EIF3H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	6-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=5906	39.097	2	2088.1366	2088.1366	K	N	222	242
PSM	YVATLGVEVHPLVFHTNR	20	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=8093	53.495	2	2051.0952	2051.0952	K	G	39	57
PSM	GQHVTGSPFQFTVGPLGEGGAHK	21	sp|O75369|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	23-UNIMOD:188	ms_run[1]:scan=8000	52.879535	2	2313.168329	2313.159758	R	V	2173	2196
PSM	AAQLVDKDSTFLSTLEHHLSR	22	sp|Q969V3-2|NCLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=9632	63.835	3	2367.2183	2367.2183	R	Y	464	485
PSM	HLEINPDHSIIETLR	23	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	15-UNIMOD:267	ms_run[2]:scan=7161	47.215	2	1795.9456	1795.9456	K	Q	633	648
PSM	HTGFLEISQHSQEFINR	24	sp|Q7L0Y3|TM10C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	17-UNIMOD:267	ms_run[2]:scan=6823	45.051	2	2052.0053	2052.0053	K	L	381	398
PSM	HWILPQDYDHAQAEAR	25	sp|Q15293-2|RCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	16-UNIMOD:267	ms_run[2]:scan=5926	39.221	2	1958.9263	1958.9263	R	H	220	236
PSM	NMSVIAHVDHGKSTLTDSLVCK	26	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	21-UNIMOD:4	ms_run[2]:scan=6081	40.2	2	2411.1937	2411.1937	R	A	21	43
PSM	RGDQLLSVNGVSVEGEHHEK	27	sp|Q9NUP9|LIN7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=4790	32.087	3	2189.0825	2189.0825	K	A	136	156
PSM	SGHFEQAIKEGEDMIAEEHFGSEK	28	sp|Q01082-3|SPTB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	9-UNIMOD:188,24-UNIMOD:188	ms_run[2]:scan=9635	63.853	3	2716.2478	2716.2478	R	I	678	702
PSM	TLKGHTDSVQDISFDHSGK	29	sp|P43034|LIS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=3787	25.824	2	2083.0373	2083.0373	R	L	145	164
PSM	HILEDSCAELGESKEHMESR	30	sp|Q6IQ49-3|SDE2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	7-UNIMOD:4	ms_run[2]:scan=4549	30.572	2	2356.0424	2356.0424	R	M	197	217
PSM	HLEINPDHSIIETLR	31	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=7164	47.23	2	1785.9373	1785.9373	K	Q	633	648
PSM	HSSYTCICGSGENSAVLHYGHAGAPNDR	32	sp|P12955-3|PEPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:4,8-UNIMOD:4,28-UNIMOD:267	ms_run[2]:scan=4842	32.413	3	3026.3023	3026.3023	R	T	174	202
PSM	HWILPQDYDHAQAEAR	33	sp|Q15293-2|RCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=5935	39.279	2	1948.918	1948.9180	R	H	220	236
PSM	IRGTSYQSPHGIPIDLLDR	34	sp|Q9Y230-2|RUVB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=7887	52.149	2	2137.128	2137.1280	R	L	290	309
PSM	IVGCSVHKGFAFVQYVNER	35	sp|P07910-4|HNRPC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	4-UNIMOD:4	ms_run[2]:scan=7109	46.897	2	2209.1102	2209.1102	K	N	43	62
PSM	MHTTFEHDIQALGTQVR	36	sp|Q01082-3|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:35,17-UNIMOD:267	ms_run[2]:scan=6787	44.826	2	2008.9664	2008.9664	R	Q	1832	1849
PSM	MHTTFEHDIQALGTQVR	37	sp|Q01082-3|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:35	ms_run[2]:scan=6789	44.838	2	1998.9582	1998.9582	R	Q	1832	1849
PSM	RECPSDECGAGVFMASHFDR	38	sp|P62979|RS27A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:267,3-UNIMOD:4,8-UNIMOD:4,20-UNIMOD:267	ms_run[2]:scan=6471	42.712	3	2346.9683	2346.9683	R	H	119	139
PSM	RPLDDGVGNQLGALVHQR	39	sp|Q96I24|FUBP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=7005	46.226	2	1944.029	1944.0290	K	T	58	76
PSM	RVLMAQHFDEVWNSEACNK	40	sp|P46063|RECQ1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	17-UNIMOD:4	ms_run[2]:scan=7092	46.788	2	2333.0681	2333.0681	R	M	455	474
PSM	KGTVLLADNVICPGAPDFLAHVR	41	sp|P21964|COMT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	12-UNIMOD:4	ms_run[1]:scan=9958	66.029395	2	2463.310843	2462.310400	R	G	212	235
PSM	HIADLAGNSEVILPVPAFNVINGGSHAGNK	42	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0		ms_run[1]:scan=10400	69.407855	3	3010.551928	3010.562468	R	L	133	163
PSM	ALEHAFQLEHIMDLTR	43	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=9595	63.582	2	1922.9673	1922.9673	K	L	2436	2452
PSM	CVHIWNTQTGALVHSYR	44	sp|Q9BZK7|TBL1R_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=6315	41.667	2	2051.0035	2051.0035	K	G	465	482
PSM	GNPSSSVEDHIEYHGHR	45	sp|Q8WUJ3|CEMIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=3234	22.385	2	1919.8511	1919.8511	K	G	276	293
PSM	GPLPLSSQHRGDADQASNILASFGLSAR	46	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=10504	70.185	3	2864.4529	2864.4529	R	D	93	121
PSM	HKELAPYDENWFYTR	47	sp|P39019|RS19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=7487	49.487	2	1967.9166	1967.9166	K	A	42	57
PSM	HLEINPDHPIVETLR	48	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	15-UNIMOD:267	ms_run[2]:scan=6295	41.55	2	1791.9507	1791.9507	K	Q	625	640
PSM	ILGSGISSSSVLHGMVFKK	49	sp|P50990-3|TCPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	18-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=8139	53.794	2	1958.1062	1958.1062	K	E	134	153
PSM	KPLFHGDSEIDQLFR	50	sp|P06493-2|CDK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=8514	56.254	2	1800.9159	1800.9159	K	I	144	159
PSM	LCNYLSHHLTISPQSGNFR	51	sp|Q9H074-3|PAIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	2-UNIMOD:4	ms_run[2]:scan=6795	44.876	2	2243.0906	2243.0906	R	Q	109	128
PSM	LFDRGDFYTAHGEDALLAAR	52	sp|P43246|MSH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=8184	54.097	2	2237.0865	2237.0865	R	E	36	56
PSM	LLGHWEEAAHDLALACK	53	sp|Q8IZP2|ST134_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	16-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=8438	55.752	2	1938.9717	1938.9717	R	F	190	207
PSM	LLGHWEEAAHDLALACK	54	sp|Q8IZP2|ST134_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	16-UNIMOD:4	ms_run[2]:scan=8437	55.746	2	1932.9516	1932.9516	R	F	190	207
PSM	NLVQCGDFPHLLVYGPSGAGKK	55	sp|P40938-2|RFC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:4,21-UNIMOD:188,22-UNIMOD:188	ms_run[2]:scan=8757	57.863	2	2368.24	2368.2400	R	T	28	50
PSM	NPQSTEPVLGGGEPPFHGHR	56	sp|Q9BXW7-2|HDHD5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	20-UNIMOD:267	ms_run[2]:scan=4737	31.751	2	2122.022	2122.0220	R	D	340	360
PSM	RPLHSAQAVDVASASNFR	57	sp|Q9H4A4|AMPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=4423	29.797	2	1924.9868	1924.9868	R	A	15	33
PSM	TLKGHTDSVQDISFDHSGK	58	sp|P43034|LIS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=3785	25.812	2	2070.997	2070.9970	R	L	145	164
PSM	VHLTQLLEKAEVIAGR	59	sp|Q96FC7-2|PHIPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=9398	62.223	2	1776.0258	1776.0258	K	M	138	154
PSM	APKPDGPGGGPGGSHMGGNYGDDR	60	sp|P35637|FUS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0		ms_run[1]:scan=2409	17.279428333333332	3	2251.963299	2251.966492	K	R	449	473
PSM	MREIVHIQAGQCGNQIGAK	61	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	1-UNIMOD:35,2-UNIMOD:267,12-UNIMOD:4,19-UNIMOD:188	ms_run[1]:scan=3845	26.170246666666667	2	2141.078634	2141.080475	-	F	1	20
PSM	AHLLADMAHISGLVAAK	62	sp|P34897-3|GLYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=8783	58.03	2	1716.9345	1716.9345	K	V	225	242
PSM	CSDAAGYPHATHDLEGPPLDAYSIQGQHTISPLDLAK	63	sp|Q15365|PCBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:4,37-UNIMOD:188	ms_run[2]:scan=9157	60.619	3	3950.8841	3950.8841	R	L	201	238
PSM	GHLHDLSEYDAEYSTWNR	64	sp|Q12872|SFSWA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=6621	43.769	2	2191.9559	2191.9559	R	D	78	96
PSM	GKDHVVSDFSEHGSLK	65	sp|P54886-2|P5CS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=3229	22.355	2	1740.8431	1740.8431	R	Y	764	780
PSM	GQAGGKLHIIEVGTPPTGNQPFPK	66	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=6750	44.595	2	2442.3019	2442.3019	R	K	222	246
PSM	HGLLVPNNTTDQELQHIR	67	sp|P56537|IF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	18-UNIMOD:267	ms_run[2]:scan=6046	39.98	3	2094.0846	2094.0846	R	N	68	86
PSM	HIANYISGIQTIGHR	68	sp|Q15393|SF3B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=6099	40.305	2	1678.8903	1678.8903	K	V	985	1000
PSM	HLEEAFTSEHWLVR	69	sp|Q8TCJ2|STT3B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	14-UNIMOD:267	ms_run[2]:scan=7516	49.67	2	1762.8666	1762.8666	K	I	755	769
PSM	HLEEAFTSEHWLVR	70	sp|Q8TCJ2|STT3B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=7522	49.71	2	1752.8584	1752.8584	K	I	755	769
PSM	IGTHNGTFHCDEALACALLR	71	sp|Q9HB07|MYG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	10-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=8223	54.347	2	2255.0576	2255.0576	R	L	47	67
PSM	KILALLDALSTVHSQK	72	sp|Q14692|BMS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=9717	64.405	2	1748.0599	1748.0599	R	M	1206	1222
PSM	KNGGLGHMNIALLSDLTK	73	sp|P30048-2|PRDX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	8-UNIMOD:35	ms_run[2]:scan=7565	49.984	2	1897.0091	1897.0091	R	Q	131	149
PSM	LGHGYHTLEDQALYNR	74	sp|P00813|ADA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	16-UNIMOD:267	ms_run[2]:scan=4951	33.1	2	1895.9154	1895.9154	R	L	236	252
PSM	LIGNESKGEHVPGFCLPK	75	sp|Q92616|GCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	7-UNIMOD:188,15-UNIMOD:4,18-UNIMOD:188	ms_run[2]:scan=6275	41.437	2	1993.0494	1993.0494	R	K	2241	2259
PSM	LKGEMMDLQHGSLFLR	76	sp|P00338-4|LDHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=8288	54.767	2	1873.9543	1873.9543	K	T	58	74
PSM	NMSVIAHVDHGKSTLTDSLVCK	77	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	12-UNIMOD:188,21-UNIMOD:4,22-UNIMOD:188	ms_run[2]:scan=6080	40.195	3	2423.234	2423.2340	R	A	21	43
PSM	RGEAHLAVNDFELAR	78	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:267,15-UNIMOD:267	ms_run[2]:scan=6088	40.245	2	1716.8811	1716.8811	R	A	359	374
PSM	RGEAHLAVNDFELAR	79	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=6090	40.254	2	1696.8645	1696.8645	R	A	359	374
PSM	RGHVFEESQVAGTPMFVVK	80	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=7056	46.557	2	2117.0728	2117.0728	K	A	767	786
PSM	RLTGFHETSNINDFSAGVANR	81	sp|P15104|GLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=6067	40.113	2	2305.12	2305.1200	R	S	299	320
PSM	SAVADKHELLSLASSNHLGK	82	sp|O15372|EIF3H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=5907	39.104	2	2076.0964	2076.0964	K	N	222	242
PSM	SWMEGLTLQDYSEHCKHNESVVK	83	sp|O00487|PSDE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	15-UNIMOD:4,16-UNIMOD:188,23-UNIMOD:188	ms_run[2]:scan=7440	49.182	3	2788.2988	2788.2988	K	E	224	247
PSM	TSSAQVEGGVHSLHSYEKR	84	sp|P12268|IMDH2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=3329	22.988	2	2071.0083	2071.0083	R	L	494	513
PSM	YVATLGVEVHPLVFHTNR	85	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	18-UNIMOD:267	ms_run[2]:scan=8092	53.489	2	2061.1035	2061.1035	K	G	39	57
PSM	KMGLGHEQGFGAPCLK	86	sp|Q9UGI8|TES_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	1-UNIMOD:188,14-UNIMOD:4,16-UNIMOD:188	ms_run[1]:scan=5226	34.82417	2	1740.878629	1740.884239	K	C	9	25
PSM	MREIVHIQAGQCGNQIGAK	87	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	2-UNIMOD:267,12-UNIMOD:4,19-UNIMOD:188	ms_run[1]:scan=4701	31.52015833333333	2	2125.087016	2125.085560	-	F	1	20
PSM	AYHSFLVEPISCHAWNKDR	88	sp|O15143|ARC1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:1,12-UNIMOD:4	ms_run[2]:scan=8520	56.295	2	2371.1168	2371.1168	M	T	2	21
PSM	FKILDAVVAQEPLHR	89	sp|Q15029-2|U5S1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=8376	55.342	2	1734.9781	1734.9781	K	G	754	769
PSM	FQEHIIQAPKPVEAIK	90	sp|Q9UHD1-2|CHRD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=5773	38.266	2	1847.0305	1847.0305	K	R	73	89
PSM	HCVKEVVEAHVDQK	91	sp|P0DPI2|GAL3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:4	ms_run[2]:scan=2555	18.206	2	1676.8304	1676.8304	K	N	220	234
PSM	HGLLVPNNTTDQELQHIR	92	sp|P56537|IF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=6054	40.03	3	2084.0763	2084.0763	R	N	68	86
PSM	HHGDVMDLQFFDQER	93	sp|Q8NFH3-2|NUP43_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	15-UNIMOD:267	ms_run[2]:scan=8421	55.641	2	1882.8296	1882.8296	R	I	73	88
PSM	HIHITQATETTTTR	94	sp|Q14677|EPN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	14-UNIMOD:267	ms_run[2]:scan=2091	15.356	2	1618.8303	1618.8303	K	H	261	275
PSM	HSQFIGYPITLFVEKER	95	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=10041	66.578	3	2063.084	2063.0840	K	D	210	227
PSM	IDHYLGKEMVQNLMVLR	96	sp|P11413|G6PD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=9829	65.16	2	2058.0754	2058.0754	R	F	199	216
PSM	IGTHNGTFHCDEALACALLR	97	sp|Q9HB07|MYG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	10-UNIMOD:4,16-UNIMOD:4,20-UNIMOD:267	ms_run[2]:scan=8229	54.388	2	2265.0658	2265.0658	R	L	47	67
PSM	ILGSGISSSSVLHGMVFKK	98	sp|P50990-3|TCPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=8140	53.801	2	1946.0659	1946.0659	K	E	134	153
PSM	ILHLLTQEALSIHGVK	99	sp|P54886-2|P5CS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=8208	54.252	2	1771.0356	1771.0356	R	E	513	529
PSM	LGHGYHTLEDQALYNR	100	sp|P00813|ADA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=4945	33.059	2	1885.9071	1885.9071	R	L	236	252
PSM	LQSRPAAPPAPGPGQLTLR	101	sp|Q99536|VAT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=5631	37.373	2	1926.0799	1926.0799	K	L	64	83
PSM	LVEKPSPLTLAPHDFANIK	102	sp|P53618|COPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	4-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=7821	51.716	2	2101.1974	2101.1974	K	A	768	787
PSM	LVGGTTPGKGGQTHLGLPVFNTVK	103	sp|P53597|SUCA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=7411	48.983	2	2377.3118	2377.3118	K	E	82	106
PSM	NSSYVHGGVDASGKPQEAVYGQNDIHHK	104	sp|Q9UN86-2|G3BP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=3508	24.111	3	2993.4016	2993.4016	R	V	37	65
PSM	QLFHPEQLITGKEDAANNYAR	105	sp|P68363-2|TBA1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=7170	47.27	3	2414.1979	2414.1979	R	G	85	106
PSM	RGDQLLSVNGVSVEGEHHEK	106	sp|Q9NUP9|LIN7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=4801	32.153	2	2189.0825	2189.0825	K	A	136	156
PSM	RLQGSGVTVNALHPGVAR	107	sp|Q8NBN7-2|RDH13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=4444	29.924	2	1831.0177	1831.0177	R	T	146	164
PSM	RLTGFHETSNINDFSAGVANR	108	sp|P15104|GLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:267,21-UNIMOD:267	ms_run[2]:scan=6063	40.088	2	2325.1365	2325.1365	R	S	299	320
PSM	RVLMAQHFDEVWNSEACNK	109	sp|P46063|RECQ1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	17-UNIMOD:4	ms_run[2]:scan=7089	46.77	3	2333.0681	2333.0681	R	M	455	474
PSM	SLENYHFVDEHGKDQGINIR	110	sp|Q14677|EPN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=5847	38.726	2	2370.1353	2370.1353	R	Q	110	130
PSM	VHLDKAQQNNVEHK	111	sp|P62081|RS7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=874	8.02137	2	1658.860644	1658.848866	K	V	156	170
PSM	HIADLAGNSEVILPVPAFNVINGGSHAGNK	112	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=10641	71.19109499999999	3	3011.545545	3010.562468	R	L	133	163
PSM	LATDKNDPHLCDFIETHYLNEQVK	113	sp|P02794|FRIH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	5-UNIMOD:188,11-UNIMOD:4,24-UNIMOD:188	ms_run[1]:scan=8305	54.877894999999995	3	2912.427898	2911.421316	K	A	121	145
PSM	DQQQKPLYHHFTTAINTENIR	114	sp|Q14344-2|GNA13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=5746	38.099	2	2553.2724	2553.2724	R	L	241	262
PSM	GKDHVVSDFSEHGSLK	115	sp|P54886-2|P5CS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	2-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=3217	22.277	2	1752.8834	1752.8834	R	Y	764	780
PSM	GQKIPIFSAAGLPHNEIAAQICR	116	sp|P21281|VATB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	22-UNIMOD:4	ms_run[2]:scan=8774	57.973	2	2490.3165	2490.3165	R	Q	186	209
PSM	HALHCTILASAGQQR	117	sp|Q9BT78-2|CSN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	5-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=3386	23.35	2	1671.8503	1671.8503	K	S	228	243
PSM	HCVKEVVEAHVDQK	118	sp|P0DPI2|GAL3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	2-UNIMOD:4,4-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=2554	18.201	2	1688.8707	1688.8707	K	N	220	234
PSM	HLEINPDHPIVETLR	119	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=6294	41.545	2	1781.9424	1781.9424	K	Q	625	640
PSM	HLHPIQTSFQEATASK	120	sp|Q8TEM1|PO210_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=4395	29.631	2	1793.906	1793.9060	R	V	1561	1577
PSM	HLQLAIRNDEELNK	121	sp|Q99878|H2A1J_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=4682	31.404	2	1691.8955	1691.8955	R	L	83	97
PSM	HLQLAVRNDEELNK	122	sp|Q8IUE6|H2A2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=3988	27.072	2	1677.8798	1677.8798	R	L	83	97
PSM	HSQFIGYPITLFVEKER	123	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=10156	67.601	3	2063.084	2063.0840	K	D	210	227
PSM	HSSYTCICGSGENSAVLHYGHAGAPNDR	124	sp|P12955-3|PEPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=4835	32.368	3	3016.294	3016.2941	R	T	174	202
PSM	HTGPGILSMANAGPNTNGSQFFICTAK	125	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	24-UNIMOD:4	ms_run[2]:scan=9462	62.661	3	2790.3218	2790.3218	K	T	92	119
PSM	IRDTPEDIVLEAPASGLAFHPAR	126	sp|Q9H6Y2|WDR55_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	2-UNIMOD:267,23-UNIMOD:267	ms_run[2]:scan=9280	61.442	3	2494.3083	2494.3083	R	D	28	51
PSM	IRDTPEDIVLEAPASGLAFHPAR	127	sp|Q9H6Y2|WDR55_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	2-UNIMOD:267,23-UNIMOD:267	ms_run[2]:scan=9283	61.46	2	2494.3083	2494.3083	R	D	28	51
PSM	KFMADCPHTIGVEFGTR	128	sp|P61106|RAB14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:4	ms_run[2]:scan=6358	41.952	2	1964.9237	1964.9237	K	I	35	52
PSM	KGIAFPTSISVNNCVCHFSPLK	129	sp|Q9UQ80-2|PA2G4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	14-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=9131	60.449	3	2475.2403	2475.2403	K	S	18	40
PSM	LVEIVHPSQEEDRHSNASQSLCEIVR	130	sp|Q5H9R7-6|PP6R3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	13-UNIMOD:267,22-UNIMOD:4,26-UNIMOD:267	ms_run[2]:scan=6389	42.148	4	3051.4947	3051.4947	R	L	195	221
PSM	LVGGTTPGKGGQTHLGLPVFNTVK	131	sp|P53597|SUCA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	9-UNIMOD:188,24-UNIMOD:188	ms_run[2]:scan=7413	48.999	2	2389.352	2389.3520	K	E	82	106
PSM	RGHVTQDAPIPGSPLYTIK	132	sp|Q15029-2|U5S1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=6037	39.921	2	2049.1007	2049.1007	R	A	819	838
PSM	RTSSAQVEGGVHSLHSYEK	133	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=3038	21.152	2	2071.0083	2071.0083	K	R	493	512
PSM	TIGGGDDSFNTFFSETGAGKHVPR	134	sp|P68363-2|TBA1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=8383	55.389	2	2496.167	2496.1670	K	A	41	65
PSM	YFLHTGHLTIAGCK	135	sp|P49589-2|SYCC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	13-UNIMOD:4	ms_run[2]:scan=5825	38.593	2	1616.8133	1616.8133	R	M	393	407
PSM	THINIVVIGHVDSGK	136	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	15-UNIMOD:188	ms_run[1]:scan=5667	37.60414333333333	2	1593.894129	1593.893419	K	S	6	21
PSM	ASLPTLGFTHFQPAQLTTVGKR	137	sp|P30566-2|PUR8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=9477	62.763	2	2369.2856	2369.2856	R	C	150	172
PSM	AYHSFLVEPISCHAWNKDR	138	sp|O15143|ARC1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:1,12-UNIMOD:4	ms_run[2]:scan=8511	56.238	3	2371.1168	2371.1168	M	T	2	21
PSM	DYHFKVDNDENEHQLSLR	139	sp|P06748-3|NPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=5570	36.991	2	2258.0352	2258.0352	K	T	28	46
PSM	ESGLQAAHPNSIFLIDHAWTCR	140	sp|Q14166|TTL12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	21-UNIMOD:4	ms_run[2]:scan=9335	61.81	3	2522.2125	2522.2125	R	V	106	128
PSM	FGLESHAHTIQICK	141	sp|Q8NE71-2|ABCF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	13-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=5182	34.545	2	1645.8342	1645.8342	R	L	691	705
PSM	GLPFEAENKHVIDFFK	142	sp|Q9NTZ6|RBM12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=9684	64.185	2	1889.9676	1889.9676	K	K	436	452
PSM	GPHLVQSDGTVPFWAHAGNAIPSSDQIR	143	sp|P49257|LMAN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=8725	57.653	2	2956.458	2956.4580	K	V	54	82
PSM	GQHVTGSPFQFTVGPLGEGGAHK	144	sp|O75369-7|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=8019	53.004	2	2307.1396	2307.1396	R	V	1993	2016
PSM	HLNEIDLFHCIDPNDSK	145	sp|Q15185-3|TEBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	10-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=8483	56.054	2	2071.9729	2071.9729	K	H	49	66
PSM	HSQFIGYPITLFVEKER	146	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=10147	67.532	2	2063.084	2063.0840	K	D	210	227
PSM	HSSYTCICGSGENSAVLHYGHAGAPNDR	147	sp|P12955-3|PEPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:4,8-UNIMOD:4,28-UNIMOD:267	ms_run[2]:scan=4844	32.423	4	3026.3023	3026.3023	R	T	174	202
PSM	HYFQNTQGLIFVVDSNDRER	148	sp|P84085|ARF5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=8121	53.677	2	2437.1775	2437.1775	R	V	80	100
PSM	IHQALKEDILEFIK	149	sp|Q93034|CUL5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=9215	61.004	2	1695.956	1695.9560	K	Q	61	75
PSM	IRDTPEDIVLEAPASGLAFHPAR	150	sp|Q9H6Y2|WDR55_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=9265	61.341	3	2474.2918	2474.2918	R	D	28	51
PSM	KFVIHPESNNLIIIETDHNAYTEATK	151	sp|Q15393|SF3B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:188,26-UNIMOD:188	ms_run[2]:scan=7802	51.594	3	3008.5646	3008.5646	R	A	787	813
PSM	KTHIQDNHDGTYTVAYVPDVTGR	152	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=5553	36.88	2	2586.2463	2586.2463	K	Y	1593	1616
PSM	KWTTLNSLQLHGLQLR	153	sp|Q08J23-3|NSUN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=8700	57.49	2	1907.0741	1907.0741	K	I	50	66
PSM	LLGHWEEAAHDLALACK	154	sp|Q8IZP2|ST134_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	16-UNIMOD:4	ms_run[2]:scan=8436	55.741	3	1932.9516	1932.9516	R	F	190	207
PSM	LTHYHEGLPTTWGTR	155	sp|O60568|PLOD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:267	ms_run[2]:scan=5346	35.571	2	1777.8775	1777.8775	R	Y	715	730
PSM	MCTLIDKFDEHDGPVR	156	sp|P53621|COPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:35,2-UNIMOD:4	ms_run[2]:scan=6136	40.531	2	1947.8819	1947.8819	R	G	40	56
PSM	NVQQIGILKPHPAYVQLLEK	157	sp|O00411|RPOM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=8324	54.999	2	2287.3052	2287.3052	R	A	614	634
PSM	SLHDALCVLAQTVKDSR	158	sp|P78371-2|TCPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	7-UNIMOD:4	ms_run[2]:scan=10256	68.387	2	1911.9836	1911.9836	R	T	342	359
PSM	SQHSSSSSHWHQEGVDVK	159	sp|Q9NZ08|ERAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	18-UNIMOD:188	ms_run[2]:scan=1776	13.423	2	2026.9189	2026.9189	R	T	501	519
PSM	HSQFLGYPITLYLEKER	160	sp|Q58FF8|H90B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	15-UNIMOD:188,17-UNIMOD:267	ms_run[1]:scan=9795	64.93582666666667	3	2109.120293	2109.122974	K	E	127	144
PSM	HGNQYIQVNEPWKR	161	sp|P56192|SYMC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=5333	35.492223333333335	2	1767.875163	1767.880501	R	I	714	728
PSM	KMGLGHEQGFGAPCLK	162	sp|Q9UGI8|TES_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	14-UNIMOD:4	ms_run[1]:scan=5233	34.869998333333335	2	1728.838789	1728.843981	K	C	9	25
PSM	TYFPHFDLSHGSAQVK	163	sp|P69905|HBA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=7070	46.64966	2	1832.882105	1832.884583	K	G	42	58
PSM	AHDGGIYAISWSPDSTHLLSASGDKTSK	164	sp|O75083-3|WDR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=8176	54.044	3	2900.3941	2900.3941	K	I	92	120
PSM	AHLLADMAHISGLVAAK	165	sp|P34897-3|GLYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=8781	58.019	3	1716.9345	1716.9345	K	V	225	242
PSM	AIGIEPSLATYHHIIR	166	sp|Q96EY7|PTCD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=7094	46.8	2	1789.9839	1789.9839	K	L	362	378
PSM	AVLGEVVLYSGARPLSHQPGPEAPALPK	167	sp|P26640|SYVC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=8647	57.144	3	2852.5549	2852.5549	R	T	202	230
PSM	CYECGEKGHYAYDCHR	168	sp|Q16629-3|SRSF7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:4,4-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=1896	14.151	2	2103.7986	2103.7986	R	Y	106	122
PSM	DGQKHVVTLLQVQDCHVLK	169	sp|P09001|RM03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	15-UNIMOD:4	ms_run[2]:scan=6280	41.464	2	2216.1736	2216.1736	K	Y	113	132
PSM	GIPVMGHSEGICHMYVDSEASVDKVTR	170	sp|P54886-2|P5CS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	12-UNIMOD:4	ms_run[2]:scan=7421	49.051	3	2973.3783	2973.3783	K	L	571	598
PSM	GLPFEAENKHVIDFFK	171	sp|Q9NTZ6|RBM12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	9-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=9685	64.191	2	1902.0078	1902.0078	K	K	436	452
PSM	GNHVIRDEEVSSADISSSSEVISQHLVSYR	172	sp|P12270|TPR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=8149	53.864	3	3299.6018	3299.6018	R	N	512	542
PSM	HSQFIGYPITLFVEKER	173	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=10038	66.555	2	2063.084	2063.0840	K	D	210	227
PSM	HSSYTCICGSGENSAVLHYGHAGAPNDR	174	sp|P12955-3|PEPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=4847	32.441	2	3016.294	3016.2941	R	T	174	202
PSM	HVVFTAETHNFPTGVCPFSGATTGTGGR	175	sp|O15067|PUR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	16-UNIMOD:4	ms_run[2]:scan=7648	50.541	3	2904.3613	2904.3613	R	I	303	331
PSM	IKGEHPGLSIGDVAK	176	sp|P09429|HMGB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=4343	29.319	2	1519.8358	1519.8358	K	K	113	128
PSM	ILHLLTQEALSIHGVK	177	sp|P54886-2|P5CS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	16-UNIMOD:188	ms_run[2]:scan=8209	54.257	2	1777.0557	1777.0557	R	E	513	529
PSM	IRDTPEDIVLEAPASGLAFHPAR	178	sp|Q9H6Y2|WDR55_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9284	61.466	2	2474.2918	2474.2918	R	D	28	51
PSM	KFVIHPESNNLIIIETDHNAYTEATK	179	sp|Q15393|SF3B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=7801	51.588	3	2996.5244	2996.5244	R	A	787	813
PSM	LFDRGDFYTAHGEDALLAAR	180	sp|P43246|MSH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:267,20-UNIMOD:267	ms_run[2]:scan=8196	54.177	2	2257.1031	2257.1031	R	E	36	56
PSM	LIGNESKGEHVPGFCLPK	181	sp|Q92616|GCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	15-UNIMOD:4	ms_run[2]:scan=6268	41.392	2	1981.0091	1981.0091	R	K	2241	2259
PSM	LKLEQIDGHIAEHNSK	182	sp|Q9NTJ3|SMC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=4368	29.464	2	1842.9991	1842.9991	K	I	1016	1032
PSM	LKLEQIDGHIAEHNSK	183	sp|Q9NTJ3|SMC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=4373	29.493	2	1830.9588	1830.9588	K	I	1016	1032
PSM	LNSHMNALHLGSQANR	184	sp|P11413|G6PD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=4092	27.733	2	1761.8693	1761.8693	R	L	121	137
PSM	LNSHMNALHLGSQANR	185	sp|P11413|G6PD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	16-UNIMOD:267	ms_run[2]:scan=4103	27.802	2	1771.8776	1771.8776	R	L	121	137
PSM	RHVFGESDELIGQK	186	sp|P60174-4|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=4467	30.071	2	1613.8162	1613.8162	R	V	18	32
PSM	RPLDDGVGNQLGALVHQR	187	sp|Q96I24|FUBP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:267,18-UNIMOD:267	ms_run[2]:scan=6981	46.071	3	1964.0455	1964.0455	K	T	58	76
PSM	RPLDDGVGNQLGALVHQR	188	sp|Q96I24|FUBP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:267,18-UNIMOD:267	ms_run[2]:scan=6995	46.165	2	1964.0455	1964.0455	K	T	58	76
PSM	SHLLNCCPHDVLSGTR	189	sp|Q9Y383-3|LC7L2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=4819	32.266	2	1864.8672	1864.8672	K	M	35	51
PSM	THINIVVIGHVDSGK	190	sp|P68104-2|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	15-UNIMOD:188	ms_run[2]:scan=5645	37.464	2	1593.8934	1593.8934	K	S	6	21
PSM	TLPHFIKDDYGPESR	191	sp|P24928|RPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=5707	37.846	2	1773.8686	1773.8686	R	G	806	821
PSM	VAIHYINPPNPAKDNFTFK	192	sp|P78406|RAE1L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	13-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=7473	49.397	2	2197.1723	2197.1723	R	C	240	259
PSM	VHLDKAQQNNVEHK	193	sp|P62081|RS7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	5-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=876	8.0375	2	1670.8891	1670.8891	K	V	156	170
PSM	VHLVGIDIFTGKK	194	sp|Q9GZV4|IF5A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	12-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=7937	52.462	2	1437.8746	1437.8746	K	Y	56	69
PSM	YFLHTGHLTIAGCK	195	sp|P49589-2|SYCC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	13-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=5824	38.588	2	1622.8335	1622.8335	R	M	393	407
PSM	YQHTGAVLDCAFYDPTHAWSGGLDHQLK	196	sp|O43684-2|BUB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	10-UNIMOD:4,28-UNIMOD:188	ms_run[2]:scan=9106	60.286	3	3192.4819	3192.4819	K	M	53	81
PSM	QLFHPEQLITGKEDAANNYAR	197	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:28	ms_run[1]:scan=9009	59.639835	3	2397.1780	2397.1708	R	G	85	106
PSM	KGIAFPTSISVNNCVCHFSPLK	198	sp|Q9UQ80|PA2G4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	1-UNIMOD:188,14-UNIMOD:4,16-UNIMOD:4,22-UNIMOD:188	ms_run[1]:scan=9149	60.56530166666667	3	2488.287421	2487.280530	K	S	72	94
PSM	KGTVLLADNVICPGAPDFLAHVR	199	sp|P21964|COMT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	1-UNIMOD:188,12-UNIMOD:4,23-UNIMOD:267	ms_run[1]:scan=9951	65.98143333333334	3	2479.339028	2478.338798	R	G	212	235
PSM	DCQLNAHKDHQYQFLEDAVR	200	sp|Q13263-2|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:4	ms_run[2]:scan=6210	41.019	3	2486.1397	2486.1397	R	N	149	169
PSM	ELYERPPHLFAIADAAYK	201	sp|O94832|MYO1D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=8450	55.829	2	2103.0789	2103.0789	R	A	70	88
PSM	FREDHPDLIQNAK	202	sp|P17480-2|UBF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=3656	25.013	2	1581.79	1581.7900	R	K	179	192
PSM	GKDHVVSDFSEHGSLK	203	sp|P54886-2|P5CS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=3238	22.412	3	1752.8834	1752.8834	R	Y	764	780
PSM	GLHSENREDEGWQVYR	204	sp|Q8IVT2|MISP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	7-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=4568	30.69	2	1993.9145	1993.9145	R	L	81	97
PSM	HLNEIDLFHCIDPNDSK	205	sp|Q15185-3|TEBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	10-UNIMOD:4	ms_run[2]:scan=8473	55.984	2	2065.9527	2065.9527	K	H	49	66
PSM	HSQFLGYPITLYLEKER	206	sp|Q58FF8|H90B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=9746	64.601	2	2093.0946	2093.0946	K	E	127	144
PSM	ILRGQDHCGIESEVVAGIPR	207	sp|P07858|CATB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	8-UNIMOD:4	ms_run[2]:scan=6744	44.556	2	2205.1324	2205.1324	K	T	312	332
PSM	ILRGQDHCGIESEVVAGIPR	208	sp|P07858|CATB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:267,8-UNIMOD:4,20-UNIMOD:267	ms_run[2]:scan=6755	44.622	3	2225.149	2225.1490	K	T	312	332
PSM	KGADSLEDFLYHEGYACTSIHGDR	209	sp|O00571-2|DDX3X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	17-UNIMOD:4	ms_run[2]:scan=8814	58.242	2	2740.2187	2740.2187	K	S	436	460
PSM	KPLFHGDSEIDQLFR	210	sp|P06493-2|CDK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=8513	56.249	3	1800.9159	1800.9159	K	I	144	159
PSM	LCLTLHNNEGSYLAHTQGKK	211	sp|Q15428|SF3A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:4	ms_run[2]:scan=5255	35.006	3	2283.143	2283.1430	K	H	58	78
PSM	LLGHWEEAAHDLALACK	212	sp|Q8IZP2|ST134_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	16-UNIMOD:4	ms_run[2]:scan=8477	56.013	2	1932.9516	1932.9516	R	F	190	207
PSM	LQFHDVAGDIFHQQCK	213	sp|P11413|G6PD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	15-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=7731	51.108	2	1947.9357	1947.9357	R	R	371	387
PSM	LVEKPSPLTLAPHDFANIK	214	sp|P53618|COPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=7805	51.612	2	2089.1572	2089.1572	K	A	768	787
PSM	LVFHTQLAHGSPTGR	215	sp|O14908|GIPC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	15-UNIMOD:267	ms_run[2]:scan=4327	29.224	2	1629.8615	1629.8615	R	I	58	73
PSM	LVNACLAEELPHIHAFEQK	216	sp|Q9H3K6|BOLA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	5-UNIMOD:4	ms_run[2]:scan=8775	57.979	2	2218.1205	2218.1205	R	T	55	74
PSM	QQLQTTRQELSHALYQHDAACR	217	sp|Q9UMS4|PRP19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	21-UNIMOD:4	ms_run[2]:scan=5532	36.753	3	2653.2779	2653.2779	R	V	94	116
PSM	RECPSDECGAGVFMASHFDR	218	sp|P62979|RS27A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=6486	42.847	3	2326.9518	2326.9518	R	H	119	139
PSM	RGFAFVTFDDHDSVDK	219	sp|P09651-3|ROA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=7458	49.297	2	1854.8537	1854.8537	K	I	146	162
PSM	RGFGFVTFDDHDPVDK	220	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=7607	50.259	2	1850.8588	1850.8588	K	I	141	157
PSM	RVHVAEALEEAAAK	221	sp|Q9BWE0|REPI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=4631	31.09	2	1492.7998	1492.7998	K	A	197	211
PSM	SAFLLQNLLVGHPEHK	222	sp|Q9NZL4|HPBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	16-UNIMOD:188	ms_run[2]:scan=9896	65.617	2	1808.004	1808.0040	K	G	250	266
PSM	TANKDHLVTAYNHLFETK	223	sp|Q00688|FKBP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=6121	40.436	2	2101.0593	2101.0593	K	R	53	71
PSM	TFVHVVPAKPEGTFK	224	sp|Q9P0M9|RM27_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=5034	33.619	2	1655.9035	1655.9035	K	L	129	144
PSM	THINIVVIGHVDSGK	225	sp|P68104-2|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=5639	37.424	2	1587.8733	1587.8733	K	S	6	21
PSM	TLKGHTDSVQDISFDHSGK	226	sp|P43034|LIS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=3784	25.807	3	2070.997	2070.9970	R	L	145	164
PSM	TVQGSGHQEHINIHK	227	sp|Q14247-3|SRC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	15-UNIMOD:188	ms_run[2]:scan=1246	10.214	2	1689.8642	1689.8642	K	L	43	58
PSM	VGLTHTMEHEDVIQIVKK	228	sp|P55039|DRG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	17-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=5749	38.117	3	2088.144	2088.1440	R	-	347	365
PSM	VRAPMVNPTLGVHEADLLK	229	sp|Q13423|NNTM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=7557	49.936	2	2059.1248	2059.1248	K	T	128	147
PSM	QLFHPEQLITGKEDAANNYAR	230	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:28,12-UNIMOD:188,21-UNIMOD:267	ms_run[1]:scan=8972	59.37894	3	2413.2072	2413.1992	R	G	85	106
PSM	HTGPGILSMANAGPNTNGSQFFICTAK	231	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	24-UNIMOD:4,27-UNIMOD:188	ms_run[1]:scan=9469	62.70883666666667	3	2797.361218	2796.341898	K	T	92	119
PSM	LCNYLSHHLTISPQSGNFR	232	sp|Q9H074|PAIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	2-UNIMOD:4,19-UNIMOD:267	ms_run[1]:scan=6799	44.89886333333334	2	2253.104636	2253.098839	R	Q	221	240
PSM	MREIVHIQAGQCGNQIGAK	233	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	1-UNIMOD:35,2-UNIMOD:267,12-UNIMOD:4,19-UNIMOD:188	ms_run[1]:scan=4130	27.972611666666666	3	2142.062308	2141.080475	-	F	1	20
PSM	AFDKHMNLILCDCDEFR	234	sp|P14678-2|RSMB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	11-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=8232	54.405	2	2182.9598	2182.9598	K	K	33	50
PSM	AGHFDKEIVPVLVSTR	235	sp|Q9BWD1|THIC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=6845	45.178	2	1766.9679	1766.9679	K	K	195	211
PSM	AHDGGIYAISWSPDSTHLLSASGDKTSK	236	sp|O75083-3|WDR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	25-UNIMOD:188,28-UNIMOD:188	ms_run[2]:scan=8188	54.125	3	2912.4343	2912.4343	K	I	92	120
PSM	AHLLADMAHISGLVAAK	237	sp|P34897-3|GLYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	17-UNIMOD:188	ms_run[2]:scan=8801	58.154	3	1722.9546	1722.9546	K	V	225	242
PSM	AIMKDPDDHTVCHLLFANQTEK	238	sp|P00387-2|NB5R3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:4	ms_run[2]:scan=6968	45.983	2	2582.2257	2582.2257	R	D	170	192
PSM	DQQQKPLYHHFTTAINTENIR	239	sp|Q14344-2|GNA13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=5743	38.08	3	2553.2724	2553.2724	R	L	241	262
PSM	DVGHNIYILAHQLAR	240	sp|Q14571|ITPR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9696	64.263	2	1718.9216	1718.9216	K	H	2103	2118
PSM	EHPYLFSQCQAIHCR	241	sp|P09960-3|LKHA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	9-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=5235	34.882	2	1944.8723	1944.8723	K	A	104	119
PSM	EHPYLFSQCQAIHCR	242	sp|P09960-3|LKHA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	9-UNIMOD:4,14-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=5236	34.888	2	1954.8806	1954.8806	K	A	104	119
PSM	ETEELHHDRVTLEVGK	243	sp|O60869-2|EDF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=3696	25.263	2	1890.9436	1890.9436	R	V	64	80
PSM	FRDPSSVGVAQHLTNTVFIDR	244	sp|Q8WXA9-2|SREK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=8151	53.876	2	2358.208	2358.2080	K	A	69	90
PSM	FRDPSSVGVAQHLTNTVFIDR	245	sp|Q8WXA9-2|SREK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:267,21-UNIMOD:267	ms_run[2]:scan=8154	53.899	3	2378.2246	2378.2246	K	A	69	90
PSM	GATYGKPVHHGVNQLK	246	sp|P61313-2|RL15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=1356	10.859	2	1704.906	1704.9060	K	F	78	94
PSM	HGVYNPNKIFGVTTLDIVR	247	sp|P40926|MDHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9115	60.345	3	2142.1586	2142.1586	K	A	158	177
PSM	HIHITQATETTTTR	248	sp|Q14677|EPN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=2093	15.366	2	1608.822	1608.8220	K	H	261	275
PSM	HLNEIDLFHCIDPNDSK	249	sp|Q15185-3|TEBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	10-UNIMOD:4	ms_run[2]:scan=8499	56.163	3	2065.9527	2065.9527	K	H	49	66
PSM	HRFAEPIGGFQCVFPGC	250	sp|Q9Y570-2|PPME1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:4,17-UNIMOD:4	ms_run[2]:scan=9306	61.615	2	1977.8978	1977.8978	R	-	183	200
PSM	HSQFLGYPITLYLEKER	251	sp|Q58FF8|H90B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9730	64.494	3	2093.0946	2093.0946	K	E	127	144
PSM	IFCCHGGLSPDLQSMEQIRR	252	sp|P62136-3|PP1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:4,4-UNIMOD:4,19-UNIMOD:267,20-UNIMOD:267	ms_run[2]:scan=7348	48.562	2	2423.1411	2423.1411	K	I	125	145
PSM	IGTHNGTFHCDEALACALLR	253	sp|Q9HB07|MYG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	10-UNIMOD:4,16-UNIMOD:4,20-UNIMOD:267	ms_run[2]:scan=8221	54.337	3	2265.0658	2265.0658	R	L	47	67
PSM	IISKIENHEGVR	254	sp|P14618-3|KPYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=2130	15.594	2	1393.7678	1393.7678	K	R	252	264
PSM	IKGEHPGLSIGDVAK	255	sp|P09429|HMGB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=4333	29.262	2	1531.8761	1531.8761	K	K	113	128
PSM	INFDKYHPGYFGK	256	sp|P46776|RL27A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	5-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=6011	39.763	2	1596.8128	1596.8128	R	V	43	56
PSM	KECEHCDCLQGFQLTHSLGGGTGSGMGTLLISK	257	sp|Q9BUF5|TBB6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:188,3-UNIMOD:4,6-UNIMOD:4,8-UNIMOD:4,33-UNIMOD:188	ms_run[2]:scan=9169	60.7	3	3589.6825	3589.6825	R	I	122	155
PSM	KGSEHQAIVQHLEK	258	sp|Q14690|RRP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=1923	14.325	2	1614.8881	1614.8881	R	S	924	938
PSM	KLDYGQHVVAGTPGR	259	sp|P38919|IF4A3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=3367	23.23	2	1596.8372	1596.8372	R	V	152	167
PSM	KPQGVDPASFHFLDTPIAK	260	sp|Q969G9|NKD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=8529	56.354	3	2067.0789	2067.0789	R	V	309	328
PSM	LFDRGDFYTAHGEDALLAAR	261	sp|P43246|MSH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=8177	54.05	3	2237.0865	2237.0865	R	E	36	56
PSM	LREQLQLLEEQHR	262	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:267,13-UNIMOD:267	ms_run[2]:scan=5404	35.935	2	1710.928	1710.9280	R	A	2562	2575
PSM	LVNACLAEELPHIHAFEQK	263	sp|Q9H3K6|BOLA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	5-UNIMOD:4,19-UNIMOD:188	ms_run[2]:scan=8782	58.024	2	2224.1406	2224.1406	R	T	55	74
PSM	NCVILPHIGSATHR	264	sp|Q9UBQ7|GRHPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:4	ms_run[2]:scan=5048	33.703	2	1573.8147	1573.8147	K	T	287	301
PSM	NVPTDVLSFPFHEHLK	265	sp|P58557|YBEY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9300	61.578	2	1878.9628	1878.9628	R	A	58	74
PSM	RLHGLDEEAEQK	266	sp|P33991|MCM4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=1943	14.446	2	1423.7056	1423.7056	K	L	428	440
PSM	SHQGLDRQELSFAAR	267	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:267,15-UNIMOD:267	ms_run[2]:scan=4752	31.848	2	1733.8712	1733.8712	K	S	2407	2422
PSM	SHVAGQMLHGGGSR	268	sp|P43155-2|CACP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	14-UNIMOD:267	ms_run[2]:scan=1351	10.831	2	1402.6763	1402.6763	R	L	281	295
PSM	TANKDHLVTAYNHLFETK	269	sp|Q00688|FKBP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	4-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=6122	40.442	2	2113.0995	2113.0995	K	R	53	71
PSM	TFHFNTVEEVHSR	270	sp|P30740|ILEU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=4969	33.217	2	1601.7587	1601.7587	K	F	57	70
PSM	THASPADLCHYHSQESDGLVCLLK	271	sp|P43405-2|KSYK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	9-UNIMOD:4,21-UNIMOD:4	ms_run[2]:scan=7317	48.367	2	2737.2588	2737.2588	R	K	81	105
PSM	VHVGDEDFVHLR	272	sp|P04080|CYTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:267	ms_run[2]:scan=5675	37.651	2	1431.7134	1431.7134	K	V	57	69
PSM	VYADGIFDLFHSGHAR	273	sp|Q9Y5K3-2|PCY1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=10032	66.518	2	1803.8693	1803.8693	R	A	79	95
PSM	YHTINGHNCEVKK	274	sp|P51991-2|ROA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	9-UNIMOD:4	ms_run[2]:scan=888	8.105	2	1598.7624	1598.7624	K	A	166	179
PSM	YQLSIHKNPNTSEPQHLLVMK	275	sp|P05023-2|AT1A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:188,21-UNIMOD:188	ms_run[2]:scan=5899	39.051	3	2488.3299	2488.3299	K	G	488	509
PSM	RNALGPGLSPELGPLPALR	276	sp|Q8N1G4|LRC47_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=9407	62.28216333333333	2	1927.113333	1927.100330	R	V	84	103
PSM	SAVADKHELLSLASSNHLGK	277	sp|O15372|EIF3H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=5916	39.15961666666667	3	2077.096427	2076.096367	K	N	222	242
PSM	HTGPGILSMANAGPNTNGSQFFICTAK	278	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	24-UNIMOD:4	ms_run[1]:scan=9659	64.02004666666667	3	2791.300095	2790.321769	K	T	92	119
PSM	INMAHLCVIGSHAVNGVAR	279	sp|P11216|PYGB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	7-UNIMOD:4	ms_run[1]:scan=6706	44.309931666666664	3	2019.032268	2018.030219	R	I	440	459
PSM	ALEEGLTPQEICDKYHIIHADIYR	280	sp|P56192|SYMC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	12-UNIMOD:4	ms_run[2]:scan=8798	58.13	3	2883.4225	2883.4225	K	W	322	346
PSM	DCQLNAHKDHQYQFLEDAVR	281	sp|Q13263-2|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:4	ms_run[2]:scan=6204	40.979	2	2486.1397	2486.1397	R	N	149	169
PSM	EFHQAGKPIGLCCIAPVLAAK	282	sp|P0DPI2|GAL3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	12-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=8160	53.934	2	2279.1919	2279.1919	K	V	165	186
PSM	FGLESHAHTIQICK	283	sp|Q8NE71-2|ABCF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:4	ms_run[2]:scan=5185	34.563	2	1639.8141	1639.8141	R	L	691	705
PSM	FQGIKHECQANGPEDLNR	284	sp|P60981-2|DEST_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	8-UNIMOD:4	ms_run[2]:scan=3390	23.378	3	2111.9807	2111.9807	K	A	111	129
PSM	FRDPSSVGVAQHLTNTVFIDR	285	sp|Q8WXA9-2|SREK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8147	53.852	3	2358.208	2358.2080	K	A	69	90
PSM	GGSPFAIVITQQHQIHR	286	sp|Q9HCD5|NCOA5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6896	45.491	2	1888.0068	1888.0068	R	S	248	265
PSM	GHQFSCVCLHGDR	287	sp|Q92499-3|DDX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	6-UNIMOD:4,8-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=3278	22.66	2	1581.6804	1581.6804	K	K	409	422
PSM	GHQFSCVCLHGDR	288	sp|Q92499-3|DDX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	6-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=3279	22.666	2	1571.6722	1571.6722	K	K	409	422
PSM	GIGIENIHYLNDGLWHMK	289	sp|Q9ULC4-2|MCTS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	18-UNIMOD:188	ms_run[2]:scan=9941	65.915	2	2115.0667	2115.0667	K	T	149	167
PSM	GLHSENREDEGWQVYR	290	sp|Q8IVT2|MISP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=4569	30.696	2	1973.898	1973.8980	R	L	81	97
PSM	HFFHEDEEPFNPDYVEVDR	291	sp|Q9HCK8-2|CHD8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=7696	50.878	2	2420.0346	2420.0346	R	I	431	450
PSM	HGHLCPIDTGLIEK	292	sp|P26358-3|DNMT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	5-UNIMOD:4	ms_run[2]:scan=5288	35.212	2	1588.8032	1588.8032	K	N	80	94
PSM	HGKAPILIATDVASR	293	sp|P17844|DDX5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5006	33.448	2	1547.8784	1547.8784	K	G	389	404
PSM	HHAEYLTELLTTQR	294	sp|Q8TDD1|DDX54_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=7197	47.444	2	1710.8689	1710.8689	K	V	349	363
PSM	HLEEAFTSEHWLVR	295	sp|Q8TCJ2|STT3B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:267	ms_run[2]:scan=7512	49.647	3	1762.8666	1762.8666	K	I	755	769
PSM	HLEEAFTSEHWLVR	296	sp|Q8TCJ2|STT3B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=7521	49.705	3	1752.8584	1752.8584	K	I	755	769
PSM	HRLDLGEDYPSGK	297	sp|O43143|DHX15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=3631	24.867	2	1485.7212	1485.7212	R	K	5	18
PSM	HWDQDDDFEFTGSHLTVR	298	sp|O60341|KDM1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	18-UNIMOD:267	ms_run[2]:scan=7617	50.328	3	2213.9642	2213.9642	K	N	551	569
PSM	HWILPQDYDHAQAEAR	299	sp|Q15293-2|RCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	16-UNIMOD:267	ms_run[2]:scan=5925	39.216	3	1958.9263	1958.9263	R	H	220	236
PSM	IHVFYIDYGNREVLPSTR	300	sp|Q7KZF4|SND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	11-UNIMOD:267,18-UNIMOD:267	ms_run[2]:scan=8101	53.546	2	2198.1387	2198.1387	K	L	759	777
PSM	IHVFYIDYGNREVLPSTR	301	sp|Q7KZF4|SND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8110	53.605	2	2178.1222	2178.1222	K	L	759	777
PSM	ILTTASSHEFEHTKK	302	sp|Q16851-2|UGPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=2304	16.641	2	1727.8842	1727.8842	K	D	28	43
PSM	INFDKYHPGYFGK	303	sp|P46776|RL27A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6012	39.767	2	1584.7725	1584.7725	R	V	43	56
PSM	KGSEHQAIVQHLEK	304	sp|Q14690|RRP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=1924	14.33	2	1602.8478	1602.8478	R	S	924	938
PSM	KHPDASVNFSEFSK	305	sp|P09429|HMGB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=5064	33.802	2	1603.8033	1603.8033	K	K	30	44
PSM	KILALLDALSTVHSQK	306	sp|Q14692|BMS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=9701	64.298	3	1748.0599	1748.0599	R	M	1206	1222
PSM	KILALLDALSTVHSQK	307	sp|Q14692|BMS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9705	64.322	2	1736.0196	1736.0196	R	M	1206	1222
PSM	KLVQNGPEVHPGANFIQQR	308	sp|O14802|RPC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5087	33.946	3	2131.1287	2131.1287	R	H	406	425
PSM	LCLTLHNNEGSYLAHTQGKK	309	sp|Q15428|SF3A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:4	ms_run[2]:scan=5266	35.073	2	2283.143	2283.1430	K	H	58	78
PSM	LCNYLSHHLTISPQSGNFR	310	sp|Q9H074-3|PAIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:4	ms_run[2]:scan=6794	44.871	3	2243.0906	2243.0906	R	Q	109	128
PSM	LHLSGIDANPNALFPPVEFPAPR	311	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	23-UNIMOD:267	ms_run[2]:scan=11071	74.609	2	2481.3044	2481.3044	R	G	803	826
PSM	LKDYAFVHFEDR	312	sp|O43390-4|HNRPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6286	41.5	2	1538.7518	1538.7518	K	G	275	287
PSM	LKLEQIDGHIAEHNSK	313	sp|Q9NTJ3|SMC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=4372	29.488	3	1842.9991	1842.9991	K	I	1016	1032
PSM	LLGHWEEAAHDLALACK	314	sp|Q8IZP2|ST134_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	16-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=8431	55.706	3	1938.9717	1938.9717	R	F	190	207
PSM	LLHIEELRELQTK	315	sp|Q9Y224|RTRAF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6963	45.949	2	1620.9199	1620.9199	R	I	206	219
PSM	LQPTAGLQDLHIHSR	316	sp|Q9Y653-5|AGRG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5721	37.936	2	1684.9009	1684.9009	K	Q	65	80
PSM	LTHYHEGLPTTWGTR	317	sp|O60568|PLOD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	15-UNIMOD:267	ms_run[2]:scan=5350	35.599	3	1777.8775	1777.8775	R	Y	715	730
PSM	MKPLVVFVLGGPGAGK	318	sp|P30085-2|KCY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:35,2-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=8733	57.706	2	1596.9464	1596.9464	-	G	1	17
PSM	NLVQCGDFPHLLVYGPSGAGKK	319	sp|P40938-2|RFC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	5-UNIMOD:4	ms_run[2]:scan=8741	57.759	2	2356.1998	2356.1998	R	T	28	50
PSM	NPQSTEPVLGGGEPPFHGHR	320	sp|Q9BXW7-2|HDHD5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=4719	31.636	2	2112.0137	2112.0137	R	D	340	360
PSM	RGEAHLAVNDFELAR	321	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:267,15-UNIMOD:267	ms_run[2]:scan=6089	40.249	3	1716.8811	1716.8811	R	A	359	374
PSM	RGFAFVTFDDHDSVDK	322	sp|P09651-3|ROA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=7434	49.141	3	1854.8537	1854.8537	K	I	146	162
PSM	RVIISAPSADAPMFVMGVNHEK	323	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:35	ms_run[2]:scan=7209	47.524	3	2384.1981	2384.1981	K	Y	76	98
PSM	SAVADKHELLSLASSNHLGK	324	sp|O15372|EIF3H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	6-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=5923	39.204	3	2088.1366	2088.1366	K	N	222	242
PSM	SFPLHFDENSFFAGDKK	325	sp|Q96HE7|ERO1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9371	62.049	2	1984.9319	1984.9319	K	E	353	370
PSM	TANKDHLVTAYNHLFETK	326	sp|Q00688|FKBP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6118	40.419	3	2101.0593	2101.0593	K	R	53	71
PSM	TFVHVVPAKPEGTFK	327	sp|Q9P0M9|RM27_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=5035	33.624	2	1667.9438	1667.9438	K	L	129	144
PSM	TKASVHTLSGHTNAVATVR	328	sp|O43660-2|PLRG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=2485	17.768	3	1949.0443	1949.0443	R	C	310	329
PSM	VTYHPDGPEGQAYDVDFTPPFRR	329	sp|Q15046|SYK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=7871	52.047	2	2663.2405	2663.2405	K	I	371	394
PSM	YHTINGHNCEVKK	330	sp|P51991|ROA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	9-UNIMOD:4	ms_run[1]:scan=1039	8.985066666666667	2	1599.7562	1598.7622	K	A	188	201
PSM	RLTGFHETSNINDFSAGVANR	331	sp|P15104|GLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=6062	40.08258166666666	3	2305.116761	2305.119956	R	S	299	320
PSM	HLLIGLPSGAILSLPK	332	sp|Q8N766|EMC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	16-UNIMOD:188	ms_run[1]:scan=10915	73.19002666666667	3	1634.020425	1634.022643	R	A	860	876
PSM	SWMEGLTLQDYSEHCKHNESVVK	333	sp|O00487|PSDE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	15-UNIMOD:4	ms_run[1]:scan=7445	49.21044833333333	2	2778.265782	2776.258500	K	E	224	247
PSM	HKSLSLGEVLDGDR	334	sp|O15321|TM9S1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	2-UNIMOD:188,14-UNIMOD:267	ms_run[1]:scan=6272	41.416090000000004	2	1541.834395	1540.818018	R	M	74	88
PSM	MREIVHIQAGQCGNQIGAK	335	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	1-UNIMOD:35,2-UNIMOD:267,12-UNIMOD:4,19-UNIMOD:188	ms_run[1]:scan=3847	26.18526333333333	3	2141.077558	2141.080475	-	F	1	20
PSM	AGKFPSLLTHNENMVAK	336	sp|P62906|RL10A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5997	39.674	2	1855.9615	1855.9615	K	V	131	148
PSM	AGVLAHLEEERDLK	337	sp|P35580|MYH10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5659	37.556	2	1578.8366	1578.8366	R	I	772	786
PSM	ALVHERDEAAYGELR	338	sp|Q9UL46|PSME2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=4012	27.232	2	1727.8591	1727.8591	R	A	189	204
PSM	APKPDGPGGGPGGSHMGGNYGDDR	339	sp|P35637-2|FUS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	16-UNIMOD:35	ms_run[2]:scan=1362	10.898	3	2267.9614	2267.9614	K	R	448	472
PSM	FASHCLMNHPDLAK	340	sp|Q9NTI5-3|PDS5B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	5-UNIMOD:4	ms_run[2]:scan=4293	29.009	2	1639.7599	1639.7599	K	D	336	350
PSM	FKILDAVVAQEPLHR	341	sp|Q15029-2|U5S1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=8366	55.277	3	1734.9781	1734.9781	K	G	754	769
PSM	GAAGHRGEFDALQAR	342	sp|Q7Z2K6|ERMP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:267,15-UNIMOD:267	ms_run[2]:scan=3439	23.684	3	1574.7817	1574.7817	R	D	99	114
PSM	GIGIENIHYLNDGLWHMK	343	sp|Q9ULC4-2|MCTS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	18-UNIMOD:188	ms_run[2]:scan=9938	65.896	3	2115.0667	2115.0667	K	T	149	167
PSM	GIGIENIHYLNDGLWHMK	344	sp|Q9ULC4-2|MCTS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9942	65.921	2	2109.0466	2109.0466	K	T	149	167
PSM	GRPDSLLAYLEQAGASPHR	345	sp|Q9P253|VPS18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9750	64.626	2	2037.0392	2037.0392	R	V	674	693
PSM	HEMPPHIYAITDTAYR	346	sp|P35579-2|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5903	39.076	2	1913.9094	1913.9094	R	S	8	24
PSM	HIHITQATETTTTR	347	sp|Q14677|EPN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:267	ms_run[2]:scan=2088	15.336	3	1618.8303	1618.8303	K	H	261	275
PSM	HLEINPDHPIVETLR	348	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6292	41.536	3	1781.9424	1781.9424	K	Q	625	640
PSM	HLEINPDHPIVETLR	349	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	15-UNIMOD:267	ms_run[2]:scan=6293	41.541	3	1791.9507	1791.9507	K	Q	625	640
PSM	HLEINPDHSIIETLR	350	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7163	47.225	3	1785.9373	1785.9373	K	Q	633	648
PSM	HLHPIQTSFQEATASK	351	sp|Q8TEM1|PO210_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	16-UNIMOD:188	ms_run[2]:scan=4407	29.7	2	1799.9262	1799.9262	R	V	1561	1577
PSM	HLLIGLPSGAILSLPK	352	sp|Q8N766-4|EMC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=10918	73.208	2	1628.0025	1628.0025	R	A	838	854
PSM	HLQLAIRGDEELDSLIK	353	sp|Q71UI9-3|H2AV_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=8908	58.915	2	1949.0582	1949.0582	R	A	48	65
PSM	HYRGPAGDATVASEK	354	sp|Q15758-3|AAAT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=1546	12.014	2	1557.7536	1557.7536	K	E	295	310
PSM	IFCCHGGLSPDLQSMEQIRR	355	sp|P62136-3|PP1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:4,4-UNIMOD:4	ms_run[2]:scan=7345	48.546	3	2403.1246	2403.1246	K	I	125	145
PSM	ILTTASSHEFEHTKK	356	sp|Q16851-2|UGPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=2307	16.663	2	1739.9245	1739.9245	K	D	28	43
PSM	IPGLLSPHPLLQLSYTATDR	357	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=10477	69.989	3	2191.2001	2191.2001	R	H	1256	1276
PSM	ISMPDVDLHLKGPK	358	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7077	46.691	2	1548.8334	1548.8334	K	V	1195	1209
PSM	IVNVSSLAHHLGR	359	sp|Q8TC12-2|RDH11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:267	ms_run[2]:scan=5953	39.396	2	1411.7923	1411.7923	R	I	159	172
PSM	KAHQLWLSVEALK	360	sp|Q16891-3|MIC60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=7396	48.881	2	1533.907	1533.9070	R	Y	533	546
PSM	KGADSLEDFLYHEGYACTSIHGDR	361	sp|O00571-2|DDX3X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	17-UNIMOD:4	ms_run[2]:scan=8969	59.356	3	2740.2187	2740.2187	K	S	436	460
PSM	KHSQFIGYPITLFVEK	362	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9966	66.083	2	1906.0353	1906.0353	K	E	209	225
PSM	KIIFHSGPTNSGK	363	sp|Q8IYB8|SUV3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=1861	13.932	2	1384.7463	1384.7463	R	T	201	214
PSM	KISSIQSIVPALEIANAHR	364	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9052	59.927	3	2046.1586	2046.1586	K	K	250	269
PSM	KNGGLGHMNIALLSDLTK	365	sp|P30048-2|PRDX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=9342	61.857	3	1893.0545	1893.0545	R	Q	131	149
PSM	KPQGVDPASFHFLDTPIAK	366	sp|Q969G9|NKD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=8547	56.479	2	2067.0789	2067.0789	R	V	309	328
PSM	LLMHGKEVGSIIGK	367	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=5101	34.035	2	1492.8838	1492.8838	R	K	18	32
PSM	LNSHMNALHLGSQANR	368	sp|P11413|G6PD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	16-UNIMOD:267	ms_run[2]:scan=4102	27.797	3	1771.8776	1771.8776	R	L	121	137
PSM	LQIRHEQISDLER	369	sp|P29144|TPP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=4756	31.871	2	1635.8693	1635.8693	R	L	890	903
PSM	LREQLQLLEEQHR	370	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:267,13-UNIMOD:267	ms_run[2]:scan=5399	35.903	3	1710.928	1710.9280	R	A	2562	2575
PSM	LREVVETPLLHPER	371	sp|P35998-2|PRS7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5748	38.111	2	1686.9417	1686.9417	K	F	50	64
PSM	LRNEYGPVLHMPTSK	372	sp|O43660-2|PLRG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5418	36.015	2	1740.8981	1740.8981	K	E	48	63
PSM	LTDIHGNVLQYHKDVK	373	sp|O95861-3|BPNT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=4097	27.763	2	1878.9952	1878.9952	K	H	207	223
PSM	LTHYDHVLIELTQAGLK	374	sp|Q14566|MCM6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	17-UNIMOD:188	ms_run[2]:scan=9331	61.78	2	1956.0776	1956.0776	R	G	780	797
PSM	LVEARPMIHELLTEGR	375	sp|Q14974-2|IMB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	5-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=7915	52.324	2	1883.0202	1883.0202	K	R	691	707
PSM	MREIVHLQAGQCGNQIGAK	376	sp|P68371|TBB4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:4	ms_run[2]:scan=4645	31.179	3	2109.0572	2109.0572	-	F	1	20
PSM	MVLAGVGVEHEHLVDCAR	377	sp|Q10713-2|MPPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:35,16-UNIMOD:4,18-UNIMOD:267	ms_run[2]:scan=5391	35.852	3	2016.9749	2016.9749	R	K	120	138
PSM	NCVILPHIGSATHR	378	sp|Q9UBQ7|GRHPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=5024	33.557	2	1583.823	1583.8230	K	T	287	301
PSM	NLKLGIHEDSTNR	379	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=3271	22.617	2	1495.7743	1495.7743	K	R	436	449
PSM	NSDRTPLVSVLLEGPPHSGK	380	sp|P46459-2|NSF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=8496	56.141	2	2102.112	2102.1120	K	T	436	456
PSM	NVLLHQAGEIWHISASPADR	381	sp|Q53HC9|EIPR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	20-UNIMOD:267	ms_run[2]:scan=8545	56.462	3	2223.1424	2223.1424	K	G	58	78
PSM	QALHSLELHYQAFLR	382	sp|Q15149-7|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	15-UNIMOD:267	ms_run[2]:scan=8430	55.7	2	1834.9718	1834.9718	R	D	892	907
PSM	RLLHVAVSDVNDDVR	383	sp|Q99460-2|PSMD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:267,15-UNIMOD:267	ms_run[2]:scan=5022	33.546	3	1726.9229	1726.9229	R	R	601	616
PSM	RTSSAQVEGGVHSLHSYEK	384	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=3035	21.135	3	2071.0083	2071.0083	K	R	493	512
PSM	RVIISAPSADAPMFVMGVNHEK	385	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=8325	55.005	2	2368.2032	2368.2032	K	Y	76	98
PSM	TGTITTFEHAHNMR	386	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=3835	26.113	2	1614.7573	1614.7573	K	V	482	496
PSM	TVQGSGHQEHINIHK	387	sp|Q14247-3|SRC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=1235	10.158	2	1683.8441	1683.8441	K	L	43	58
PSM	VHLVGIDIFTGKK	388	sp|Q9GZV4|IF5A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7939	52.473	2	1425.8344	1425.8344	K	Y	56	69
PSM	VREAFQPQEPDFPPPPPDLEQLR	389	sp|P18206-2|VINC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9399	62.229	3	2701.35	2701.3500	K	L	831	854
PSM	VVEVLAGHGHLYSR	390	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=4581	30.771	2	1535.8209	1535.8209	K	I	1242	1256
PSM	YGPSLMPGGNKEAWPHIK	391	sp|P52209-2|6PGD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7032	46.4	2	1980.988	1980.9880	R	T	124	142
PSM	YGPSLMPGGNKEAWPHIK	392	sp|P52209-2|6PGD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	11-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=7075	46.678	2	1993.0283	1993.0283	R	T	124	142
PSM	VVEVLAGHGHLYSR	393	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	14-UNIMOD:267	ms_run[1]:scan=4578	30.753441666666667	2	1545.839360	1545.829130	K	I	1242	1256
PSM	SLVHDLFQKVEEAK	394	sp|Q9NTJ3|SMC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	9-UNIMOD:188,14-UNIMOD:188	ms_run[1]:scan=9556	63.312355000000004	2	1653.909660	1653.912880	K	S	574	588
PSM	SLVHDLFQKVEEAK	395	sp|Q9NTJ3|SMC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=9557	63.31813666666667	2	1641.869206	1641.872622	K	S	574	588
PSM	YHAASAEEQATIERNPYTIFHQALK	396	sp|Q9Y2R9|RT07_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=7865	52.010153333333335	3	2887.421828	2887.425306	K	N	126	151
PSM	RSYDVPPPPMEPDHPFYSNISK	397	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=7073	46.66607166666667	3	2573.205712	2572.205660	R	D	117	139
PSM	QLQAAAAHWQQHQQHR	398	sp|P49750|YLPM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:28,16-UNIMOD:267	ms_run[1]:scan=5075	33.87114166666667	2	1929.9334	1929.9329	K	V	382	398
PSM	APKPDGPGGGPGGSHMGGNYGDDR	399	sp|P35637|FUS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:188,24-UNIMOD:267	ms_run[1]:scan=2411	17.291558333333334	3	2267.991201	2267.994890	K	R	449	473
PSM	MREIVHIQAGQCGNQIGAK	400	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	1-UNIMOD:35,12-UNIMOD:4	ms_run[1]:scan=4123	27.92653	3	2126.034035	2125.052077	-	F	1	20
PSM	MREIVHIQAGQCGNQIGAK	401	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	1-UNIMOD:35,12-UNIMOD:4	ms_run[1]:scan=4131	27.97875833333333	2	2126.034786	2125.052077	-	F	1	20
PSM	AIQGGTSHHLGQNFSK	402	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=2331	16.806	2	1680.8332	1680.8332	R	M	1235	1251
PSM	ALEHAFQLEHIMDLTR	403	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	16-UNIMOD:267	ms_run[2]:scan=9585	63.507	2	1932.9755	1932.9755	K	L	2436	2452
PSM	ASALRHEEQPAPGYDTHGR	404	sp|Q07157-2|ZO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	5-UNIMOD:267,19-UNIMOD:267	ms_run[2]:scan=1782	13.458	2	2111.0048	2111.0048	R	L	1072	1091
PSM	AVLGEVVLYSGARPLSHQPGPEAPALPK	405	sp|P26640|SYVC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8655	57.196	2	2852.5549	2852.5549	R	T	202	230
PSM	DVGHNIYILAHQLAR	406	sp|Q14571|ITPR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9693	64.244	3	1718.9216	1718.9216	K	H	2103	2118
PSM	FIPHENGVHTIDVK	407	sp|O75369-7|FLNB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	14-UNIMOD:188	ms_run[2]:scan=4390	29.598	2	1610.8512	1610.8512	R	F	2167	2181
PSM	FQEHIIQAPKPVEAIK	408	sp|Q9UHD1-2|CHRD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	10-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=5783	38.327	2	1859.0708	1859.0708	K	R	73	89
PSM	FTYRSDSFENPVLQQHFR	409	sp|P12956-2|XRCC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	4-UNIMOD:267,18-UNIMOD:267	ms_run[2]:scan=7528	49.748	3	2290.1034	2290.1034	R	N	430	448
PSM	GAAGHRGEFDALQAR	410	sp|Q7Z2K6|ERMP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=3437	23.672	3	1554.7651	1554.7651	R	D	99	114
PSM	GATYGKPVHHGVNQLK	411	sp|P61313-2|RL15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	6-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=1353	10.842	2	1716.9462	1716.9462	K	F	78	94
PSM	GQAGGKLHIIEVGTPPTGNQPFPK	412	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6749	44.59	3	2442.3019	2442.3019	R	K	222	246
PSM	GQKIPIFSAAGLPHNEIAAQICR	413	sp|P21281|VATB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	22-UNIMOD:4	ms_run[2]:scan=8765	57.913	3	2490.3165	2490.3165	R	Q	186	209
PSM	HALHCTILASAGQQR	414	sp|Q9BT78-2|CSN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	5-UNIMOD:4	ms_run[2]:scan=3382	23.326	2	1661.842	1661.8420	K	S	228	243
PSM	HIANYISGIQTIGHR	415	sp|Q15393|SF3B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6095	40.281	3	1678.8903	1678.8903	K	V	985	1000
PSM	HIITVDGKPPTWSEFPK	416	sp|O95573|ACSL3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	8-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=7229	47.678	2	1963.0606	1963.0606	R	G	233	250
PSM	HKIISIFSGTEK	417	sp|Q13177|PAK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	2-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=5030	33.597	2	1370.7961	1370.7961	R	G	51	63
PSM	HLDLEKNWMLVEK	418	sp|P55263-3|ADK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	6-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=7835	51.809	2	1665.8951	1665.8951	K	A	166	179
PSM	HVHLENATEYATLR	419	sp|Q96A22|CK052_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=4955	33.125	3	1652.8271	1652.8271	K	F	94	108
PSM	HVVFTAETHNFPTGVCPFSGATTGTGGR	420	sp|O15067|PUR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	16-UNIMOD:4,28-UNIMOD:267	ms_run[2]:scan=7666	50.667	3	2914.3696	2914.3696	R	I	303	331
PSM	ILHLLTQEALSIHGVK	421	sp|P54886-2|P5CS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8198	54.19	3	1771.0356	1771.0356	R	E	513	529
PSM	IRGTSYQSPHGIPIDLLDR	422	sp|Q9Y230-2|RUVB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	2-UNIMOD:267,19-UNIMOD:267	ms_run[2]:scan=7875	52.075	3	2157.1445	2157.1445	R	L	290	309
PSM	IVGCSVHKGFAFVQYVNER	423	sp|P07910-4|HNRPC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	4-UNIMOD:4	ms_run[2]:scan=7106	46.88	3	2209.1102	2209.1102	K	N	43	62
PSM	KGMWSEGNGSHTIR	424	sp|Q7KZF4|SND1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=2936	20.529	2	1558.7311	1558.7311	K	D	161	175
PSM	KLASQGDSISSQLGPIHPPPR	425	sp|Q92945|FUBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5609	37.238	3	2184.1651	2184.1651	K	T	122	143
PSM	KLYVSNLGIGHTR	426	sp|Q06203|PUR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=4755	31.865	2	1456.815	1456.8150	K	Y	81	94
PSM	KNGGLGHMNIALLSDLTK	427	sp|P30048-2|PRDX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9337	61.822	3	1881.0142	1881.0142	R	Q	131	149
PSM	KPAAGLSAAPVPTAPAAGAPLMDFGNDFVPPAPR	428	sp|Q9NQC3-2|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10785	72.211	3	3270.686	3270.6860	R	G	58	92
PSM	LGHGYHTLEDQALYNR	429	sp|P00813|ADA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	16-UNIMOD:267	ms_run[2]:scan=4952	33.107	3	1895.9154	1895.9154	R	L	236	252
PSM	LHELNQKWEALK	430	sp|Q13813-2|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	7-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=5013	33.491	2	1519.855	1519.8550	K	A	865	877
PSM	LHLFASEQREEIIK	431	sp|O75165|DJC13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6050	40.002	2	1711.9257	1711.9257	R	S	179	193
PSM	LLMHGKEVGSIIGK	432	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5103	34.047	2	1480.8436	1480.8436	R	K	18	32
PSM	LQIRHEQISDLER	433	sp|P29144|TPP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	4-UNIMOD:267,13-UNIMOD:267	ms_run[2]:scan=4762	31.91	2	1655.8858	1655.8858	R	L	890	903
PSM	LQSRPAAPPAPGPGQLTLR	434	sp|Q99536|VAT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5624	37.329	3	1926.0799	1926.0799	K	L	64	83
PSM	LRDLHPDLEGQLK	435	sp|Q9NYU2-2|UGGG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=4981	33.292	2	1532.8311	1532.8311	K	E	266	279
PSM	LREVVETPLLHPER	436	sp|P35998-2|PRS7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	2-UNIMOD:267,14-UNIMOD:267	ms_run[2]:scan=5753	38.144	2	1706.9582	1706.9582	K	F	50	64
PSM	MHTTFEHDIQALGTQVR	437	sp|Q01082-3|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:35	ms_run[2]:scan=6791	44.85	3	1998.9582	1998.9582	R	Q	1832	1849
PSM	MLEIDPQKVNINGGAVSLGHPIGMSGAR	438	sp|P24752|THIL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:35	ms_run[2]:scan=8441	55.77	4	2876.4637	2876.4637	K	I	366	394
PSM	MVLAGVGVEHEHLVDCAR	439	sp|Q10713-2|MPPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:35,16-UNIMOD:4,18-UNIMOD:267	ms_run[2]:scan=5402	35.919	2	2016.9749	2016.9749	R	K	120	138
PSM	NPHLNKDLAFTLEER	440	sp|P48163|MAOX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6448	42.54	2	1795.9217	1795.9217	R	Q	21	36
PSM	RDHALLEEQSK	441	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=1502	11.745	2	1324.6735	1324.6735	K	Q	633	644
PSM	RGEAHLAVNDFELAR	442	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6097	40.296	3	1696.8645	1696.8645	R	A	359	374
PSM	RIFHTVTTTDDPVIR	443	sp|O15371-2|EIF3D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=4898	32.764	3	1769.9424	1769.9424	K	K	173	188
PSM	RPELLTHSTTEVTQPR	444	sp|P78347-2|GTF2I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=3797	25.885	3	1883.9968	1883.9968	K	T	499	515
PSM	RSTYNHLSSWLTDAR	445	sp|P61106|RAB14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6498	42.942	2	1805.8809	1805.8809	R	N	96	111
PSM	RYQEALHLGSQLLR	446	sp|O00231|PSD11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:267,14-UNIMOD:267	ms_run[2]:scan=6681	44.152	2	1702.9382	1702.9382	K	E	142	156
PSM	SDFFELLSNHHLDSQSR	447	sp|O14776-2|TCRG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9351	61.917	3	2030.9446	2030.9446	K	W	776	793
PSM	SLHDALCVLAQTVKDSR	448	sp|P78371-2|TCPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	7-UNIMOD:4,14-UNIMOD:188,17-UNIMOD:267	ms_run[2]:scan=10260	68.417	2	1928.012	1924.0239	R	T	342	359
PSM	SLHDALCVLAQTVKDSR	449	sp|P78371-2|TCPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	7-UNIMOD:4	ms_run[2]:scan=10252	68.362	3	1911.9836	1911.9836	R	T	342	359
PSM	SSVHQPGSHYCQGCAYKK	450	sp|Q9P021|CRIPT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:4,14-UNIMOD:4,17-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=1196	9.9226	2	2104.961	2104.9610	K	G	63	81
PSM	TATLRHDADGQATLLNLLLR	451	sp|O43242|PSMD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	5-UNIMOD:267,20-UNIMOD:267	ms_run[2]:scan=10956	73.519	3	2211.2239	2211.2239	R	N	237	257
PSM	VCHAHPTLSEAFR	452	sp|P09622-2|DLDH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	2-UNIMOD:4	ms_run[2]:scan=3858	26.246	2	1523.7303	1523.7303	R	E	384	397
PSM	VHHPDYNNELTQFLPR	453	sp|Q5EBL8|PDZ11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8247	54.505	2	1978.965	1978.9650	R	T	31	47
PSM	VHIPNDDAQFDASHCDSDKGEFGGFGSVTGK	454	sp|Q16576|RBBP7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	15-UNIMOD:4,19-UNIMOD:188,31-UNIMOD:188	ms_run[2]:scan=6930	45.711	3	3305.4722	3305.4722	R	I	83	114
PSM	VILHLKEDQTEYLEER	455	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6093	40.27	3	2014.0371	2014.0371	K	R	186	202
PSM	YHTINGHNAEVR	456	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=1388	11.057	2	1409.68	1409.6800	K	K	162	174
PSM	YQDIIHSIHLAR	457	sp|Q9UIG0-2|BAZ1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:267	ms_run[2]:scan=6773	44.739	2	1474.792	1474.7920	R	K	1021	1033
PSM	SLVHDLFQKVEEAK	458	sp|Q9NTJ3|SMC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	9-UNIMOD:188,14-UNIMOD:188	ms_run[1]:scan=9561	63.34540666666666	3	1653.908007	1653.912880	K	S	574	588
PSM	SHEVKAEGYEVAHGGR	459	sp|P53041|PPP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	5-UNIMOD:188,16-UNIMOD:267	ms_run[1]:scan=1636	12.568546666666666	3	1740.847164	1740.851444	R	C	426	442
PSM	ALVDHHDAEVKEK	460	sp|Q8N2F6|ARM10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	11-UNIMOD:188,13-UNIMOD:188	ms_run[1]:scan=1056	9.085268333333334	2	1501.800189	1501.792764	R	V	323	336
PSM	MREIVHIQAGQCGNQIGAK	461	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	1-UNIMOD:35,12-UNIMOD:4	ms_run[1]:scan=3849	26.194901666666667	3	2125.048977	2125.052077	-	F	1	20
PSM	AAQLVDKDSTFLSTLEHHLSR	462	sp|Q969V3-2|NCLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9638	63.872	2	2367.2183	2367.2183	R	Y	464	485
PSM	ALSQRDPPHNNFFFFDGMK	463	sp|Q9UBE0|SAE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9320	61.708	2	2267.0582	2267.0582	K	G	317	336
PSM	ATIAGGGVIPHIHK	464	sp|Q71UI9-3|H2AV_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=4587	30.809	2	1369.783	1369.7830	K	S	65	79
PSM	CVYKPMQPGPHVVK	465	sp|O75369-7|FLNB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:4,4-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=3429	23.62	2	1650.8777	1650.8777	R	I	247	261
PSM	DLQLLSQFLKHPQK	466	sp|Q9Y653-5|AGRG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9987	66.218	2	1693.9515	1693.9515	R	A	7	21
PSM	FAGLHFFNPVPVMK	467	sp|Q16836|HCDH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10487	70.061	2	1602.8381	1602.8381	R	L	166	180
PSM	FHWEQDQIAHMK	468	sp|Q9UG63|ABCF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:188	ms_run[2]:scan=5650	37.493	2	1574.7396	1574.7396	R	N	328	340
PSM	FTYRSDSFENPVLQQHFR	469	sp|P12956-2|XRCC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7530	49.76	3	2270.0869	2270.0869	R	N	430	448
PSM	FYDQLNHHIFELVSSSDANER	470	sp|P42345|MTOR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9240	61.169	3	2520.167	2520.1670	R	K	63	84
PSM	GAGHMVPTDKPLAAFTMFSR	471	sp|P10619-2|PPGB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9336	61.816	3	2133.05	2133.0500	K	F	437	457
PSM	GHYTEGAELVDSVLDVVRK	472	sp|P68371|TBB4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10893	73.038	3	2086.0695	2086.0695	K	E	104	123
PSM	GPHLVQSDGTVPFWAHAGNAIPSSDQIR	473	sp|P49257|LMAN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8722	57.636	3	2956.458	2956.4580	K	V	54	82
PSM	GPLPLSSQHRGDADQASNILASFGLSAR	474	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	10-UNIMOD:267,28-UNIMOD:267	ms_run[2]:scan=10498	70.143	3	2884.4695	2884.4695	R	D	93	121
PSM	HGYIGEFEIIDDHR	475	sp|P62244|RS15A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	14-UNIMOD:267	ms_run[2]:scan=7140	47.081	2	1709.8037	1709.8037	K	A	44	58
PSM	HHGQEGSILVTK	476	sp|Q9Y5P6|GMPPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:188	ms_run[2]:scan=1939	14.424	2	1310.7038	1310.7038	R	V	126	138
PSM	HKGSPFPEVAESVQQELESYR	477	sp|Q8WVM8-2|SCFD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9978	66.161	3	2416.1659	2416.1659	K	A	237	258
PSM	HLLGAEHGDEPR	478	sp|Q9BV38|WDR18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=1752	13.275	2	1329.6426	1329.6426	K	H	342	354
PSM	HLMHLELDISDSK	479	sp|P16435|NCPR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:188	ms_run[2]:scan=6464	42.664	2	1542.7808	1542.7808	R	I	299	312
PSM	HLVLAGGSKPR	480	sp|O00267-2|SPT5H_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=1590	12.287	3	1133.6669	1133.6669	R	D	638	649
PSM	HLVSAGYVHVNR	481	sp|Q96T60-2|PNKP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=3297	22.782	3	1350.7157	1350.7157	K	D	346	358
PSM	HRPSEADEEELAR	482	sp|O14617-3|AP3D1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=1967	14.594	3	1537.7121	1537.7121	K	R	486	499
PSM	HSSYTCICGSGENSAVLHYGHAGAPNDR	483	sp|P12955-3|PEPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	6-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=4843	32.418	4	3016.294	3016.2941	R	T	174	202
PSM	HVAEVLEYTKDEQLESLFQR	484	sp|P05198|IF2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9565	63.369	3	2433.2176	2433.2176	R	T	114	134
PSM	IGTHNGTFHCDEALACALLR	485	sp|Q9HB07|MYG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	10-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=8220	54.331	3	2255.0576	2255.0576	R	L	47	67
PSM	INMAHLCVIGSHAVNGVAR	486	sp|P11216|PYGB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	7-UNIMOD:4,19-UNIMOD:267	ms_run[2]:scan=6711	44.34	3	2028.0385	2028.0385	R	I	440	459
PSM	IPGLLSPHPLLQLSYTATDR	487	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	20-UNIMOD:267	ms_run[2]:scan=10478	69.996	3	2201.2084	2201.2084	R	H	1256	1276
PSM	KFMADCPHTIGVEFGTR	488	sp|P61106|RAB14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:188,6-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=6349	41.894	2	1980.9521	1976.9639	K	I	35	52
PSM	KHPDASVNFSEFSK	489	sp|P09429|HMGB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5067	33.82	2	1591.7631	1591.7631	K	K	30	44
PSM	KHYEDAQVPLTNHK	490	sp|Q9Y6I4|UBP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=2097	15.389	2	1678.8427	1678.8427	K	K	59	73
PSM	KILALLDALSTVHSQK	491	sp|Q14692|BMS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9702	64.304	3	1736.0196	1736.0196	R	M	1206	1222
PSM	KISSIQSIVPALEIANAHR	492	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9067	60.026	2	2046.1586	2046.1586	K	K	250	269
PSM	KYNPTWHCIVGR	493	sp|Q96FJ2|DYL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	8-UNIMOD:4	ms_run[2]:scan=4912	32.851	2	1529.7562	1529.7562	K	N	49	61
PSM	LTHYDHVLIELTQAGLK	494	sp|Q14566|MCM6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	17-UNIMOD:188	ms_run[2]:scan=9324	61.737	3	1956.0776	1956.0776	R	G	780	797
PSM	LVFHTQLAHGSPTGR	495	sp|O14908|GIPC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=4326	29.218	2	1619.8532	1619.8532	R	I	58	73
PSM	MAQALEELRSQHDEQVR	496	sp|Q03252|LMNB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:35	ms_run[2]:scan=4288	28.979	2	2054.9804	2054.9804	K	L	256	273
PSM	MDLGECLKVHDLALR	497	sp|Q9Y383-3|LC7L2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:35,6-UNIMOD:4	ms_run[2]:scan=6991	46.137	2	1784.8913	1784.8913	R	A	51	66
PSM	MHTTFEHDIQALGTQVR	498	sp|Q01082-3|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:35,17-UNIMOD:267	ms_run[2]:scan=6790	44.845	3	2008.9664	2008.9664	R	Q	1832	1849
PSM	MIPCDFLIPVQTQHPIRK	499	sp|P06744|G6PI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:35,4-UNIMOD:4	ms_run[2]:scan=7840	51.843	2	2208.1547	2208.1548	K	G	401	419
PSM	MREIVHIQAGQCGNQIGTK	500	sp|Q9BUF5|TBB6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:35,2-UNIMOD:267,12-UNIMOD:4,19-UNIMOD:188	ms_run[2]:scan=3840	26.143	2	2171.091	2167.1029	-	F	1	20
PSM	NHDHQEIAVPVANLK	501	sp|O75607|NPM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	15-UNIMOD:188	ms_run[2]:scan=5095	33.997	2	1689.8894	1689.8894	R	L	88	103
PSM	RAGLNEMVEYITHSR	502	sp|Q14738-3|2A5D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:267,15-UNIMOD:267	ms_run[2]:scan=8823	58.301	2	1794.895	1794.8950	K	D	40	55
PSM	SLENYHFVDEHGKDQGINIR	503	sp|Q14677|EPN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5842	38.697	3	2370.1353	2370.1353	R	Q	110	130
PSM	TANKDHLVTAYNHLFETK	504	sp|Q00688|FKBP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	4-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=6126	40.469	3	2113.0995	2113.0995	K	R	53	71
PSM	TEWLDGKHVVFGK	505	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	7-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=6285	41.495	2	1526.8284	1526.8284	K	V	119	132
PSM	TFHFNTVEEVHSR	506	sp|P30740|ILEU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:267	ms_run[2]:scan=4962	33.17	2	1611.7669	1611.7669	K	F	57	70
PSM	TFVHVVPAKPEGTFK	507	sp|Q9P0M9|RM27_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5031	33.603	3	1655.9035	1655.9035	K	L	129	144
PSM	TGHSLLHTLYGR	508	sp|P31040-2|SDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5089	33.962	2	1353.7153	1353.7153	R	S	148	160
PSM	THINIVVIGHVDSGK	509	sp|P68104-2|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	15-UNIMOD:188	ms_run[2]:scan=5634	37.391	3	1593.8934	1593.8934	K	S	6	21
PSM	THINIVVIGHVDSGK	510	sp|P68104-2|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5668	37.609	3	1587.8733	1587.8733	K	S	6	21
PSM	VAIHYINPPNPAKDNFTFK	511	sp|P78406|RAE1L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7556	49.929	2	2185.132	2185.1320	R	C	240	259
PSM	VEFLPVHWHSSLGGDATGVDR	512	sp|Q9Y6Y8-2|S23IP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	21-UNIMOD:267	ms_run[2]:scan=8467	55.943	3	2288.1213	2288.1213	R	N	495	516
PSM	VHVGDEDFVHLR	513	sp|P04080|CYTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5676	37.656	2	1421.7052	1421.7052	K	V	57	69
PSM	VLATEDRSDHLIQTDTVNLHR	514	sp|P51151|RAB9A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5324	35.436	3	2432.2408	2432.2408	R	K	172	193
PSM	VLATEDRSDHLIQTDTVNLHR	515	sp|P51151|RAB9A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	7-UNIMOD:267,21-UNIMOD:267	ms_run[2]:scan=5334	35.498	3	2452.2573	2452.2573	R	K	172	193
PSM	VREAFQPQEPDFPPPPPDLEQLR	516	sp|P18206-2|VINC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9156	60.612	3	2701.35	2701.3500	K	L	831	854
PSM	VREAFQPQEPDFPPPPPDLEQLR	517	sp|P18206-2|VINC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:267,23-UNIMOD:267	ms_run[2]:scan=9158	60.625	3	2721.3666	2721.3666	K	L	831	854
PSM	VREAFQPQEPDFPPPPPDLEQLR	518	sp|P18206-2|VINC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:267,23-UNIMOD:267	ms_run[2]:scan=9724	64.453	3	2721.3666	2721.3666	K	L	831	854
PSM	VYADGIFDLFHSGHAR	519	sp|Q9Y5K3-2|PCY1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	16-UNIMOD:267	ms_run[2]:scan=10026	66.478	2	1813.8775	1813.8775	R	A	79	95
PSM	YHTINGHNAEVR	520	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:267	ms_run[2]:scan=1386	11.046	2	1419.6883	1419.6883	K	K	162	174
PSM	YYVTIIDAPGHRDFIK	521	sp|P68104-2|EF1A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7355	48.608	2	1906.9941	1906.9941	K	N	85	101
PSM	KEVVHTVSLHEIDVINSR	522	sp|Q9Y230|RUVB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=6003	39.71374	3	2075.118683	2074.117103	R	T	236	254
PSM	VHLVGIDIFTGKK	523	sp|P63241|IF5A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=7972	52.69020833333334	2	1425.837307	1425.834386	K	Y	56	69
PSM	HYNGEAYEDDEHHPR	524	sp|P31689|DNJA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1655	12.684551666666666	2	1868.734051	1867.751003	R	G	375	390
PSM	RSYDVPPPPMEPDHPFYSNISK	525	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=7027	46.37103	3	2572.203559	2572.205660	R	D	117	139
PSM	CHAEHTPEEEIDHTGAK	526	sp|O95757|HS74L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	1-UNIMOD:4	ms_run[1]:scan=1887	14.094493333333332	3	1959.832306	1959.838104	K	T	540	557
PSM	TQHHVEALVEHQNGK	527	sp|Q9H0U6|RM18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	15-UNIMOD:188	ms_run[1]:scan=1628	12.520163333333333	2	1732.856204	1731.874809	R	V	86	101
PSM	MREIVHIQAGQCGNQIGAK	528	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	2-UNIMOD:267,12-UNIMOD:4,19-UNIMOD:188	ms_run[1]:scan=4700	31.514021666666668	3	2126.087092	2125.085560	-	F	1	20
PSM	TKGVDEVTIVNILTNR	529	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=10075	66.85839833333333	2	1771.993157	1770.983963	K	S	48	64
PSM	MREIVHIQAGQCGNQIGAK	530	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	1-UNIMOD:35,2-UNIMOD:267,12-UNIMOD:4,19-UNIMOD:188	ms_run[1]:scan=4184	28.312618333333337	2	2142.062561	2141.080475	-	F	1	20
PSM	AGKFPSLLTHNENMVAK	531	sp|P62906|RL10A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	3-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=5996	39.668	2	1868.0017	1868.0017	K	V	131	148
PSM	ASEEHLKQHYIDLK	532	sp|P22392|NDKB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	7-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=3685	25.198	2	1721.9139	1721.9139	R	D	43	57
PSM	ATIAGGGVIPHIHK	533	sp|Q71UI9-3|H2AV_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	14-UNIMOD:188	ms_run[2]:scan=4594	30.854	2	1375.8031	1375.8031	K	S	65	79
PSM	CHAEHTPEEEIDHTGAK	534	sp|O95757|HS74L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:4	ms_run[2]:scan=1898	14.163	2	1959.8381	1959.8381	K	T	540	557
PSM	DHGLLIYHIPQVEPR	535	sp|Q9Y676|RT18B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8056	53.252	2	1785.9526	1785.9526	R	D	159	174
PSM	DHPESYHSFMWNNFFK	536	sp|P46926|GNPI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10279	68.549	2	2084.8839	2084.8839	R	H	80	96
PSM	DHQLLEPIRDFEAR	537	sp|Q14134-2|TRI29_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	9-UNIMOD:267,14-UNIMOD:267	ms_run[2]:scan=7552	49.905	2	1757.8964	1757.8964	R	K	210	224
PSM	FDCHHCNESLFGK	538	sp|Q14192-2|FHL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	3-UNIMOD:4,6-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=4291	28.997	2	1655.6916	1655.6916	R	K	5	18
PSM	FFHETEAPRPK	539	sp|P56556|NDUA6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=2621	18.601	2	1357.6779	1357.6779	R	D	106	117
PSM	FHCPHCDTVIAR	540	sp|P49711-2|CTCF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	3-UNIMOD:4,6-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=2980	20.799	2	1521.6845	1521.6845	K	K	109	121
PSM	FHQNQLLSSLKGEPAPALSSR	541	sp|Q07352|TISB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:188,21-UNIMOD:267	ms_run[2]:scan=6846	45.184	2	2295.2306	2291.2425	K	D	62	83
PSM	FQEHIIQAPKPVEAIK	542	sp|Q9UHD1-2|CHRD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=5789	38.367	3	1859.0708	1859.0708	K	R	73	89
PSM	FTYRSDSFENPVLQQHFR	543	sp|P12956-2|XRCC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	4-UNIMOD:267,18-UNIMOD:267	ms_run[2]:scan=7539	49.818	2	2290.1034	2290.1034	R	N	430	448
PSM	FTYRSDSFENPVLQQHFR	544	sp|P12956-2|XRCC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7543	49.842	2	2270.0869	2270.0869	R	N	430	448
PSM	GFGGITHGPPEKK	545	sp|P49748-2|ACADV_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=2370	17.044	2	1323.6935	1323.6935	R	M	265	278
PSM	GIVKDIIHDPGR	546	sp|P62917|RL8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4541	30.522	2	1318.7357	1318.7357	K	G	43	55
PSM	GKDHVVSDFSEHGSLK	547	sp|P54886-2|P5CS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3216	22.272	3	1740.8431	1740.8431	R	Y	764	780
PSM	GLDPHQALFGTSGEHFNLFSGGSER	548	sp|Q9BRR8|GPTC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	25-UNIMOD:267	ms_run[2]:scan=9806	65.009	3	2669.2498	2669.2498	K	A	240	265
PSM	HFNELEHELQSR	549	sp|Q7Z3C6-3|ATG9A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4982	33.298	2	1537.7274	1537.7274	R	L	342	354
PSM	HFVGMLPEKDCR	550	sp|P60981-2|DEST_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:4	ms_run[2]:scan=3976	26.996	2	1487.7013	1487.7013	K	Y	53	65
PSM	HHVLGTITTDK	551	sp|Q5JPE7-3|NOMO2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=2189	15.954	2	1220.6513	1220.6513	R	M	499	510
PSM	HKPAFTEEDVLNIFPVVK	552	sp|O75153|CLU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=10523	70.321	2	2094.1552	2094.1552	R	H	952	970
PSM	HLHPIQTSFQEATASK	553	sp|Q8TEM1|PO210_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4389	29.592	3	1793.906	1793.9060	R	V	1561	1577
PSM	HLNEIDLFHCIDPNDSK	554	sp|Q15185-3|TEBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=8471	55.972	3	2071.9729	2071.9729	K	H	49	66
PSM	HPGSFDVVHVK	555	sp|P62701|RS4X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3775	25.753	3	1220.6302	1220.6302	R	D	201	212
PSM	HTVTMIPGDGIGPELMLHVK	556	sp|P51553-2|IDH3G_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	20-UNIMOD:188	ms_run[2]:scan=9484	62.81	3	2150.1323	2150.1323	R	S	55	75
PSM	HYFQNTQGLIFVVDSNDRER	557	sp|P84085|ARF5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8103	53.558	3	2437.1775	2437.1775	R	V	80	100
PSM	HYFQNTQGLIFVVDSNDRER	558	sp|P84085|ARF5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	18-UNIMOD:267,20-UNIMOD:267	ms_run[2]:scan=8134	53.764	2	2457.194	2457.1940	R	V	80	100
PSM	IFCCHGGLSPDLQSMEQIRR	559	sp|P62136-3|PP1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	3-UNIMOD:4,4-UNIMOD:4,19-UNIMOD:267,20-UNIMOD:267	ms_run[2]:scan=7352	48.591	3	2423.1411	2423.1411	K	I	125	145
PSM	IHVFYIDYGNREVLPSTR	560	sp|Q7KZF4|SND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:267,18-UNIMOD:267	ms_run[2]:scan=8097	53.518	3	2198.1387	2198.1387	K	L	759	777
PSM	ISMPDFDLHLKGPK	561	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=8296	54.82	2	1608.8737	1608.8737	K	V	2579	2593
PSM	KAHQLWLSVEALK	562	sp|Q16891-3|MIC60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7393	48.86	2	1521.8667	1521.8667	R	Y	533	546
PSM	KFGTINIVHPK	563	sp|Q9Y617-2|SERC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=4485	30.177	2	1264.7694	1264.7694	K	L	117	128
PSM	KFGTINIVHPK	564	sp|Q9Y617-2|SERC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4487	30.187	2	1252.7292	1252.7292	K	L	117	128
PSM	KFVIHPESNNLIIIETDHNAYTEATK	565	sp|Q15393|SF3B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7817	51.693	4	2996.5244	2996.5244	R	A	787	813
PSM	KFVIHPESNNLIIIETDHNAYTEATK	566	sp|Q15393|SF3B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7822	51.722	2	2996.5244	2996.5244	R	A	787	813
PSM	KGADSLEDFLYHEGYACTSIHGDR	567	sp|O00571-2|DDX3X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	17-UNIMOD:4	ms_run[2]:scan=8805	58.182	4	2740.2187	2740.2187	K	S	436	460
PSM	KGHAVGDIPGVR	568	sp|P62266|RS23_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=2675	18.925	2	1204.6677	1204.6677	R	F	108	120
PSM	KHIMGQNVADYMR	569	sp|P46777|RL5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4785	32.054	3	1561.7494	1561.7494	R	Y	197	210
PSM	KHSQFIGYPITLFVEK	570	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=9962	66.054	2	1918.0755	1918.0755	K	E	209	225
PSM	KLHYNEGLNIK	571	sp|Q6NXS1|IPP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=3653	24.996	2	1339.7651	1339.7651	R	L	145	156
PSM	KLHYNEGLNIK	572	sp|Q6NXS1|IPP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=3658	25.029	3	1339.7651	1339.7651	R	L	145	156
PSM	KNGGLGHMNIALLSDLTK	573	sp|P30048-2|PRDX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	8-UNIMOD:35	ms_run[2]:scan=7570	50.018	3	1897.0091	1897.0091	R	Q	131	149
PSM	LKDYAFIHFDER	574	sp|O60506-5|HNRPQ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7057	46.563	2	1552.7674	1552.7674	K	D	218	230
PSM	LLMHGKEVGSIIGK	575	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	6-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=5098	34.018	3	1492.8838	1492.8838	R	K	18	32
PSM	LNHYVLYKAVQGFFTSNNATR	576	sp|O43242|PSMD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10218	68.084	3	2442.2444	2442.2444	R	D	108	129
PSM	MAQALEELRSQHDEQVR	577	sp|Q03252|LMNB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:35	ms_run[2]:scan=4279	28.922	3	2054.9804	2054.9804	K	L	256	273
PSM	MKLPQFGISTPGSDLHVNAK	578	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=8088	53.462	3	2151.1549	2151.1549	K	G	5406	5426
PSM	MKQVEELYHSLLELGEK	579	sp|Q13813-2|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:35	ms_run[2]:scan=9907	65.689	3	2061.0452	2061.0452	R	R	1066	1083
PSM	MKQVEELYHSLLELGEK	580	sp|Q13813-2|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:35	ms_run[2]:scan=9916	65.75	2	2061.0452	2061.0452	R	R	1066	1083
PSM	NIKLGIHEDSQNR	581	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3008	20.968	2	1522.7852	1522.7852	K	K	444	457
PSM	NPQSTEPVLGGGEPPFHGHR	582	sp|Q9BXW7-2|HDHD5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	20-UNIMOD:267	ms_run[2]:scan=4734	31.733	3	2122.022	2122.0220	R	D	340	360
PSM	QVEVTVHKGDECQLVGPAQPSHWK	583	sp|Q15149-7|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:4	ms_run[2]:scan=5273	35.117	2	2728.3391	2728.3391	K	V	785	809
PSM	RAGLNEMVEYITHSR	584	sp|Q14738-3|2A5D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:267,15-UNIMOD:267	ms_run[2]:scan=8822	58.295	3	1794.895	1794.8950	K	D	40	55
PSM	RDHALLEEQSK	585	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=1503	11.749	3	1324.6735	1324.6735	K	Q	633	644
PSM	RDHALLEEQSK	586	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:188	ms_run[2]:scan=1536	11.954	2	1330.6937	1330.6937	K	Q	633	644
PSM	RDPHLACVAYER	587	sp|Q00610-2|CLH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:267,7-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=3253	22.505	2	1505.7312	1505.7312	K	G	912	924
PSM	RHVFGESDELIGQK	588	sp|P60174-4|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4468	30.075	3	1613.8162	1613.8162	R	V	18	32
PSM	RIFHTVTTTDDPVIR	589	sp|O15371-2|EIF3D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4905	32.809	2	1769.9424	1769.9424	K	K	173	188
PSM	RLHGLDEEAEQK	590	sp|P33991|MCM4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=1944	14.452	3	1423.7056	1423.7056	K	L	428	440
PSM	RLQGSGVTVNALHPGVAR	591	sp|Q8NBN7-2|RDH13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4440	29.9	3	1831.0177	1831.0177	R	T	146	164
PSM	RLQYTEHQQLEGWR	592	sp|Q12800-2|TFCP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4934	32.991	2	1842.9125	1842.9125	R	W	128	142
PSM	RPELLTHSTTEVTQPR	593	sp|P78347-2|GTF2I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3789	25.836	3	1863.9803	1863.9803	K	T	499	515
PSM	RSYDVPPPPMEPDHPFYSNISK	594	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6922	45.655	3	2572.2057	2572.2057	R	D	117	139
PSM	RYQEALHLGSQLLR	595	sp|O00231|PSD11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:267,14-UNIMOD:267	ms_run[2]:scan=6680	44.146	3	1702.9382	1702.9382	K	E	142	156
PSM	SHEVKAEGYEVAHGGR	596	sp|P53041|PPP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=1637	12.574	2	1724.823	1724.8230	R	C	426	442
PSM	SHGIDLDHNR	597	sp|Q9NTJ3|SMC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=1589	12.282	2	1162.5479	1162.5479	R	F	215	225
PSM	SHRVPLDVACAR	598	sp|Q15149-7|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:4	ms_run[2]:scan=3052	21.24	3	1379.7092	1379.7092	K	G	3117	3129
PSM	SHVAGQMLHGGGSR	599	sp|P43155-2|CACP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=1354	10.848	2	1392.6681	1392.6681	R	L	281	295
PSM	TGTITTFEHAHNMR	600	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	14-UNIMOD:267	ms_run[2]:scan=3834	26.107	2	1624.7655	1624.7655	K	V	482	496
PSM	TQIALSPNNHEVHIYKK	601	sp|Q92747|ARC1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4106	27.818	2	1991.0589	1991.0589	R	N	21	38
PSM	TTLLHMLKDDR	602	sp|Q9Y6B6|SAR1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5770	38.251	2	1341.7075	1341.7075	K	L	39	50
PSM	VLRHEEFEEGCK	603	sp|Q9HC38-3|GLOD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:4	ms_run[2]:scan=2099	15.405	2	1531.7089	1531.7089	K	A	31	43
PSM	YHTVNGHNCEVR	604	sp|P09651-3|ROA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	9-UNIMOD:4	ms_run[2]:scan=963	8.5492	2	1484.6579	1484.6579	K	K	167	179
PSM	HVVFTAETHNFPTGVCPFSGATTGTGGR	605	sp|O15067|PUR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	16-UNIMOD:4	ms_run[1]:scan=7653	50.575109999999995	2	2905.359393	2904.361326	R	I	303	331
PSM	KAHQLWLSVEALK	606	sp|Q16891|MIC60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:188,13-UNIMOD:188	ms_run[1]:scan=7384	48.801498333333335	2	1533.905771	1533.907006	R	Y	565	578
PSM	LEQSGCYHHCVDENIERR	607	sp|Q969G9|NKD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	6-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=2771	19.523253333333333	3	2301.000904	2301.001498	R	N	239	257
PSM	YHTINGHNCEVKK	608	sp|P51991|ROA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	9-UNIMOD:4,12-UNIMOD:188,13-UNIMOD:188	ms_run[1]:scan=1038	8.979265	2	1611.7952	1610.8022	K	A	188	201
PSM	HLLIGLPSGAILSLPK	609	sp|Q8N766|EMC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=10932	73.313785	3	1628.000629	1628.002514	R	A	860	876
PSM	EVIELPVKHPELFEALGIAQPK	610	sp|P62195|PRS8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=10607	70.96462666666667	3	2457.369670	2456.367898	K	G	163	185
PSM	QLVMNHMHHEDQQVR	611	sp|Q9UI12|VATH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:28,15-UNIMOD:267	ms_run[1]:scan=3825	26.054201666666668	2	1893.8610	1893.8597	K	Y	435	450
PSM	QEQTLQLEQQSKLK	612	sp|Q9NVI7-3|ATD3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0		ms_run[1]:scan=5368	35.71329	2	1700.9312	1699.9102	M	E	2	16
PSM	GIRHEVININLK	613	sp|P78417|GSTO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:267,12-UNIMOD:188	ms_run[1]:scan=5218	34.773021666666665	2	1420.849384	1420.848530	K	N	46	58
PSM	HGVYNPNKIFGVTTLDIVR	614	sp|P40926|MDHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	8-UNIMOD:188,19-UNIMOD:267	ms_run[1]:scan=9211	60.98142166666667	3	2158.192122	2158.186971	K	A	158	177
PSM	AGFRPVEAGGQHGGR	615	sp|O15234|CASC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=1840	13.807	3	1494.744	1494.7440	R	S	324	339
PSM	AHHSSQEMSSEYREYADSFGK	616	sp|Q99447-2|PCY2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5318	35.396	2	2445.0292	2445.0292	K	C	81	102
PSM	AILIFNNHGKPR	617	sp|Q92572|AP3S1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4456	29.999	2	1378.7834	1378.7834	K	L	4	16
PSM	APGPGLAQGLPQLHSLVLR	618	sp|Q8N1G4|LRC47_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	19-UNIMOD:267	ms_run[2]:scan=9809	65.027	3	1933.1137	1933.1137	R	R	65	84
PSM	DLSRFDASFFGVHPK	619	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9033	59.8	3	1721.8526	1721.8526	K	Q	56	71
PSM	DVGPHRDLVGELGTALR	620	sp|P04066|FUCO_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	6-UNIMOD:267,17-UNIMOD:267	ms_run[2]:scan=7734	51.13	3	1823.9757	1823.9757	K	K	157	174
PSM	ELGLGRHENAIK	621	sp|P07384|CAN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=2908	20.359	2	1335.7259	1335.7259	R	Y	25	37
PSM	FEQIYLSKPTHWER	622	sp|P30876|RPB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6207	40.997	2	1832.921	1832.9210	K	D	88	102
PSM	FQEHIIQAPKPVEAIK	623	sp|Q9UHD1-2|CHRD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5780	38.31	3	1847.0305	1847.0305	K	R	73	89
PSM	GAAGHRGEFDALQAR	624	sp|Q7Z2K6|ERMP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=3436	23.666	2	1554.7651	1554.7651	R	D	99	114
PSM	GAAGHRGEFDALQAR	625	sp|Q7Z2K6|ERMP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	6-UNIMOD:267,15-UNIMOD:267	ms_run[2]:scan=3440	23.689	2	1574.7817	1574.7817	R	D	99	114
PSM	GLQCHPSKPLLASCGLDR	626	sp|Q6RFH5-2|WDR74_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	4-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=4784	32.048	3	2007.9982	2007.9983	R	V	274	292
PSM	GQAGGKLHIIEVGTPPTGNQPFPK	627	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	6-UNIMOD:188,24-UNIMOD:188	ms_run[2]:scan=6734	44.491	3	2454.3422	2454.3422	R	K	222	246
PSM	GRPDSLLAYLEQAGASPHR	628	sp|Q9P253|VPS18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:267,19-UNIMOD:267	ms_run[2]:scan=9743	64.583	3	2057.0557	2057.0557	R	V	674	693
PSM	HCVKEVVEAHVDQK	629	sp|P0DPI2|GAL3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:4	ms_run[2]:scan=2556	18.212	3	1676.8304	1676.8304	K	N	220	234
PSM	HGHLCPIDTGLIEK	630	sp|P26358-3|DNMT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	5-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=5296	35.263	2	1594.8233	1594.8233	K	N	80	94
PSM	HHGQEGSILVTK	631	sp|Q9Y5P6|GMPPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=1941	14.436	2	1304.6837	1304.6837	R	V	126	138
PSM	HIAFSGNKWEQK	632	sp|Q9BYD1|RM13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=3643	24.938	2	1443.7259	1443.7259	R	V	64	76
PSM	HIAFSGNKWEQK	633	sp|Q9BYD1|RM13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	8-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=3652	24.991	2	1455.7662	1455.7662	R	V	64	76
PSM	HKELAPYDENWFYTR	634	sp|P39019|RS19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7484	49.466	3	1967.9166	1967.9166	K	A	42	57
PSM	HKIISIFSGTEK	635	sp|Q13177|PAK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5041	33.661	2	1358.7558	1358.7558	R	G	51	63
PSM	HKPAFTEEDVLNIFPVVK	636	sp|O75153|CLU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10522	70.315	2	2082.115	2082.1150	R	H	952	970
PSM	HLETFEHPNVVR	637	sp|Q00534|CDK6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4081	27.663	2	1476.7474	1476.7474	R	L	67	79
PSM	HRPSEADEEELAR	638	sp|O14617-3|AP3D1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=1969	14.605	2	1537.7121	1537.7121	K	R	486	499
PSM	HSVDLIGRPFGSK	639	sp|Q96FX7|TRM61_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5298	35.274	2	1411.7572	1411.7572	R	V	45	58
PSM	HTGFLEISQHSQEFINR	640	sp|Q7L0Y3|TM10C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	17-UNIMOD:267	ms_run[2]:scan=6821	45.041	3	2052.0053	2052.0053	K	L	381	398
PSM	IGTQGNVNFGGRPQLPGSHPASSPAQGNR	641	sp|P43405-2|KSYK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:267,29-UNIMOD:267	ms_run[2]:scan=5155	34.377	3	2920.4555	2920.4555	K	Q	262	291
PSM	IHQIGPGMVQQIQSVCMECQGHGER	642	sp|P31689-2|DNJA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	16-UNIMOD:4,19-UNIMOD:4	ms_run[2]:scan=7297	48.223	3	2878.3095	2878.3095	R	I	162	187
PSM	IHVIDHSGAR	643	sp|Q99426-2|TBCB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=1237	10.169	2	1103.5836	1103.5836	R	L	34	44
PSM	KAHQDIHTQLQDVK	644	sp|O00461|GOLI4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=2142	15.665	2	1659.8693	1659.8693	R	Q	187	201
PSM	KHPDASVNFSEFSK	645	sp|P09429|HMGB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=5062	33.792	3	1603.8033	1603.8033	K	K	30	44
PSM	KLDQEMEQLNHHTTTR	646	sp|Q92878-3|RAD50_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=3430	23.626	3	1979.9483	1979.9483	R	T	381	397
PSM	KSAEFLLHMLK	647	sp|P18621-2|RL17_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=7505	49.601	2	1327.7725	1327.7725	K	N	48	59
PSM	LHELNQKWEALK	648	sp|Q13813-2|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5015	33.502	2	1507.8147	1507.8147	K	A	865	877
PSM	LKLEPHEGLLLR	649	sp|P08195-2|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6116	40.41	3	1416.8453	1416.8453	R	F	513	525
PSM	LKLHCTPGDGQR	650	sp|Q6L8Q7-2|PDE12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	5-UNIMOD:4	ms_run[2]:scan=1597	12.33	2	1380.6932	1380.6932	R	F	246	258
PSM	LLEAFHNQGPVIKR	651	sp|Q9Y2R9|RT07_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5282	35.174	3	1620.91	1620.9100	K	K	209	223
PSM	LLLDIPLQTPHKLVDTGR	652	sp|P0DJD0|RGPD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9128	60.426	2	2028.1732	2028.1732	R	A	1154	1172
PSM	LLMHGKEVGSIIGK	653	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5099	34.023	3	1480.8436	1480.8436	R	K	18	32
PSM	LNSHMNALHLGSQANR	654	sp|P11413|G6PD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4090	27.721	3	1761.8693	1761.8693	R	L	121	137
PSM	LQAEIEGLKGQR	655	sp|P05787|K2C8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4285	28.957	2	1340.7412	1340.7412	R	A	317	329
PSM	LQIRHEQISDLER	656	sp|P29144|TPP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4763	31.915	3	1635.8693	1635.8693	R	L	890	903
PSM	LQSRPAAPPAPGPGQLTLR	657	sp|Q99536|VAT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	4-UNIMOD:267,19-UNIMOD:267	ms_run[2]:scan=5630	37.368	3	1946.0965	1946.0965	K	L	64	83
PSM	LSEVDIDDDERPHNPHK	658	sp|Q6UX04-2|CWC27_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=3223	22.317	2	2014.9344	2014.9344	R	I	144	161
PSM	LSNHISSLFREDQIYR	659	sp|P11413|G6PD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7248	47.842	2	1977.0068	1977.0068	R	I	183	199
PSM	LTHYDHVLIELTQAGLK	660	sp|Q14566|MCM6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9333	61.797	3	1950.0575	1950.0575	R	G	780	797
PSM	LVEARPMIHELLTEGR	661	sp|Q14974-2|IMB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	5-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=7897	52.211	3	1883.0202	1883.0202	K	R	691	707
PSM	MIPCDFLIPVQTQHPIRK	662	sp|P06744|G6PI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	4-UNIMOD:4	ms_run[2]:scan=8677	57.338	2	2192.1598	2192.1598	K	G	401	419
PSM	MKHYEVEILDAK	663	sp|Q9NZ01-2|TECR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:35	ms_run[2]:scan=4738	31.757	2	1490.7439	1490.7439	-	T	1	13
PSM	MKQVEELYHSLLELGEK	664	sp|Q13813-2|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:35,2-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=9917	65.756	2	2073.0855	2073.0855	R	R	1066	1083
PSM	NVPTDVLSFPFHEHLK	665	sp|P58557|YBEY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	16-UNIMOD:188	ms_run[2]:scan=9287	61.489	2	1884.983	1884.9830	R	A	58	74
PSM	QEFAQHANAFHQWIQETR	666	sp|Q13813-2|SPTN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	18-UNIMOD:267	ms_run[2]:scan=7039	46.446	2	2250.0594	2250.0594	R	T	2213	2231
PSM	RHPVCSGTCQPTQFR	667	sp|O43278-2|SPIT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:267,5-UNIMOD:4,9-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=2118	15.522	3	1849.8579	1849.8579	R	C	311	326
PSM	RIEQHYFEDR	668	sp|O75431-2|MTX2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:267,10-UNIMOD:267	ms_run[2]:scan=3051	21.234	2	1411.6747	1411.6747	R	G	238	248
PSM	RSYDVPPPPMEPDHPFYSNISK	669	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6924	45.667	2	2572.2057	2572.2057	R	D	117	139
PSM	RVESPVLPPVLVPR	670	sp|Q99717|SMAD5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8266	54.625	2	1556.9402	1556.9402	K	H	130	144
PSM	RVFITDDFHDMMPK	671	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8346	55.144	2	1750.8171	1750.8171	R	Y	415	429
PSM	RYQEALHLGSQLLR	672	sp|O00231|PSD11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6692	44.222	2	1682.9216	1682.9216	K	E	142	156
PSM	SAFLLQNLLVGHPEHK	673	sp|Q9NZL4|HPBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	16-UNIMOD:188	ms_run[2]:scan=9887	65.557	3	1808.004	1808.0040	K	G	250	266
PSM	SFDLIHSPHGELK	674	sp|Q9UNX4|WDR3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:188	ms_run[2]:scan=5695	37.77	2	1484.7719	1484.7719	K	A	367	380
PSM	SHEVKAEGYEVAHGGR	675	sp|P53041|PPP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	5-UNIMOD:188,16-UNIMOD:267	ms_run[2]:scan=1623	12.492	2	1740.8514	1736.8633	R	C	426	442
PSM	SKGQENDHVHEK	676	sp|Q13427|PPIG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=391	5.2683	2	1418.6941	1418.6941	K	N	725	737
PSM	SRHCPYLDTINR	677	sp|Q53GS9|SNUT2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:267,4-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=3580	24.551	3	1550.7527	1550.7527	R	S	102	114
PSM	TEWLDGKHVVFGK	678	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6298	41.564	2	1514.7882	1514.7882	K	V	119	132
PSM	TGHSLLHTLYGR	679	sp|P31040-2|SDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:267	ms_run[2]:scan=5081	33.911	2	1363.7236	1363.7236	R	S	148	160
PSM	TKGVDEVTIVNILTNR	680	sp|P07355-2|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:188,16-UNIMOD:267	ms_run[2]:scan=10067	66.784	2	1787.0124	1783.0242	K	S	66	82
PSM	VHLVGIDIFTGKK	681	sp|Q9GZV4|IF5A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=7923	52.373	3	1437.8746	1437.8746	K	Y	56	69
PSM	VHVGDEDFVHLR	682	sp|P04080|CYTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:267	ms_run[2]:scan=5670	37.62	3	1431.7134	1431.7134	K	V	57	69
PSM	VHVGDEDFVHLR	683	sp|P04080|CYTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5674	37.647	3	1421.7052	1421.7052	K	V	57	69
PSM	VRAPMVNPTLGVHEADLLK	684	sp|Q13423|NNTM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7567	49.996	3	2059.1248	2059.1248	K	T	128	147
PSM	YHGHSMSDPGVSYR	685	sp|P08559-3|ODPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=2674	18.92	2	1591.6838	1591.6838	R	T	258	272
PSM	YLLHGLECVVAMHQAQLISK	686	sp|P55010|IF5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	8-UNIMOD:4,20-UNIMOD:188	ms_run[2]:scan=9721	64.429	3	2315.2226	2315.2226	R	I	313	333
PSM	YRHSDGNLCVK	687	sp|P49458-2|SRP09_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	9-UNIMOD:4	ms_run[2]:scan=1310	10.585	2	1347.6354	1347.6354	K	V	31	42
PSM	YVLENHPGTNSNYQMHLLKK	688	sp|Q5SSJ5|HP1B3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	19-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=5247	34.955	3	2397.2302	2397.2302	K	T	367	387
PSM	KGLVGPELHDR	689	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=2680	18.958638333333333	2	1219.667707	1219.667320	R	L	3887	3898
PSM	HSQFIGYPITLFVEKER	690	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	15-UNIMOD:188,17-UNIMOD:267	ms_run[1]:scan=10438	69.687935	3	2079.098350	2079.112409	K	D	210	227
PSM	ALEHAFQLEHIMDLTR	691	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=9591	63.5531	3	1922.963140	1922.967267	K	L	2436	2452
PSM	HIADLAGNSEVILPVPAFNVINGGSHAGNK	692	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=10494	70.11343666666667	3	3010.551928	3010.562468	R	L	133	163
PSM	HIADLAGNSEVILPVPAFNVINGGSHAGNK	693	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=10418	69.52804499999999	4	3010.552751	3010.562468	R	L	133	163
PSM	QLLHNFPPDQLTSSGAPFWSGPKR	694	sp|P22314|UBA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28	ms_run[1]:scan=10576	70.7176	3	2662.3291	2662.3287	R	C	724	748
PSM	TGIKNGVHFLQLELINGR	695	sp|Q9HCU5|PREB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=9999	66.2926	3	2009.104571	2008.121794	K	L	39	57
PSM	GEAQVWTQLLRALEER	696	sp|P08514|ITA2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=2567	18.276421666666668	2	1898.028213	1898.001010	R	A	978	994
PSM	VHELKEHNGQVTGIDWAPESNR	697	sp|O15143|ARC1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	5-UNIMOD:188,22-UNIMOD:267	ms_run[1]:scan=5542	36.813590000000005	3	2532.230720	2531.248796	K	I	45	67
PSM	VHELKEHNGQVTGIDWAPESNR	698	sp|O15143|ARC1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	5-UNIMOD:188,22-UNIMOD:267	ms_run[1]:scan=5545	36.82966666666667	2	2532.231671	2531.248796	K	I	45	67
PSM	RSYDVPPPPMEPDHPFYSNISK	699	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=7028	46.3759	2	2573.259810	2572.205660	R	D	117	139
PSM	GRPDSLLAYLEQAGASPHR	700	sp|Q9P253|VPS18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=9744	64.58920166666667	3	2039.041379	2037.039187	R	V	674	693
PSM	AAHFLHGCNSK	701	sp|Q9UJX2-2|CDC23_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	8-UNIMOD:4	ms_run[2]:scan=1225	10.1	2	1240.5771	1240.5771	R	K	102	113
PSM	AGFRPVEAGGQHGGR	702	sp|O15234|CASC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	4-UNIMOD:267,15-UNIMOD:267	ms_run[2]:scan=1830	13.745	2	1514.7605	1514.7605	R	S	324	339
PSM	AHDGGIYAISWSPDSTHLLSASGDKTSK	703	sp|O75083-3|WDR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8189	54.131	2	2900.3941	2900.3941	K	I	92	120
PSM	ALAVNPRDPPSWSVLAGHSR	704	sp|Q9Y490|TLN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	7-UNIMOD:267,20-UNIMOD:267	ms_run[2]:scan=7376	48.749	3	2149.1296	2149.1296	R	T	1619	1639
PSM	AQVPDTVFHHGR	705	sp|Q9Y2G1-2|MYRF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=3414	23.525	2	1362.6793	1362.6793	R	V	539	551
PSM	DGQKHVVTLLQVQDCHVLK	706	sp|P09001|RM03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	15-UNIMOD:4	ms_run[2]:scan=6281	41.47	3	2216.1736	2216.1736	K	Y	113	132
PSM	DKLESEMEDAYHEHQANLLR	707	sp|P23246-2|SFPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7657	50.604	3	2427.1125	2427.1125	K	Q	517	537
PSM	EKANGTTVHVGIHPSK	708	sp|Q9UNX3|RL26L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=1835	13.774	2	1673.8849	1673.8849	R	V	88	104
PSM	ELHINLIPNKQDR	709	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5797	38.42	3	1588.8685	1588.8685	K	T	75	88
PSM	EVEEEPGIHSLKHNK	710	sp|Q9Y4L1-2|HYOU1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=2070	15.224	2	1756.9147	1756.9147	R	R	365	380
PSM	EVIELPVKHPELFEALGIAQPK	711	sp|P62195-2|PRS8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	8-UNIMOD:188,22-UNIMOD:188	ms_run[2]:scan=10601	70.923	3	2468.4082	2468.4082	K	G	155	177
PSM	FNEEHIPDSPFVVPVASPSGDARR	712	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	23-UNIMOD:267,24-UNIMOD:267	ms_run[2]:scan=8278	54.705	3	2642.2992	2642.2992	K	L	2303	2327
PSM	GAGHMVPTDKPLAAFTMFSR	713	sp|P10619-2|PPGB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9339	61.834	2	2133.05	2133.0500	K	F	437	457
PSM	GIRHEVININLK	714	sp|P78417-2|GSTO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5170	34.475	2	1404.8201	1404.8201	K	N	46	58
PSM	GQKIPIFSAAGLPHNEIAAQICR	715	sp|P21281|VATB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	3-UNIMOD:188,22-UNIMOD:4,23-UNIMOD:267	ms_run[2]:scan=8767	57.925	2	2506.3449	2502.3568	R	Q	186	209
PSM	GVDEVTIVNILTNR	716	sp|P07355-2|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	14-UNIMOD:267	ms_run[2]:scan=11124	75.096	2	1551.8496	1551.8496	K	S	68	82
PSM	GVMMHHSNLIAGMTGQCER	717	sp|O60488-2|ACSL4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	17-UNIMOD:4	ms_run[2]:scan=5428	36.076	3	2127.9435	2127.9435	K	I	246	265
PSM	HFEELETIMDRER	718	sp|Q8TAQ2-2|SMRC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7171	47.276	2	1703.7937	1703.7937	R	E	936	949
PSM	HFNELEHELQSR	719	sp|Q7Z3C6-3|ATG9A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:267	ms_run[2]:scan=4971	33.229	3	1547.7356	1547.7356	R	L	342	354
PSM	HGVYNPNKIFGVTTLDIVR	720	sp|P40926|MDHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	8-UNIMOD:188,19-UNIMOD:267	ms_run[2]:scan=9123	60.396	2	2158.187	2154.1988	K	A	158	177
PSM	HHYEQQQEDLAR	721	sp|Q14839|CHD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=1283	10.437	2	1552.7019	1552.7019	R	N	1320	1332
PSM	HKITSADGHIESSALLK	722	sp|Q8N573-6|OXR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=3826	26.06	3	1818.0038	1818.0038	K	E	21	38
PSM	HKLVSDGQALPEMEIHLQTNAEK	723	sp|Q12931-2|TRAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6674	44.109	2	2587.3064	2587.3064	R	G	76	99
PSM	HLEINPDHSIIETLR	724	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	15-UNIMOD:267	ms_run[2]:scan=7156	47.183	3	1795.9456	1795.9456	K	Q	633	648
PSM	HLPSTEPDPHVVR	725	sp|Q9BUJ2-4|HNRL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=3113	21.608	3	1482.7579	1482.7579	K	I	171	184
PSM	HPGSFDVVHVK	726	sp|P62701|RS4X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:188	ms_run[2]:scan=3748	25.59	3	1226.6503	1226.6503	R	D	201	212
PSM	HPGSFDVVHVK	727	sp|P62701|RS4X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:188	ms_run[2]:scan=3757	25.642	2	1226.6503	1226.6503	R	D	201	212
PSM	HSSYTCICGSGENSAVLHYGHAGAPNDR	728	sp|P12955-3|PEPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	6-UNIMOD:4,8-UNIMOD:4,28-UNIMOD:267	ms_run[2]:scan=4849	32.453	2	3026.3023	3026.3023	R	T	174	202
PSM	HVAEDLGKVFGER	729	sp|P40939|ECHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5857	38.789	2	1455.747	1455.7470	K	F	598	611
PSM	IHLRDYVIEDDVNMAIR	730	sp|P49736|MCM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	4-UNIMOD:267,14-UNIMOD:35,17-UNIMOD:267	ms_run[2]:scan=7755	51.275	2	2107.0635	2107.0635	R	V	780	797
PSM	IHQALKEDILEFIK	731	sp|Q93034|CUL5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	6-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=9221	61.046	2	1707.9962	1707.9962	K	Q	61	75
PSM	IRGTSYQSPHGIPIDLLDR	732	sp|Q9Y230-2|RUVB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7872	52.053	3	2137.128	2137.1280	R	L	290	309
PSM	ITAHLVHELR	733	sp|P42765|THIM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=3507	24.106	2	1187.6775	1187.6775	R	R	361	371
PSM	IVGHLTHALK	734	sp|P24752|THIL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2298	16.611	2	1087.6502	1087.6502	R	Q	394	404
PSM	IVGHLTHALK	735	sp|P24752|THIL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:188	ms_run[2]:scan=2300	16.621	2	1093.6703	1093.6703	R	Q	394	404
PSM	KGLVGPELHDR	736	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2654	18.8	2	1219.6673	1219.6673	R	L	3718	3729
PSM	KHPAPPPSNYEILVK	737	sp|Q9Y2L1-2|RRP44_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=4810	32.209	2	1688.925	1688.9250	R	A	660	675
PSM	KHPAPPPSNYEILVK	738	sp|Q9Y2L1-2|RRP44_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=4803	32.165	3	1700.9652	1700.9652	R	A	660	675
PSM	KIHIDLPNEQAR	739	sp|P62333|PRS10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=4605	30.921	2	1432.7787	1432.7787	R	L	298	310
PSM	KNCPHIVVGTPGR	740	sp|Q13838|DX39B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	3-UNIMOD:4	ms_run[2]:scan=2429	17.409	2	1433.7562	1433.7562	K	I	163	176
PSM	KPAAGLSAAPVPTAPAAGAPLMDFGNDFVPPAPR	741	sp|Q9NQC3-2|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	22-UNIMOD:35	ms_run[2]:scan=9885	65.539	3	3286.6809	3286.6809	R	G	58	92
PSM	LAGLLQHPDPIVINHVISVDPNDQK	742	sp|Q92925-3|SMRD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9148	60.559	4	2731.4657	2731.4657	K	K	329	354
PSM	LGGSPTSLGTWGSWIGPDHDKFSAMK	743	sp|P14314-2|GLU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9947	65.957	3	2731.3064	2731.3064	K	Y	436	462
PSM	LGGSPTSLGTWGSWIGPDHDKFSAMK	744	sp|P14314-2|GLU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9956	66.017	2	2731.3064	2731.3064	K	Y	436	462
PSM	LGNDFHTNKR	745	sp|P08708|RS17_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=1097	9.3212	2	1200.6	1200.6000	R	V	24	34
PSM	LGPISPPQPPSVSAWNKPLTSFGSAPSSEGAK	746	sp|Q9Y520-2|PRC2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9791	64.906	3	3190.6299	3190.6299	K	N	1766	1798
PSM	LKLEPHEGLLLR	747	sp|P08195-2|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6117	40.415	2	1416.8453	1416.8453	R	F	513	525
PSM	LKLPSIPLVPVSAQK	748	sp|Q15785|TOM34_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9546	63.247	2	1588.9916	1588.9916	R	R	142	157
PSM	LLQDHPWLLSQNLVVKPDQLIK	749	sp|P53396|ACLY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	16-UNIMOD:188,22-UNIMOD:188	ms_run[2]:scan=10650	71.251	3	2608.5144	2608.5144	R	R	43	65
PSM	LLQDHPWLLSQNLVVKPDQLIK	750	sp|P53396|ACLY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10661	71.323	3	2596.4741	2596.4741	R	R	43	65
PSM	LMKHDVNLGR	751	sp|Q6P2Q9|PRP8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2221	16.141	2	1181.6339	1181.6339	R	A	1142	1152
PSM	LREQLQLLEEQHR	752	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5405	35.94	3	1690.9115	1690.9115	R	A	2562	2575
PSM	LREVVETPLLHPER	753	sp|P35998-2|PRS7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5755	38.156	3	1686.9417	1686.9417	K	F	50	64
PSM	LVFHTQLAHGSPTGR	754	sp|O14908|GIPC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	15-UNIMOD:267	ms_run[2]:scan=4324	29.207	3	1629.8615	1629.8615	R	I	58	73
PSM	MEEDPDDVPHGHITSLAVKR	755	sp|P41227-2|NAA10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:35	ms_run[2]:scan=4353	29.376	3	2261.0746	2261.0746	K	S	60	80
PSM	NEHRPASALVNPLAR	756	sp|O15027-2|SC16A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=4710	31.578	3	1643.8856	1643.8856	K	G	325	340
PSM	NLFNVVDCKLHWQK	757	sp|P55884|EIF3B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	8-UNIMOD:4	ms_run[2]:scan=9034	59.806	2	1799.9141	1799.9141	R	N	508	522
PSM	QLFHPEQLITGKEDAANNYAR	758	sp|P68363-2|TBA1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7174	47.294	2	2414.1979	2414.1979	R	G	85	106
PSM	RALIVLAHSER	759	sp|P15559-3|NQO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=3575	24.519	2	1263.7412	1263.7412	R	T	5	16
PSM	RHVFGESDELIGQK	760	sp|P60174-4|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:267,14-UNIMOD:188	ms_run[2]:scan=4462	30.038	2	1629.8446	1625.8564	R	V	18	32
PSM	RPLDDGVGNQLGALVHQR	761	sp|Q96I24|FUBP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6989	46.125	3	1944.029	1944.0290	K	T	58	76
PSM	RQHEAEEGVR	762	sp|Q15149-7|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=580	6.3565	2	1209.585	1209.5850	R	R	2526	2536
PSM	RVDPVYIHLAER	763	sp|Q13085-3|ACACA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5420	36.028	3	1466.7994	1466.7994	R	L	2061	2073
PSM	SHRTEMDWVLK	764	sp|P52597|HNRPF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5612	37.26	2	1400.6871	1400.6871	K	H	88	99
PSM	SPNRDFLTHVSAR	765	sp|O15067|PUR4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=4073	27.615	2	1498.7641	1498.7641	R	E	569	582
PSM	SYELPDGQVITIGNER	766	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8960	59.292	2	1789.8846	1789.8846	K	F	239	255
PSM	TFHFNTVEEVHSR	767	sp|P30740|ILEU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=4959	33.153	3	1601.7587	1601.7587	K	F	57	70
PSM	TFHFNTVEEVHSR	768	sp|P30740|ILEU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	13-UNIMOD:267	ms_run[2]:scan=4961	33.165	3	1611.7669	1611.7669	K	F	57	70
PSM	TSMESLIHHFK	769	sp|O75306-2|NDUS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6377	42.071	2	1328.6547	1328.6547	K	L	373	384
PSM	VCGQEEVLQNNHCLGSHEHIQNCR	770	sp|O00443|P3C2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:4,13-UNIMOD:4,23-UNIMOD:4,24-UNIMOD:267	ms_run[2]:scan=3954	26.855	3	2927.2849	2927.2849	K	K	474	498
PSM	VCHAHPTLSEAFR	771	sp|P09622-2|DLDH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=3859	26.251	2	1533.7386	1533.7386	R	E	384	397
PSM	VHMFEAHSDYIR	772	sp|P35606-2|COPB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=4856	32.499	2	1503.6929	1503.6929	R	C	63	75
PSM	VKIGHYILGDTLGVGTFGK	773	sp|Q13131|AAPK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8993	59.525	2	1974.0938	1974.0938	R	V	22	41
PSM	VYLLYRPGHYDILYK	774	sp|Q96FW1|OTUB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8400	55.502	2	1912.0247	1912.0247	K	-	257	272
PSM	WVPEITHHCPK	775	sp|P60953-1|CDC42_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	9-UNIMOD:4,11-UNIMOD:188	ms_run[2]:scan=3759	25.653	2	1408.7017	1408.7017	K	T	97	108
PSM	YGAHNYHPLPVALER	776	sp|P04181|OAT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5292	35.235	2	1735.8794	1735.8794	K	G	50	65
PSM	YQHTGAVLDCAFYDPTHAWSGGLDHQLK	777	sp|O43684-2|BUB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:4,28-UNIMOD:188	ms_run[2]:scan=9105	60.28	4	3192.4819	3192.4819	K	M	53	81
PSM	YVATLGVEVHPLVFHTNR	778	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	18-UNIMOD:267	ms_run[2]:scan=8094	53.501	3	2061.1035	2061.1035	K	G	39	57
PSM	RDHALLEEQSK	779	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:267,11-UNIMOD:188	ms_run[1]:scan=1607	12.391811666666667	2	1340.706921	1340.701926	K	Q	633	644
PSM	HIADLAGNSEVILPVPAFNVINGGSHAGNK	780	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	30-UNIMOD:188	ms_run[1]:scan=10636	71.15557166666667	3	3017.564614	3016.582597	R	L	133	163
PSM	ALTGGIAHLFKQNK	781	sp|P09622|DLDH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=6185	40.859051666666666	2	1496.852530	1496.846347	K	V	133	147
PSM	CGEDYKLHFIFR	782	sp|P27824|CALX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:4,6-UNIMOD:188,12-UNIMOD:267	ms_run[1]:scan=7574	50.03834333333334	2	1599.811960	1599.783882	K	H	194	206
PSM	HLLIGLPSGAILSLPK	783	sp|Q8N766|EMC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	16-UNIMOD:188	ms_run[1]:scan=10917	73.20194333333333	2	1634.022708	1634.022643	R	A	860	876
PSM	QLQAAAAHWQQHQQHR	784	sp|P49750|YLPM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28,16-UNIMOD:267	ms_run[1]:scan=5073	33.858955	3	1929.9332	1929.9329	K	V	382	398
PSM	RLQGSGVTVNALHPGVAR	785	sp|Q8NBN7|RDH13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:267,18-UNIMOD:267	ms_run[1]:scan=4454	29.986695	2	1851.043186	1851.034201	R	T	217	235
PSM	APKPDGPGGGPGGSHMGGNYGDDR	786	sp|P35637|FUS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=2418	17.337306666666667	2	2251.963875	2251.966492	K	R	449	473
PSM	LAGLLQHPDPIVINHVISVDPNDQK	787	sp|Q92925|SMRD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=9165	60.67105333333333	3	2732.476192	2731.465714	K	K	377	402
PSM	KQGGLGPMNIPLVSD	788	sp|Q06830|PRDX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0		ms_run[1]:scan=9381	62.11160166666667	2	1524.8016	1524.7965	K	P	93	108
PSM	EIGGDVQKHAEMVHTGLK	789	sp|Q01518|CAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=4554	30.601718333333334	2	1948.985223	1947.983646	K	L	64	82
PSM	IQEVFSSYKFNHLVPR	790	sp|P49356|FNTB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=7687	50.81585833333333	2	1964.018180	1963.031582	K	L	55	71
PSM	MREIVHIQAGQCGNQIGAK	791	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:35,12-UNIMOD:4	ms_run[1]:scan=4348	29.3451	3	2126.035649	2125.052077	-	F	1	20
PSM	AHGLLAEENRGLGER	792	sp|Q14980-4|NUMA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=3790	25.841	2	1620.8332	1620.8332	K	A	1443	1458
PSM	ALIDPSSGLPNRLPPGAVPPGAR	793	sp|Q92530|PSMF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:267,23-UNIMOD:267	ms_run[2]:scan=7780	51.443	3	2271.2602	2271.2602	R	F	220	243
PSM	ALVHERDEAAYGELR	794	sp|Q9UL46|PSME2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4011	27.226	3	1727.8591	1727.8591	R	A	189	204
PSM	ASEEHLKQHYIDLK	795	sp|P22392|NDKB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=3686	25.204	2	1709.8737	1709.8737	R	D	43	57
PSM	CYECGEKGHYAYDCHR	796	sp|Q16629-3|SRSF7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:4,4-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=1893	14.133	3	2103.7986	2103.7986	R	Y	106	122
PSM	DKLESEMEDAYHEHQANLLR	797	sp|P23246-2|SFPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7665	50.661	4	2427.1125	2427.1125	K	Q	517	537
PSM	FASHCLMNHPDLAK	798	sp|Q9NTI5-3|PDS5B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	5-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=4294	29.015	2	1645.78	1645.7800	K	D	336	350
PSM	FDPYEHEALFHTPVEGKEPGTVALVSK	799	sp|Q9HAV7|GRPE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7921	52.363	3	2996.492	2996.4920	K	V	170	197
PSM	FDPYEHEALFHTPVEGKEPGTVALVSK	800	sp|Q9HAV7|GRPE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	17-UNIMOD:188,27-UNIMOD:188	ms_run[2]:scan=7929	52.412	3	3008.5322	3008.5322	K	V	170	197
PSM	FDSSHDRNEPFVFSLGK	801	sp|Q13451-2|FKBP5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=8001	52.886	2	1980.933	1980.9330	K	G	67	84
PSM	FHWEQDQIAHMK	802	sp|Q9UG63|ABCF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:188	ms_run[2]:scan=5647	37.475	3	1574.7396	1574.7396	R	N	328	340
PSM	FQGIKHECQANGPEDLNR	803	sp|P60981-2|DEST_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	5-UNIMOD:188,8-UNIMOD:4,18-UNIMOD:267	ms_run[2]:scan=3392	23.388	2	2128.0091	2124.0209	K	A	111	129
PSM	GFGGITHGPPEKK	804	sp|P49748-2|ACADV_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=2364	17.007	2	1335.7338	1335.7338	R	M	265	278
PSM	GGHFYSAKPEILR	805	sp|P52701-2|MSH6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4500	30.264	2	1473.7728	1473.7728	K	A	162	175
PSM	GHGLQELKAELDAAVLK	806	sp|O43824|GTPB6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9340	61.84	3	1790.989	1790.9890	R	A	441	458
PSM	GIGIENIHYLNDGLWHMK	807	sp|Q9ULC4-2|MCTS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	17-UNIMOD:35	ms_run[2]:scan=9054	59.939	2	2125.0415	2125.0415	K	T	149	167
PSM	GLGAFVIDSDHLGHR	808	sp|Q13057|COASY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7034	46.413	2	1592.8059	1592.8059	K	A	380	395
PSM	GQAGGKLHIIEVGTPPTGNQPFPK	809	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6732	44.479	2	2442.3019	2442.3019	R	K	222	246
PSM	GVDEVTIVNILTNR	810	sp|P07355-2|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11133	75.162	2	1541.8413	1541.8413	K	S	68	82
PSM	HGNQYIQVNEPWKR	811	sp|P56192|SYMC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	13-UNIMOD:188,14-UNIMOD:267	ms_run[2]:scan=5344	35.559	2	1783.9089	1779.9208	R	I	714	728
PSM	HKELAPYDENWFYTR	812	sp|P39019|RS19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:188,15-UNIMOD:267	ms_run[2]:scan=7483	49.461	2	1983.945	1979.9569	K	A	42	57
PSM	HKSIEEIVR	813	sp|P39748-2|FEN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2714	19.165	2	1109.6193	1109.6193	K	R	189	198
PSM	HLAFIDQLIEDKK	814	sp|Q9UPN4-3|CP131_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=8683	57.379	3	1568.8562	1568.8562	R	V	627	640
PSM	HLEFSHDQYR	815	sp|Q9NR45|SIAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:267	ms_run[2]:scan=2917	20.416	3	1340.6137	1340.6137	R	E	87	97
PSM	HLETFEHPNVVR	816	sp|Q00534|CDK6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4063	27.557	3	1476.7474	1476.7474	R	L	67	79
PSM	HLREYQDLLNVK	817	sp|P08670|VIME_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5882	38.947	2	1526.8205	1526.8205	R	M	379	391
PSM	HLTHENVQR	818	sp|Q12874|SF3A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:267	ms_run[2]:scan=686	6.9416	2	1142.582	1142.5820	R	K	339	348
PSM	HPAKPDPSGECNPDLR	819	sp|Q16576|RBBP7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:4	ms_run[2]:scan=1866	13.965	3	1788.8213	1788.8213	K	L	156	172
PSM	HPGSFDVVHVK	820	sp|P62701|RS4X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=3755	25.627	2	1220.6302	1220.6302	R	D	201	212
PSM	HSQFIGYPITLFVEKER	821	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	15-UNIMOD:188,17-UNIMOD:267	ms_run[2]:scan=10031	66.512	3	2079.1124	2075.1243	K	D	210	227
PSM	HSQFIGYPITLFVEKER	822	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	15-UNIMOD:188,17-UNIMOD:267	ms_run[2]:scan=10146	67.527	3	2079.1124	2075.1243	K	D	210	227
PSM	HTGFLEISQHSQEFINR	823	sp|Q7L0Y3|TM10C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6822	45.046	3	2041.997	2041.9970	K	L	381	398
PSM	IAVDEVHCCSQWGHDFRPDYK	824	sp|P46063|RECQ1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	8-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=6215	41.045	2	2618.1431	2618.1431	R	A	216	237
PSM	IGDLQAFQGHGAGNLAGLKGR	825	sp|P08195-2|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6673	44.103	4	2079.0974	2079.0974	R	L	126	147
PSM	IHQIGPGMVQQIQSVCMECQGHGER	826	sp|P31689-2|DNJA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	16-UNIMOD:4,19-UNIMOD:4,25-UNIMOD:267	ms_run[2]:scan=7305	48.281	3	2888.3178	2888.3178	R	I	162	187
PSM	IKGEHPGLSIGDVAK	827	sp|P09429|HMGB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4342	29.315	3	1519.8358	1519.8358	K	K	113	128
PSM	ILAHLTGTEFMQDPDEEHLKK	828	sp|Q9NR12-5|PDLI7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	20-UNIMOD:188,21-UNIMOD:188	ms_run[2]:scan=6575	43.473	3	2463.2507	2463.2507	R	S	169	190
PSM	IPVHPNDHVNK	829	sp|P07954-2|FUMH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=1296	10.512	2	1268.6626	1268.6626	K	S	130	141
PSM	IPVHPNDHVNK	830	sp|P07954-2|FUMH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:188	ms_run[2]:scan=1297	10.517	2	1274.6827	1274.6827	K	S	130	141
PSM	IQVWHEEHR	831	sp|P26038|MOES_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:267	ms_run[2]:scan=2689	19.01	2	1242.6133	1242.6133	R	G	172	181
PSM	IQVWHEEHR	832	sp|P26038|MOES_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2690	19.015	2	1232.6051	1232.6051	R	G	172	181
PSM	ITSVAWSPHHDGR	833	sp|Q8TEQ6|GEMI5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	13-UNIMOD:267	ms_run[2]:scan=3321	22.936	2	1471.7196	1471.7196	K	L	642	655
PSM	IVGCSVHKGFAFVQYVNER	834	sp|P07910-4|HNRPC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	4-UNIMOD:4,8-UNIMOD:188,19-UNIMOD:267	ms_run[2]:scan=7111	46.909	2	2225.1386	2221.1505	K	N	43	62
PSM	KDHPFGFVAVPTK	835	sp|P63279|UBC9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5840	38.682	2	1441.7718	1441.7718	R	N	18	31
PSM	KGADSLEDFLYHEGYACTSIHGDR	836	sp|O00571-2|DDX3X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	17-UNIMOD:4	ms_run[2]:scan=8952	59.23	4	2740.2187	2740.2187	K	S	436	460
PSM	KHPAPPPSNYEILVK	837	sp|Q9Y2L1-2|RRP44_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4802	32.16	3	1688.925	1688.9250	R	A	660	675
PSM	LDHKFDLMYAK	838	sp|P68363-2|TBA1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5681	37.682	2	1379.6908	1379.6908	R	R	275	286
PSM	LGHGYHTLEDQALYNR	839	sp|P00813|ADA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4946	33.065	3	1885.9071	1885.9071	R	L	236	252
PSM	LKDYAFVHFEDR	840	sp|O43390-4|HNRPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6296	41.555	3	1538.7518	1538.7518	K	G	275	287
PSM	LKLEQIDGHIAEHNSK	841	sp|Q9NTJ3|SMC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4377	29.521	3	1830.9588	1830.9588	K	I	1016	1032
PSM	LSPFMADIRDAPQDFHPDR	842	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:267,19-UNIMOD:267	ms_run[2]:scan=8560	56.566	2	2247.0646	2247.0646	R	V	656	675
PSM	LVNHFVEEFKR	843	sp|P0DMV8-2|HS71A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5392	35.859	2	1416.7514	1416.7514	R	K	182	193
PSM	MHFESGSTLKK	844	sp|P15374|UCHL3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:35	ms_run[2]:scan=1217	10.051	2	1279.6231	1279.6231	K	F	111	122
PSM	MKHYEVEILDAK	845	sp|Q9NZ01-2|TECR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:35	ms_run[2]:scan=4747	31.814	3	1490.7439	1490.7439	-	T	1	13
PSM	NFYQEHPDLARR	846	sp|P17844|DDX5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:267,12-UNIMOD:267	ms_run[2]:scan=3814	25.987	2	1564.765	1564.7650	K	T	57	69
PSM	NMSVIAHVDHGKSTLTDSLVCK	847	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	21-UNIMOD:4	ms_run[2]:scan=6094	40.275	3	2411.1937	2411.1937	R	A	21	43
PSM	NSHLINVLMWELEKK	848	sp|O15372|EIF3H_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	14-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=10632	71.132	3	1865.0272	1865.0272	K	S	207	222
PSM	NVLLHQAGEIWHISASPADR	849	sp|Q53HC9|EIPR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=8528	56.348	3	2213.1341	2213.1341	K	G	58	78
PSM	QESLPHAGPIIVHCSAGIGR	850	sp|P29350-2|PTN6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	14-UNIMOD:4	ms_run[2]:scan=5741	38.064	3	2098.0742	2098.0742	R	T	401	421
PSM	QWHVEHFVCAK	851	sp|Q7Z4I7-4|LIMS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:4,11-UNIMOD:188	ms_run[2]:scan=4861	32.532	2	1445.697	1445.6970	K	C	64	75
PSM	RAHLTVGQAAAGGSGNLLTER	852	sp|Q99959-2|PKP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5117	34.138	3	2078.0981	2078.0981	R	S	316	337
PSM	RFTVAHTCFDVDNGTSAGR	853	sp|Q08499-7|PDE4D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	8-UNIMOD:4	ms_run[2]:scan=5283	35.18	3	2109.965	2109.9650	R	S	81	100
PSM	RGFGFVTFDDHDPVDK	854	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7589	50.135	3	1850.8588	1850.8588	K	I	141	157
PSM	RHPVCSGTCQPTQFR	855	sp|O43278-2|SPIT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	5-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=2117	15.516	3	1829.8414	1829.8414	R	C	311	326
PSM	RYQEALHLGSQLLR	856	sp|O00231|PSD11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6682	44.158	3	1682.9216	1682.9216	K	E	142	156
PSM	SESNRFPLPFPFPSK	857	sp|Q96SY0-4|INT14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10369	69.187	2	1748.8886	1748.8886	R	L	58	73
PSM	SLDMDSIIAEVK	858	sp|P05787|K2C8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:188	ms_run[2]:scan=10194	67.908	2	1325.6844	1325.6844	R	A	253	265
PSM	SLEDALSSDTSGHFRR	859	sp|P08133|ANXA6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	15-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=5878	38.925	2	1796.8556	1796.8556	K	I	484	500
PSM	SREAIDSPVSFLALHNQIR	860	sp|Q92900-2|RENT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=8809	58.207	3	2152.1389	2152.1389	K	N	548	567
PSM	TFSGQTHGFVHR	861	sp|Q96DG6|CMBL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2750	19.387	2	1372.6636	1372.6636	K	K	206	218
PSM	TIHTDVLFGLLKK	862	sp|Q14562|DHX8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=9170	60.706	3	1495.9165	1495.9165	R	T	691	704
PSM	TPLTSADEHVHSKLEGSK	863	sp|Q5SW79-2|CE170_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=3617	24.777	3	1934.9698	1934.9698	R	V	957	975
PSM	VAIHYINPPNPAKDNFTFK	864	sp|P78406|RAE1L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	13-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=7466	49.35	3	2197.1723	2197.1723	R	C	240	259
PSM	VHLVGIDIFTGKK	865	sp|Q9GZV4|IF5A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7931	52.422	3	1425.8344	1425.8344	K	Y	56	69
PSM	VVEVLAGHGHLYSR	866	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4576	30.742	3	1535.8209	1535.8209	K	I	1242	1256
PSM	YNDKHIPGSPFTAK	867	sp|O75369-7|FLNB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	4-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=4260	28.806	2	1585.8291	1585.8291	K	I	1714	1728
PSM	TKGVDEVTIVNILTNR	868	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	2-UNIMOD:188,16-UNIMOD:267	ms_run[1]:scan=10066	66.77772	3	1787.013807	1787.012361	K	S	48	64
PSM	HGNQYIQVNEPWKR	869	sp|P56192|SYMC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=5332	35.486983333333335	3	1768.877300	1767.880501	R	I	714	728
PSM	HYNGEAYEDDEHHPR	870	sp|P31689|DNJA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1645	12.621931666666667	3	1868.732955	1867.751003	R	G	375	390
PSM	HIADLAGNSEVILPVPAFNVINGGSHAGNK	871	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	30-UNIMOD:188	ms_run[1]:scan=10385	69.303415	3	3016.570203	3016.582597	R	L	133	163
PSM	CGEDYKLHFIFR	872	sp|P27824|CALX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=9135	60.47311	3	1566.7302	1566.7284	K	H	194	206
PSM	IGKPHTVPCK	873	sp|P15880|RS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	9-UNIMOD:4	ms_run[1]:scan=868	7.988578333333334	2	1135.624254	1135.617199	K	V	174	184
PSM	HLTHENVQR	874	sp|Q12874|SF3A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=687	6.945835000000001	2	1132.574383	1132.573754	R	K	339	348
PSM	VLVPEHEKDVLEWIACVR	875	sp|P48147|PPCE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	16-UNIMOD:4	ms_run[1]:scan=10755	71.99327166666667	3	2192.130167	2191.145960	K	S	328	346
PSM	KQGGLGPMNIPLVSD	876	sp|Q06830|PRDX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:188	ms_run[1]:scan=9387	62.152448333333325	2	1530.8215	1530.8166	K	P	93	108
PSM	ILLDHEKEWK	877	sp|P54136|SYRC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	7-UNIMOD:188,10-UNIMOD:188	ms_run[1]:scan=4398	29.648098333333333	2	1321.750215	1321.743295	K	L	564	574
PSM	THINIVVIGHVDSGK	878	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	15-UNIMOD:188	ms_run[1]:scan=5665	37.595325	3	1593.892458	1593.893419	K	S	6	21
PSM	ICKGDHWTTR	879	sp|O75821|EIF3G_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	2-UNIMOD:4,3-UNIMOD:188,10-UNIMOD:267	ms_run[1]:scan=1448	11.423635	2	1290.633877	1288.631738	R	C	159	169
PSM	QLFALYSGNDVTDISDDRFPK	880	sp|P00739|HPTR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=5858	38.794235	2	2400.140360	2400.159755	R	P	16	37