MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000208 -- new
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220618\20220618002634800212^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\111222_HL18.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220618\20220618002634800212^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\111222_HL18.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Acetyl (Protein N-term),Label:13C(6) (K),Label:13C(6)15N(4) (R),Oxidation (M)
MTD	software[1]-setting	maxMissedCleavages=1
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=40
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Label:13C(6) (K),Label:13C(6)15N(4) (R),Acetyl (Protein N-term)
MTD	software[2]-setting	TOL(-)=20
MTD	software[2]-setting	TOL(+)=20
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=1000
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=1
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Acetyl (Protein N-term),Label:13C(6) (K),Label:13C(6)15N(4) (R),Oxidation (M)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=1
MTD	software[3]-setting	peptide_mass_tolerance=20
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:1, Acetyl,]
MTD	variable_mod[1]-site	N-term
MTD	variable_mod[1]-position	Protein N-term
MTD	variable_mod[2]	[UNIMOD, UNIMOD:188, Label:13C(6),]
MTD	variable_mod[2]-site	K
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:267, Label:13C(6)15N(4),]
MTD	variable_mod[3]-site	R
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[4]-site	M
MTD	variable_mod[4]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	790-UNIMOD:267,802-UNIMOD:267	0.02	44.0	4	2	1
PRT	sp|O94832|MYO1D_HUMAN	Unconventional myosin-Id OS=Homo sapiens OX=9606 GN=MYO1D PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	970-UNIMOD:4,975-UNIMOD:188,976-UNIMOD:188,74-UNIMOD:267,87-UNIMOD:188	0.04	44.0	5	2	1
PRT	sp|P00491|PNPH_HUMAN	Purine nucleoside phosphorylase OS=Homo sapiens OX=9606 GN=PNP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	31-UNIMOD:4	0.07	44.0	1	1	1
PRT	sp|P17858|PFKAL_HUMAN	ATP-dependent 6-phosphofructokinase, liver type OS=Homo sapiens OX=9606 GN=PFKL PE=1 SV=6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	444-UNIMOD:188	0.03	44.0	3	1	0
PRT	sp|P41250|GARS_HUMAN	Glycine--tRNA ligase OS=Homo sapiens OX=9606 GN=GARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	596-UNIMOD:267	0.04	42.0	4	2	0
PRT	sp|P22695|QCR2_HUMAN	Cytochrome b-c1 complex subunit 2, mitochondrial OS=Homo sapiens OX=9606 GN=UQCRC2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	301-UNIMOD:267,315-UNIMOD:188	0.09	42.0	6	2	0
PRT	sp|Q92945|FUBP2_HUMAN	Far upstream element-binding protein 2 OS=Homo sapiens OX=9606 GN=KHSRP PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	42.0	null	142-UNIMOD:267	0.03	42.0	4	1	0
PRT	sp|P29083|T2EA_HUMAN	General transcription factor IIE subunit 1 OS=Homo sapiens OX=9606 GN=GTF2E1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	236-UNIMOD:267	0.04	41.0	4	1	0
PRT	sp|P11216|PYGB_HUMAN	Glycogen phosphorylase, brain form OS=Homo sapiens OX=9606 GN=PYGB PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.02	41.0	1	1	1
PRT	sp|P63244|RACK1_HUMAN	Receptor of activated protein C kinase 1 OS=Homo sapiens OX=9606 GN=RACK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	41.0	null	207-UNIMOD:4	0.09	41.0	2	1	0
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	767-UNIMOD:267,785-UNIMOD:188	0.02	41.0	3	1	0
PRT	sp|O76003|GLRX3_HUMAN	Glutaredoxin-3 OS=Homo sapiens OX=9606 GN=GLRX3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.07	40.0	2	1	0
PRT	sp|P31689|DNJA1_HUMAN	DnaJ homolog subfamily A member 1 OS=Homo sapiens OX=9606 GN=DNAJA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null	389-UNIMOD:267	0.04	40.0	8	1	0
PRT	sp|O75832-2|PSD10_HUMAN	Isoform 2 of 26S proteasome non-ATPase regulatory subunit 10 OS=Homo sapiens OX=9606 GN=PSMD10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.13	40.0	2	1	0
PRT	sp|Q14677|EPN4_HUMAN	Clathrin interactor 1 OS=Homo sapiens OX=9606 GN=CLINT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null	122-UNIMOD:188,129-UNIMOD:267	0.03	40.0	3	1	0
PRT	sp|O15143|ARC1B_HUMAN	Actin-related protein 2/3 complex subunit 1B OS=Homo sapiens OX=9606 GN=ARPC1B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null	49-UNIMOD:188,66-UNIMOD:267	0.06	40.0	5	1	0
PRT	sp|P07954-2|FUMH_HUMAN	Isoform Cytoplasmic of Fumarate hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=FH	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.05	39.0	1	1	1
PRT	sp|Q9UNX3|RL26L_HUMAN	60S ribosomal protein L26-like 1 OS=Homo sapiens OX=9606 GN=RPL26L1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	89-UNIMOD:188,103-UNIMOD:188	0.15	39.0	3	2	1
PRT	sp|O43707|ACTN4_HUMAN	Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.05	39.0	4	3	2
PRT	sp|Q5BKZ1-3|ZN326_HUMAN	Isoform 3 of DBIRD complex subunit ZNF326 OS=Homo sapiens OX=9606 GN=ZNF326	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	119-UNIMOD:188,139-UNIMOD:188	0.07	39.0	3	1	0
PRT	sp|P61326-2|MGN_HUMAN	Isoform 2 of Protein mago nashi homolog OS=Homo sapiens OX=9606 GN=MAGOH	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.15	38.0	1	1	1
PRT	sp|Q8WUJ3-2|CEMIP_HUMAN	Isoform 2 of Cell migration-inducing and hyaluronan-binding protein OS=Homo sapiens OX=9606 GN=CEMIP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	516-UNIMOD:4	0.04	38.0	2	2	2
PRT	sp|Q14152-2|EIF3A_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit A OS=Homo sapiens OX=9606 GN=EIF3A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	199-UNIMOD:267,194-UNIMOD:35	0.02	38.0	6	1	0
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	647-UNIMOD:267	0.02	38.0	4	1	0
PRT	sp|P04181|OAT_HUMAN	Ornithine aminotransferase, mitochondrial OS=Homo sapiens OX=9606 GN=OAT PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	93-UNIMOD:4,77-UNIMOD:188,96-UNIMOD:188	0.08	38.0	5	2	1
PRT	sp|P13010|XRCC5_HUMAN	X-ray repair cross-complementing protein 5 OS=Homo sapiens OX=9606 GN=XRCC5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	195-UNIMOD:188,202-UNIMOD:188,130-UNIMOD:267,141-UNIMOD:267	0.04	38.0	5	2	0
PRT	sp|Q9P2N5|RBM27_HUMAN	RNA-binding protein 27 OS=Homo sapiens OX=9606 GN=RBM27 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	776-UNIMOD:4,786-UNIMOD:188	0.03	38.0	1	1	1
PRT	sp|Q13098-5|CSN1_HUMAN	Isoform 4 of COP9 signalosome complex subunit 1 OS=Homo sapiens OX=9606 GN=GPS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	171-UNIMOD:4,159-UNIMOD:267,179-UNIMOD:188	0.05	38.0	3	1	0
PRT	sp|Q8NFH5-2|NUP35_HUMAN	Isoform 2 of Nucleoporin NUP35 OS=Homo sapiens OX=9606 GN=NUP35	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	66-UNIMOD:188,68-UNIMOD:188	0.07	38.0	3	1	0
PRT	sp|Q9UHD8-4|SEPT9_HUMAN	Isoform 4 of Septin-9 OS=Homo sapiens OX=9606 GN=SEPTIN9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.06	38.0	3	1	0
PRT	sp|Q92499-3|DDX1_HUMAN	Isoform 3 of ATP-dependent RNA helicase DDX1 OS=Homo sapiens OX=9606 GN=DDX1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	11-UNIMOD:4,17-UNIMOD:4,4-UNIMOD:188,18-UNIMOD:267	0.05	37.0	4	2	1
PRT	sp|Q8NFH3-2|NUP43_HUMAN	Isoform 2 of Nucleoporin Nup43 OS=Homo sapiens OX=9606 GN=NUP43	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	87-UNIMOD:267	0.06	37.0	4	1	0
PRT	sp|P08138-2|TNR16_HUMAN	Isoform 2 of Tumor necrosis factor receptor superfamily member 16 OS=Homo sapiens OX=9606 GN=NGFR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	287-UNIMOD:4,290-UNIMOD:267	0.08	37.0	2	1	0
PRT	sp|Q9UBQ0|VPS29_HUMAN	Vacuolar protein sorting-associated protein 29 OS=Homo sapiens OX=9606 GN=VPS29 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	36-UNIMOD:4,41-UNIMOD:4,30-UNIMOD:188,43-UNIMOD:188	0.11	37.0	5	1	0
PRT	sp|O75306-2|NDUS2_HUMAN	Isoform 2 of NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFS2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	96-UNIMOD:267	0.04	37.0	2	1	0
PRT	sp|P68104-2|EF1A1_HUMAN	Isoform 2 of Elongation factor 1-alpha 1 OS=Homo sapiens OX=9606 GN=EEF1A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	20-UNIMOD:188	0.04	37.0	4	1	0
PRT	sp|Q15084-3|PDIA6_HUMAN	Isoform 3 of Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 GN=PDIA6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	82-UNIMOD:188,99-UNIMOD:188	0.06	37.0	3	1	0
PRT	sp|P54886-2|P5CS_HUMAN	Isoform Short of Delta-1-pyrroline-5-carboxylate synthase OS=Homo sapiens OX=9606 GN=ALDH18A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.02	36.0	2	1	0
PRT	sp|P56537|IF6_HUMAN	Eukaryotic translation initiation factor 6 OS=Homo sapiens OX=9606 GN=EIF6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	85-UNIMOD:267	0.08	36.0	2	1	0
PRT	sp|Q8TEM1|PO210_HUMAN	Nuclear pore membrane glycoprotein 210 OS=Homo sapiens OX=9606 GN=NUP210 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	1576-UNIMOD:188	0.01	36.0	4	1	0
PRT	sp|Q15185-3|TEBP_HUMAN	Isoform 3 of Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	58-UNIMOD:4,65-UNIMOD:188	0.14	36.0	3	1	0
PRT	sp|Q99878|H2A1J_HUMAN	Histone H2A type 1-J OS=Homo sapiens OX=9606 GN=H2AC14 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	89-UNIMOD:267,96-UNIMOD:188	0.12	36.0	2	1	0
PRT	sp|P14618|KPYM_HUMAN	Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	36.0	null	89-UNIMOD:188,2-UNIMOD:1,22-UNIMOD:35,31-UNIMOD:4,30-UNIMOD:35	0.12	36.0	10	3	1
PRT	sp|Q9HC35-2|EMAL4_HUMAN	Isoform 2 of Echinoderm microtubule-associated protein-like 4 OS=Homo sapiens OX=9606 GN=EML4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	580-UNIMOD:4,598-UNIMOD:267	0.03	36.0	4	1	0
PRT	sp|Q14697|GANAB_HUMAN	Neutral alpha-glucosidase AB OS=Homo sapiens OX=9606 GN=GANAB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	684-UNIMOD:267,698-UNIMOD:267	0.02	36.0	4	1	0
PRT	sp|P62993-2|GRB2_HUMAN	Isoform 2 of Growth factor receptor-bound protein 2 OS=Homo sapiens OX=9606 GN=GRB2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.10	36.0	1	1	1
PRT	sp|Q02880-2|TOP2B_HUMAN	Isoform Beta-1 of DNA topoisomerase 2-beta OS=Homo sapiens OX=9606 GN=TOP2B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.01	36.0	2	1	0
PRT	sp|Q9Y383-3|LC7L2_HUMAN	Isoform 3 of Putative RNA-binding protein Luc7-like 2 OS=Homo sapiens OX=9606 GN=LUC7L2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	40-UNIMOD:4,41-UNIMOD:4	0.04	36.0	2	1	0
PRT	sp|O60271-4|JIP4_HUMAN	Isoform 4 of C-Jun-amino-terminal kinase-interacting protein 4 OS=Homo sapiens OX=9606 GN=SPAG9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.02	36.0	1	1	1
PRT	sp|P17812-2|PYRG1_HUMAN	Isoform 2 of CTP synthase 1 OS=Homo sapiens OX=9606 GN=CTPS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	100-UNIMOD:188,104-UNIMOD:188	0.05	35.0	3	1	0
PRT	sp|Q96G46-2|DUS3L_HUMAN	Isoform 2 of tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Homo sapiens OX=9606 GN=DUS3L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	185-UNIMOD:267,199-UNIMOD:267	0.05	35.0	2	1	0
PRT	sp|Q14CX7-2|NAA25_HUMAN	Isoform 2 of N-alpha-acetyltransferase 25, NatB auxiliary subunit OS=Homo sapiens OX=9606 GN=NAA25	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	548-UNIMOD:267	0.02	35.0	4	1	0
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	639-UNIMOD:267	0.05	35.0	5	2	0
PRT	sp|Q96HS1|PGAM5_HUMAN	Serine/threonine-protein phosphatase PGAM5, mitochondrial OS=Homo sapiens OX=9606 GN=PGAM5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.05	35.0	2	1	0
PRT	sp|P49411|EFTU_HUMAN	Elongation factor Tu, mitochondrial OS=Homo sapiens OX=9606 GN=TUFM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	127-UNIMOD:4,135-UNIMOD:188	0.04	35.0	4	1	0
PRT	sp|Q5TBB1-2|RNH2B_HUMAN	Isoform 2 of Ribonuclease H2 subunit B OS=Homo sapiens OX=9606 GN=RNASEH2B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	145-UNIMOD:188,153-UNIMOD:188	0.07	35.0	3	1	0
PRT	sp|Q9NUP9|LIN7C_HUMAN	Protein lin-7 homolog C OS=Homo sapiens OX=9606 GN=LIN7C PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.11	35.0	1	1	1
PRT	sp|P46379-4|BAG6_HUMAN	Isoform 4 of Large proline-rich protein BAG6 OS=Homo sapiens OX=9606 GN=BAG6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	673-UNIMOD:267	0.02	35.0	5	1	0
PRT	sp|P29144|TPP2_HUMAN	Tripeptidyl-peptidase 2 OS=Homo sapiens OX=9606 GN=TPP2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	655-UNIMOD:188,660-UNIMOD:267	0.02	35.0	3	1	0
PRT	sp|O60264|SMCA5_HUMAN	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Homo sapiens OX=9606 GN=SMARCA5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null		0.02	35.0	1	1	1
PRT	sp|Q9BQ52|RNZ2_HUMAN	Zinc phosphodiesterase ELAC protein 2 OS=Homo sapiens OX=9606 GN=ELAC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	651-UNIMOD:4,660-UNIMOD:188	0.02	35.0	2	1	0
PRT	sp|P82675|RT05_HUMAN	28S ribosomal protein S5, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	374-UNIMOD:267,377-UNIMOD:4,388-UNIMOD:267	0.05	34.0	3	1	0
PRT	sp|Q9P2R3|ANFY1_HUMAN	Rabankyrin-5 OS=Homo sapiens OX=9606 GN=ANKFY1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	712-UNIMOD:4,716-UNIMOD:4,724-UNIMOD:4,731-UNIMOD:267	0.02	34.0	1	1	1
PRT	sp|Q9ULE6|PALD_HUMAN	Paladin OS=Homo sapiens OX=9606 GN=PALD1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	47-UNIMOD:188	0.02	34.0	3	1	0
PRT	sp|P06493-2|CDK1_HUMAN	Isoform 2 of Cyclin-dependent kinase 1 OS=Homo sapiens OX=9606 GN=CDK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.07	34.0	2	1	0
PRT	sp|P23284|PPIB_HUMAN	Peptidyl-prolyl cis-trans isomerase B OS=Homo sapiens OX=9606 GN=PPIB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	131-UNIMOD:188,145-UNIMOD:188	0.08	34.0	4	1	0
PRT	sp|P49748-2|ACADV_HUMAN	Isoform 2 of Very long-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ACADVL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	2	1	0
PRT	sp|P12268|IMDH2_HUMAN	Inosine-5'-monophosphate dehydrogenase 2 OS=Homo sapiens OX=9606 GN=IMPDH2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	136-UNIMOD:267,140-UNIMOD:4,149-UNIMOD:267,356-UNIMOD:267,375-UNIMOD:188	0.07	34.0	5	2	1
PRT	sp|Q8NC51-3|PAIRB_HUMAN	Isoform 3 of Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	330-UNIMOD:267,325-UNIMOD:35	0.04	34.0	5	1	0
PRT	sp|Q05048|CSTF1_HUMAN	Cleavage stimulation factor subunit 1 OS=Homo sapiens OX=9606 GN=CSTF1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null	242-UNIMOD:267	0.05	34.0	4	1	0
PRT	sp|P43405-2|KSYK_HUMAN	Isoform Short of Tyrosine-protein kinase SYK OS=Homo sapiens OX=9606 GN=SYK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	89-UNIMOD:4,101-UNIMOD:4,104-UNIMOD:188,273-UNIMOD:267,290-UNIMOD:267	0.09	34.0	5	2	1
PRT	sp|Q9NZJ9-3|NUDT4_HUMAN	Isoform 3 of Diphosphoinositol polyphosphate phosphohydrolase 2 OS=Homo sapiens OX=9606 GN=NUDT4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	80-UNIMOD:4,82-UNIMOD:188,91-UNIMOD:188	0.12	34.0	2	1	0
PRT	sp|P22626|ROA2_HUMAN	Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	185-UNIMOD:267,186-UNIMOD:188	0.04	34.0	3	1	0
PRT	sp|O96028|NSD2_HUMAN	Histone-lysine N-methyltransferase NSD2 OS=Homo sapiens OX=9606 GN=NSD2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null		0.02	34.0	1	1	1
PRT	sp|P11177|ODPB_HUMAN	Pyruvate dehydrogenase E1 component subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=PDHB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	null	233-UNIMOD:28,244-UNIMOD:267,249-UNIMOD:4,258-UNIMOD:188	0.08	34.0	4	1	0
PRT	sp|O60547|GMDS_HUMAN	GDP-mannose 4,6 dehydratase OS=Homo sapiens OX=9606 GN=GMDS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	70-UNIMOD:188,81-UNIMOD:188	0.05	34.0	3	1	0
PRT	sp|Q13885|TBB2A_HUMAN	Tubulin beta-2A chain OS=Homo sapiens OX=9606 GN=TUBB2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	1-UNIMOD:35,2-UNIMOD:267,12-UNIMOD:4,19-UNIMOD:188	0.04	34.0	5	1	0
PRT	sp|Q15021|CND1_HUMAN	Condensin complex subunit 1 OS=Homo sapiens OX=9606 GN=NCAPD2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	362-UNIMOD:267,381-UNIMOD:267	0.02	33.0	5	1	0
PRT	sp|P34897-3|GLYM_HUMAN	Isoform 3 of Serine hydroxymethyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=SHMT2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	2	1	0
PRT	sp|P08621|RU17_HUMAN	U1 small nuclear ribonucleoprotein 70 kDa OS=Homo sapiens OX=9606 GN=SNRNP70 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	39-UNIMOD:4,46-UNIMOD:267,27-UNIMOD:188,32-UNIMOD:188	0.11	33.0	7	3	1
PRT	sp|P06733-2|ENOA_HUMAN	Isoform MBP-1 of Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	69-UNIMOD:188	0.09	33.0	2	1	0
PRT	sp|E9PRG8|CK098_HUMAN	Uncharacterized protein C11orf98 OS=Homo sapiens OX=9606 GN=C11orf98 PE=4 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	35-UNIMOD:267,48-UNIMOD:267	0.13	33.0	3	1	0
PRT	sp|P55145|MANF_HUMAN	Mesencephalic astrocyte-derived neurotrophic factor OS=Homo sapiens OX=9606 GN=MANF PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	94-UNIMOD:188,104-UNIMOD:188	0.10	33.0	3	1	0
PRT	sp|P09429|HMGB1_HUMAN	High mobility group protein B1 OS=Homo sapiens OX=9606 GN=HMGB1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	30-UNIMOD:188,43-UNIMOD:188,114-UNIMOD:188,127-UNIMOD:188	0.14	33.0	5	2	0
PRT	sp|P68371|TBB4B_HUMAN	Tubulin beta-4B chain OS=Homo sapiens OX=9606 GN=TUBB4B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	267-UNIMOD:35,12-UNIMOD:4	0.08	33.0	2	2	2
PRT	sp|Q9NTJ3|SMC4_HUMAN	Structural maintenance of chromosomes protein 4 OS=Homo sapiens OX=9606 GN=SMC4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	1017-UNIMOD:188,1031-UNIMOD:188	0.01	33.0	1	1	1
PRT	sp|Q01581|HMCS1_HUMAN	Hydroxymethylglutaryl-CoA synthase, cytoplasmic OS=Homo sapiens OX=9606 GN=HMGCS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.06	33.0	2	1	0
PRT	sp|P22061|PIMT_HUMAN	Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Homo sapiens OX=9606 GN=PCMT1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.07	33.0	1	1	1
PRT	sp|P50995-2|ANX11_HUMAN	Isoform 2 of Annexin A11 OS=Homo sapiens OX=9606 GN=ANXA11	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	355-UNIMOD:267,367-UNIMOD:267	0.03	33.0	3	1	0
PRT	sp|Q9H0U6|RM18_HUMAN	39S ribosomal protein L18, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL18 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	100-UNIMOD:188	0.09	33.0	4	1	0
PRT	sp|P62826|RAN_HUMAN	GTP-binding nuclear protein Ran OS=Homo sapiens OX=9606 GN=RAN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.09	33.0	1	1	1
PRT	sp|Q71U36|TBA1A_HUMAN	Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	33.0	null	85-UNIMOD:28,96-UNIMOD:188,105-UNIMOD:267	0.05	33.0	3	1	0
PRT	sp|P53985|MOT1_HUMAN	Monocarboxylate transporter 1 OS=Homo sapiens OX=9606 GN=SLC16A1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null		0.03	33.0	1	1	1
PRT	sp|P51991|ROA3_HUMAN	Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens OX=9606 GN=HNRNPA3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	196-UNIMOD:4,199-UNIMOD:188,200-UNIMOD:188	0.04	33.0	2	1	0
PRT	sp|Q6P1X6|CH082_HUMAN	UPF0598 protein C8orf82 OS=Homo sapiens OX=9606 GN=C8orf82 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	null	107-UNIMOD:385,107-UNIMOD:4	0.10	33.0	1	1	1
PRT	sp|Q712K3|UB2R2_HUMAN	Ubiquitin-conjugating enzyme E2 R2 OS=Homo sapiens OX=9606 GN=UBE2R2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.08	32.0	1	1	1
PRT	sp|P30153|2AAA_HUMAN	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Homo sapiens OX=9606 GN=PPP2R1A PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	1	1	1
PRT	sp|P20936-2|RASA1_HUMAN	Isoform 2 of Ras GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RASA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|P61313-2|RL15_HUMAN	Isoform 2 of 60S ribosomal protein L15 OS=Homo sapiens OX=9606 GN=RPL15	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	83-UNIMOD:188,93-UNIMOD:188	0.12	32.0	2	1	0
PRT	sp|Q13347|EIF3I_HUMAN	Eukaryotic translation initiation factor 3 subunit I OS=Homo sapiens OX=9606 GN=EIF3I PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	298-UNIMOD:188	0.05	32.0	3	1	0
PRT	sp|Q5JTH9-2|RRP12_HUMAN	Isoform 2 of RRP12-like protein OS=Homo sapiens OX=9606 GN=RRP12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	173-UNIMOD:188,186-UNIMOD:188	0.02	32.0	2	1	0
PRT	sp|P07195|LDHB_HUMAN	L-lactate dehydrogenase B chain OS=Homo sapiens OX=9606 GN=LDHB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	164-UNIMOD:4,158-UNIMOD:267,170-UNIMOD:267	0.04	32.0	4	1	0
PRT	sp|Q8TEX9|IPO4_HUMAN	Importin-4 OS=Homo sapiens OX=9606 GN=IPO4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|Q2NKX8|ERC6L_HUMAN	DNA excision repair protein ERCC-6-like OS=Homo sapiens OX=9606 GN=ERCC6L PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	749-UNIMOD:188,771-UNIMOD:188	0.02	32.0	3	1	0
PRT	sp|P32322-2|P5CR1_HUMAN	Isoform 2 of Pyrroline-5-carboxylate reductase 1, mitochondrial OS=Homo sapiens OX=9606 GN=PYCR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	216-UNIMOD:35	0.04	32.0	1	1	1
PRT	sp|Q9NYB0|TE2IP_HUMAN	Telomeric repeat-binding factor 2-interacting protein 1 OS=Homo sapiens OX=9606 GN=TERF2IP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	54-UNIMOD:4	0.04	32.0	1	1	1
PRT	sp|Q14247-3|SRC8_HUMAN	Isoform 3 of Src substrate cortactin OS=Homo sapiens OX=9606 GN=CTTN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	1	1	0
PRT	sp|Q13263-2|TIF1B_HUMAN	Isoform 2 of Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	127-UNIMOD:4,139-UNIMOD:4,142-UNIMOD:4,147-UNIMOD:4,150-UNIMOD:4	0.06	32.0	3	2	1
PRT	sp|Q8N684|CPSF7_HUMAN	Cleavage and polyadenylation specificity factor subunit 7 OS=Homo sapiens OX=9606 GN=CPSF7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	447-UNIMOD:267,455-UNIMOD:267	0.04	32.0	3	1	0
PRT	sp|P35637-2|FUS_HUMAN	Isoform Short of RNA-binding protein FUS OS=Homo sapiens OX=9606 GN=FUS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.05	31.0	1	1	1
PRT	sp|P08195-2|4F2_HUMAN	Isoform 2 of 4F2 cell-surface antigen heavy chain OS=Homo sapiens OX=9606 GN=SLC3A2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.05	31.0	2	2	2
PRT	sp|P48735-2|IDHP_HUMAN	Isoform 2 of Isocitrate dehydrogenase [NADP], mitochondrial OS=Homo sapiens OX=9606 GN=IDH2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.04	31.0	1	1	1
PRT	sp|P63000|RAC1_HUMAN	Ras-related C3 botulinum toxin substrate 1 OS=Homo sapiens OX=9606 GN=RAC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	105-UNIMOD:4,116-UNIMOD:188	0.08	31.0	4	1	0
PRT	sp|O43837|IDH3B_HUMAN	Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=IDH3B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	350-UNIMOD:188,351-UNIMOD:188,164-UNIMOD:267,180-UNIMOD:267	0.12	31.0	2	2	2
PRT	sp|Q06481-5|APLP2_HUMAN	Isoform 5 of Amyloid-like protein 2 OS=Homo sapiens OX=9606 GN=APLP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	2	1	0
PRT	sp|P46063|RECQ1_HUMAN	ATP-dependent DNA helicase Q1 OS=Homo sapiens OX=9606 GN=RECQL PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	223-UNIMOD:4,224-UNIMOD:4	0.03	31.0	2	1	0
PRT	sp|P30048-2|PRDX3_HUMAN	Isoform 2 of Thioredoxin-dependent peroxide reductase, mitochondrial OS=Homo sapiens OX=9606 GN=PRDX3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.08	31.0	1	1	1
PRT	sp|Q99666-2|RGPD5_HUMAN	Isoform 2 of RANBP2-like and GRIP domain-containing protein 5/6 OS=Homo sapiens OX=9606 GN=RGPD5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	188-UNIMOD:4,182-UNIMOD:188,193-UNIMOD:267	0.02	31.0	2	1	0
PRT	sp|Q15149-7|PLEC_HUMAN	Isoform 7 of Plectin OS=Homo sapiens OX=9606 GN=PLEC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	3119-UNIMOD:267,3126-UNIMOD:4,3128-UNIMOD:267,169-UNIMOD:188,177-UNIMOD:188,2723-UNIMOD:188,2734-UNIMOD:188	0.01	31.0	7	3	1
PRT	sp|P61019-2|RAB2A_HUMAN	Isoform 2 of Ras-related protein Rab-2A OS=Homo sapiens OX=9606 GN=RAB2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	67-UNIMOD:267,81-UNIMOD:267	0.09	31.0	1	1	0
PRT	sp|Q04446|GLGB_HUMAN	1,4-alpha-glucan-branching enzyme OS=Homo sapiens OX=9606 GN=GBE1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	565-UNIMOD:267,576-UNIMOD:267	0.02	31.0	3	1	0
PRT	sp|P50402|EMD_HUMAN	Emerin OS=Homo sapiens OX=9606 GN=EMD PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	18-UNIMOD:267,31-UNIMOD:267	0.06	31.0	4	1	0
PRT	sp|Q9Y6C9|MTCH2_HUMAN	Mitochondrial carrier homolog 2 OS=Homo sapiens OX=9606 GN=MTCH2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	147-UNIMOD:267	0.06	31.0	3	1	0
PRT	sp|Q5T4S7-3|UBR4_HUMAN	Isoform 3 of E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	2554-UNIMOD:188,2561-UNIMOD:188	0.00	31.0	2	1	0
PRT	sp|Q9NUM4|T106B_HUMAN	Transmembrane protein 106B OS=Homo sapiens OX=9606 GN=TMEM106B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.09	31.0	2	1	0
PRT	sp|Q9BRK5-4|CAB45_HUMAN	Isoform 4 of 45 kDa calcium-binding protein OS=Homo sapiens OX=9606 GN=SDF4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.09	31.0	1	1	1
PRT	sp|P05023-2|AT1A1_HUMAN	Isoform 2 of Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens OX=9606 GN=ATP1A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	1	1	1
PRT	sp|O00515|LAD1_HUMAN	Ladinin-1 OS=Homo sapiens OX=9606 GN=LAD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.03	31.0	1	1	1
PRT	sp|Q9C075|K1C23_HUMAN	Keratin, type I cytoskeletal 23 OS=Homo sapiens OX=9606 GN=KRT23 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	1-UNIMOD:1,24-UNIMOD:267,26-UNIMOD:267	0.06	31.0	2	1	0
PRT	sp|P30520|PURA2_HUMAN	Adenylosuccinate synthetase isozyme 2 OS=Homo sapiens OX=9606 GN=ADSS2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.06	31.0	1	1	1
PRT	sp|Q71UI9-3|H2AV_HUMAN	Isoform 3 of Histone H2A.V OS=Homo sapiens OX=9606 GN=H2AFV	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	78-UNIMOD:188	0.17	30.0	2	1	0
PRT	sp|Q9UMX0-4|UBQL1_HUMAN	Isoform 4 of Ubiquilin-1 OS=Homo sapiens OX=9606 GN=UBQLN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	70-UNIMOD:188,83-UNIMOD:188	0.09	30.0	3	1	0
PRT	sp|P04792|HSPB1_HUMAN	Heat shock protein beta-1 OS=Homo sapiens OX=9606 GN=HSPB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.07	30.0	1	1	1
PRT	sp|P61160|ARP2_HUMAN	Actin-related protein 2 OS=Homo sapiens OX=9606 GN=ACTR2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	316-UNIMOD:267,319-UNIMOD:267	0.05	30.0	2	1	0
PRT	sp|Q99538-3|LGMN_HUMAN	Isoform 3 of Legumain OS=Homo sapiens OX=9606 GN=LGMN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	50-UNIMOD:4,58-UNIMOD:267	0.04	30.0	1	1	1
PRT	sp|Q9NZM1-5|MYOF_HUMAN	Isoform 5 of Myoferlin OS=Homo sapiens OX=9606 GN=MYOF	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	1242-UNIMOD:267	0.02	30.0	4	2	0
PRT	sp|Q69YN2-3|C19L1_HUMAN	Isoform 3 of CWF19-like protein 1 OS=Homo sapiens OX=9606 GN=CWF19L1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	191-UNIMOD:4,194-UNIMOD:4	0.05	30.0	1	1	1
PRT	sp|P08034|CXB1_HUMAN	Gap junction beta-1 protein OS=Homo sapiens OX=9606 GN=GJB1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	121-UNIMOD:188,122-UNIMOD:267	0.06	30.0	2	1	0
PRT	sp|P55786-2|PSA_HUMAN	Isoform 2 of Puromycin-sensitive aminopeptidase OS=Homo sapiens OX=9606 GN=NPEPPS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	2	1	0
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	635-UNIMOD:4	0.01	30.0	2	1	0
PRT	sp|P10599|THIO_HUMAN	Thioredoxin OS=Homo sapiens OX=9606 GN=TXN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	37-UNIMOD:35,39-UNIMOD:188,48-UNIMOD:188	0.12	30.0	3	1	0
PRT	sp|P61244-3|MAX_HUMAN	Isoform 3 of Protein max OS=Homo sapiens OX=9606 GN=MAX	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.14	30.0	2	1	0
PRT	sp|Q96DV4|RM38_HUMAN	39S ribosomal protein L38, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL38 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	60-UNIMOD:267,72-UNIMOD:267	0.04	30.0	1	1	1
PRT	sp|P60174-4|TPIS_HUMAN	Isoform 4 of Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	18-UNIMOD:267,31-UNIMOD:188	0.09	30.0	3	1	0
PRT	sp|Q9NYF8-4|BCLF1_HUMAN	Isoform 4 of Bcl-2-associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	420-UNIMOD:188,426-UNIMOD:188	0.02	30.0	2	1	0
PRT	sp|P51580|TPMT_HUMAN	Thiopurine S-methyltransferase OS=Homo sapiens OX=9606 GN=TPMT PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.06	30.0	1	1	1
PRT	sp|P14866|HNRPL_HUMAN	Heterogeneous nuclear ribonucleoprotein L OS=Homo sapiens OX=9606 GN=HNRNPL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.08	30.0	1	1	1
PRT	sp|P68363-2|TBA1B_HUMAN	Isoform 2 of Tubulin alpha-1B chain OS=Homo sapiens OX=9606 GN=TUBA1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	79-UNIMOD:267	0.11	30.0	2	2	2
PRT	sp|P52789|HXK2_HUMAN	Hexokinase-2 OS=Homo sapiens OX=9606 GN=HK2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|Q8WYP5|ELYS_HUMAN	Protein ELYS OS=Homo sapiens OX=9606 GN=AHCTF1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|Q8WYA6-3|CTBL1_HUMAN	Isoform 3 of Beta-catenin-like protein 1 OS=Homo sapiens OX=9606 GN=CTNNBL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	156-UNIMOD:4	0.07	30.0	1	1	1
PRT	sp|Q9Y3F4|STRAP_HUMAN	Serine-threonine kinase receptor-associated protein OS=Homo sapiens OX=9606 GN=STRAP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	270-UNIMOD:4	0.07	30.0	2	1	0
PRT	sp|Q14684|RRP1B_HUMAN	Ribosomal RNA processing protein 1 homolog B OS=Homo sapiens OX=9606 GN=RRP1B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	427-UNIMOD:267	0.03	30.0	2	1	0
PRT	sp|P13667|PDIA4_HUMAN	Protein disulfide-isomerase A4 OS=Homo sapiens OX=9606 GN=PDIA4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	2	2	2
PRT	sp|Q9NSV4|DIAP3_HUMAN	Protein diaphanous homolog 3 OS=Homo sapiens OX=9606 GN=DIAPH3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	396-UNIMOD:188,406-UNIMOD:267	0.01	30.0	1	1	1
PRT	sp|Q9GZT3-2|SLIRP_HUMAN	Isoform 2 of SRA stem-loop-interacting RNA-binding protein, mitochondrial OS=Homo sapiens OX=9606 GN=SLIRP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	48-UNIMOD:4	0.13	29.0	1	1	0
PRT	sp|Q5VT52-2|RPRD2_HUMAN	Isoform 2 of Regulation of nuclear pre-mRNA domain-containing protein 2 OS=Homo sapiens OX=9606 GN=RPRD2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	1310-UNIMOD:267	0.02	29.0	2	1	0
PRT	sp|P55884|EIF3B_HUMAN	Eukaryotic translation initiation factor 3 subunit B OS=Homo sapiens OX=9606 GN=EIF3B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	420-UNIMOD:4,430-UNIMOD:188	0.02	29.0	2	1	0
PRT	sp|Q01081-4|U2AF1_HUMAN	Isoform 4 of Splicing factor U2AF 35 kDa subunit OS=Homo sapiens OX=9606 GN=U2AF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	96-UNIMOD:4	0.09	29.0	1	1	1
PRT	sp|Q15813|TBCE_HUMAN	Tubulin-specific chaperone E OS=Homo sapiens OX=9606 GN=TBCE PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	48-UNIMOD:188,60-UNIMOD:188	0.03	29.0	2	1	0
PRT	sp|Q96FX7|TRM61_HUMAN	tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRMT61A OS=Homo sapiens OX=9606 GN=TRMT61A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.05	29.0	2	1	0
PRT	sp|Q92973-3|TNPO1_HUMAN	Isoform 3 of Transportin-1 OS=Homo sapiens OX=9606 GN=TNPO1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	149-UNIMOD:267,155-UNIMOD:4,163-UNIMOD:267	0.02	29.0	2	1	0
PRT	sp|Q13813-3|SPTN1_HUMAN	Isoform 3 of Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	1891-UNIMOD:188,1903-UNIMOD:188	0.02	29.0	4	3	2
PRT	sp|Q9UBQ7|GRHPR_HUMAN	Glyoxylate reductase/hydroxypyruvate reductase OS=Homo sapiens OX=9606 GN=GRHPR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	288-UNIMOD:4,300-UNIMOD:267	0.05	29.0	2	1	0
PRT	sp|P19784|CSK22_HUMAN	Casein kinase II subunit alpha' OS=Homo sapiens OX=9606 GN=CSNK2A2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	230-UNIMOD:267,245-UNIMOD:267	0.05	29.0	1	1	1
PRT	sp|Q02790|FKBP4_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Homo sapiens OX=9606 GN=FKBP4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	1	1	1
PRT	sp|Q96MG7|NSE3_HUMAN	Non-structural maintenance of chromosomes element 3 homolog OS=Homo sapiens OX=9606 GN=NSMCE3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.06	29.0	1	1	1
PRT	sp|Q9NZ52-3|GGA3_HUMAN	Isoform 3 of ADP-ribosylation factor-binding protein GGA3 OS=Homo sapiens OX=9606 GN=GGA3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	92-UNIMOD:267,104-UNIMOD:267	0.02	29.0	2	1	0
PRT	sp|Q9Y5K8|VATD_HUMAN	V-type proton ATPase subunit D OS=Homo sapiens OX=9606 GN=ATP6V1D PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.05	29.0	1	1	1
PRT	sp|Q8N1G0-2|ZN687_HUMAN	Isoform 2 of Zinc finger protein 687 OS=Homo sapiens OX=9606 GN=ZNF687	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	788-UNIMOD:4,793-UNIMOD:188	0.01	29.0	1	1	1
PRT	sp|P30046-2|DOPD_HUMAN	Isoform 2 of D-dopachrome decarboxylase OS=Homo sapiens OX=9606 GN=DDT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	87-UNIMOD:188	0.12	29.0	2	1	0
PRT	sp|P11586|C1TC_HUMAN	C-1-tetrahydrofolate synthase, cytoplasmic OS=Homo sapiens OX=9606 GN=MTHFD1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	175-UNIMOD:188,195-UNIMOD:4,198-UNIMOD:188	0.03	29.0	2	1	0
PRT	sp|P31939-2|PUR9_HUMAN	Isoform 2 of Bifunctional purine biosynthesis protein PURH OS=Homo sapiens OX=9606 GN=ATIC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	78-UNIMOD:267	0.02	29.0	2	1	0
PRT	sp|Q9GZT3|SLIRP_HUMAN	SRA stem-loop-interacting RNA-binding protein, mitochondrial OS=Homo sapiens OX=9606 GN=SLIRP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	48-UNIMOD:4	0.13	29.0	1	1	0
PRT	sp|Q14247|SRC8_HUMAN	Src substrate cortactin OS=Homo sapiens OX=9606 GN=CTTN PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	57-UNIMOD:188	0.03	29.0	1	1	0
PRT	sp|Q96GD4|AURKB_HUMAN	Aurora kinase B OS=Homo sapiens OX=9606 GN=AURKB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null		0.05	29.0	1	1	1
PRT	sp|P11940|PABP1_HUMAN	Polyadenylate-binding protein 1 OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null		0.03	29.0	2	1	0
PRT	sp|Q07157-2|ZO1_HUMAN	Isoform Short of Tight junction protein ZO-1 OS=Homo sapiens OX=9606 GN=TJP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	1076-UNIMOD:267,1090-UNIMOD:267	0.01	28.0	2	1	0
PRT	sp|Q9Y4B5|MTCL1_HUMAN	Microtubule cross-linking factor 1 OS=Homo sapiens OX=9606 GN=MTCL1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|Q04637-6|IF4G1_HUMAN	Isoform E of Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|P22626-2|ROA2_HUMAN	Isoform A2 of Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.05	28.0	1	1	1
PRT	sp|Q15067-3|ACOX1_HUMAN	Isoform 3 of Peroxisomal acyl-coenzyme A oxidase 1 OS=Homo sapiens OX=9606 GN=ACOX1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|Q9UKK9|NUDT5_HUMAN	ADP-sugar pyrophosphatase OS=Homo sapiens OX=9606 GN=NUDT5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.06	28.0	1	1	1
PRT	sp|P29350-2|PTN6_HUMAN	Isoform 3 of Tyrosine-protein phosphatase non-receptor type 6 OS=Homo sapiens OX=9606 GN=PTPN6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	521-UNIMOD:188,531-UNIMOD:188	0.02	28.0	2	1	0
PRT	sp|O95104-2|SCAF4_HUMAN	Isoform 2 of SR-related and CTD-associated factor 4 OS=Homo sapiens OX=9606 GN=SCAF4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|P57088|TMM33_HUMAN	Transmembrane protein 33 OS=Homo sapiens OX=9606 GN=TMEM33 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null	224-UNIMOD:4,221-UNIMOD:188,229-UNIMOD:267	0.07	28.0	2	1	0
PRT	sp|Q15393|SF3B3_HUMAN	Splicing factor 3B subunit 3 OS=Homo sapiens OX=9606 GN=SF3B3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|P05787|K2C8_HUMAN	Keratin, type II cytoskeletal 8 OS=Homo sapiens OX=9606 GN=KRT8 PE=1 SV=7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	225-UNIMOD:267,264-UNIMOD:188	0.05	28.0	3	2	1
PRT	sp|P47897-2|SYQ_HUMAN	Isoform 2 of Glutamine--tRNA ligase OS=Homo sapiens OX=9606 GN=QARS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	153-UNIMOD:35,155-UNIMOD:188,169-UNIMOD:188	0.02	28.0	3	1	0
PRT	sp|P78527-2|PRKDC_HUMAN	Isoform 2 of DNA-dependent protein kinase catalytic subunit OS=Homo sapiens OX=9606 GN=PRKDC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	2530-UNIMOD:267,2538-UNIMOD:267	0.00	28.0	1	1	1
PRT	sp|P14735|IDE_HUMAN	Insulin-degrading enzyme OS=Homo sapiens OX=9606 GN=IDE PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	299-UNIMOD:188	0.02	28.0	2	1	0
PRT	sp|Q9H6W3|RIOX1_HUMAN	Ribosomal oxygenase 1 OS=Homo sapiens OX=9606 GN=RIOX1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	94-UNIMOD:267,113-UNIMOD:267	0.03	28.0	1	1	1
PRT	sp|P25098|ARBK1_HUMAN	Beta-adrenergic receptor kinase 1 OS=Homo sapiens OX=9606 GN=GRK2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|Q7Z6Z7-2|HUWE1_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens OX=9606 GN=HUWE1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	3243-UNIMOD:4	0.00	28.0	1	1	1
PRT	sp|P62937|PPIA_HUMAN	Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null	115-UNIMOD:4,118-UNIMOD:188,82-UNIMOD:188,91-UNIMOD:188,125-UNIMOD:188,131-UNIMOD:188	0.34	28.0	6	3	1
PRT	sp|Q6Y7W6-4|GGYF2_HUMAN	Isoform 3 of GRB10-interacting GYF protein 2 OS=Homo sapiens OX=9606 GN=GIGYF2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	603-UNIMOD:267	0.02	28.0	2	1	0
PRT	sp|Q5T4S7|UBR4_HUMAN	E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	1698-UNIMOD:4,1700-UNIMOD:188,1708-UNIMOD:188	0.00	28.0	2	1	0
PRT	sp|P54886|P5CS_HUMAN	Delta-1-pyrroline-5-carboxylate synthase OS=Homo sapiens OX=9606 GN=ALDH18A1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	767-UNIMOD:188,781-UNIMOD:188	0.02	28.0	1	1	0
PRT	sp|Q9Y230|RUVB2_HUMAN	RuvB-like 2 OS=Homo sapiens OX=9606 GN=RUVBL2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	236-UNIMOD:188,253-UNIMOD:267	0.04	28.0	1	1	1
PRT	sp|P11387|TOP1_HUMAN	DNA topoisomerase 1 OS=Homo sapiens OX=9606 GN=TOP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	223-UNIMOD:188,239-UNIMOD:188	0.03	27.0	3	1	0
PRT	sp|P15170|ERF3A_HUMAN	Eukaryotic peptide chain release factor GTP-binding subunit ERF3A OS=Homo sapiens OX=9606 GN=GSPT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	163-UNIMOD:188	0.02	27.0	2	1	0
PRT	sp|Q06787-11|FMR1_HUMAN	Isoform 11 of Synaptic functional regulator FMR1 OS=Homo sapiens OX=9606 GN=FMR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	359-UNIMOD:188,372-UNIMOD:188	0.04	27.0	1	1	1
PRT	sp|P46776|RL27A_HUMAN	60S ribosomal protein L27a OS=Homo sapiens OX=9606 GN=RPL27A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.09	27.0	1	1	1
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	2	1	0
PRT	sp|Q9Y696|CLIC4_HUMAN	Chloride intracellular channel protein 4 OS=Homo sapiens OX=9606 GN=CLIC4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	62-UNIMOD:188,85-UNIMOD:188	0.10	27.0	3	1	0
PRT	sp|P18887|XRCC1_HUMAN	DNA repair protein XRCC1 OS=Homo sapiens OX=9606 GN=XRCC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	12-UNIMOD:4,20-UNIMOD:4	0.03	27.0	1	1	1
PRT	sp|Q01813-2|PFKAP_HUMAN	Isoform 2 of ATP-dependent 6-phosphofructokinase, platelet type OS=Homo sapiens OX=9606 GN=PFKP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	2	1	0
PRT	sp|Q13131|AAPK1_HUMAN	5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Homo sapiens OX=9606 GN=PRKAA1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	141-UNIMOD:4	0.03	27.0	1	1	1
PRT	sp|Q9UGP8|SEC63_HUMAN	Translocation protein SEC63 homolog OS=Homo sapiens OX=9606 GN=SEC63 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	396-UNIMOD:267,397-UNIMOD:267	0.02	27.0	2	1	0
PRT	sp|P22102-2|PUR2_HUMAN	Isoform Short of Trifunctional purine biosynthetic protein adenosine-3 OS=Homo sapiens OX=9606 GN=GART	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.04	27.0	1	1	1
PRT	sp|P09651-3|ROA1_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	175-UNIMOD:4	0.12	27.0	2	2	2
PRT	sp|Q15293|RCN1_HUMAN	Reticulocalbin-1 OS=Homo sapiens OX=9606 GN=RCN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	null	142-UNIMOD:28,165-UNIMOD:188,166-UNIMOD:188	0.08	27.0	3	1	0
PRT	sp|P42166|LAP2A_HUMAN	Lamina-associated polypeptide 2, isoform alpha OS=Homo sapiens OX=9606 GN=TMPO PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	27.0	null	479-UNIMOD:28,484-UNIMOD:188,500-UNIMOD:188	0.03	27.0	3	1	0
PRT	sp|Q9NP81|SYSM_HUMAN	Serine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=SARS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	195-UNIMOD:188,203-UNIMOD:267	0.03	27.0	1	1	1
PRT	sp|O00116|ADAS_HUMAN	Alkyldihydroxyacetonephosphate synthase, peroxisomal OS=Homo sapiens OX=9606 GN=AGPS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null	621-UNIMOD:188	0.03	26.0	2	1	0
PRT	sp|P68400-2|CSK21_HUMAN	Isoform 2 of Casein kinase II subunit alpha OS=Homo sapiens OX=9606 GN=CSNK2A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.06	26.0	1	1	1
PRT	sp|P16435|NCPR_HUMAN	NADPH--cytochrome P450 reductase OS=Homo sapiens OX=9606 GN=POR PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q96FW1|OTUB1_HUMAN	Ubiquitin thioesterase OTUB1 OS=Homo sapiens OX=9606 GN=OTUB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.05	26.0	1	1	1
PRT	sp|P07355-2|ANXA2_HUMAN	Isoform 2 of Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	81-UNIMOD:267	0.04	26.0	2	1	0
PRT	sp|P62701|RS4X_HUMAN	40S ribosomal protein S4, X isoform OS=Homo sapiens OX=9606 GN=RPS4X PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	211-UNIMOD:188	0.09	26.0	4	2	1
PRT	sp|Q9NR19|ACSA_HUMAN	Acetyl-coenzyme A synthetase, cytoplasmic OS=Homo sapiens OX=9606 GN=ACSS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	680-UNIMOD:35,696-UNIMOD:267	0.04	26.0	3	1	0
PRT	sp|P53367-3|ARFP1_HUMAN	Isoform 3 of Arfaptin-1 OS=Homo sapiens OX=9606 GN=ARFIP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.08	26.0	1	1	1
PRT	sp|P78371-2|TCPB_HUMAN	Isoform 2 of T-complex protein 1 subunit beta OS=Homo sapiens OX=9606 GN=CCT2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	242-UNIMOD:4	0.05	26.0	3	2	1
PRT	sp|Q9Y224|RTRAF_HUMAN	RNA transcription, translation and transport factor protein OS=Homo sapiens OX=9606 GN=RTRAF PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.06	26.0	1	1	1
PRT	sp|P12236|ADT3_HUMAN	ADP/ATP translocase 3 OS=Homo sapiens OX=9606 GN=SLC25A6 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.05	26.0	1	1	1
PRT	sp|Q14166|TTL12_HUMAN	Tubulin--tyrosine ligase-like protein 12 OS=Homo sapiens OX=9606 GN=TTLL12 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	377-UNIMOD:267,389-UNIMOD:267	0.02	26.0	1	1	1
PRT	sp|P32969|RL9_HUMAN	60S ribosomal protein L9 OS=Homo sapiens OX=9606 GN=RPL9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.08	26.0	1	1	1
PRT	sp|Q14671-2|PUM1_HUMAN	Isoform 2 of Pumilio homolog 1 OS=Homo sapiens OX=9606 GN=PUM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	193-UNIMOD:267,211-UNIMOD:267	0.02	26.0	1	1	1
PRT	sp|P61599|NAA20_HUMAN	N-alpha-acetyltransferase 20 OS=Homo sapiens OX=9606 GN=NAA20 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.09	26.0	1	1	1
PRT	sp|P25205|MCM3_HUMAN	DNA replication licensing factor MCM3 OS=Homo sapiens OX=9606 GN=MCM3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	314-UNIMOD:188,315-UNIMOD:188	0.02	26.0	2	1	0
PRT	sp|P09960-3|LKHA4_HUMAN	Isoform 3 of Leukotriene A-4 hydrolase OS=Homo sapiens OX=9606 GN=LTA4H	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	112-UNIMOD:4,117-UNIMOD:4	0.06	26.0	2	1	0
PRT	sp|Q6UB35|C1TM_HUMAN	Monofunctional C1-tetrahydrofolate synthase, mitochondrial OS=Homo sapiens OX=9606 GN=MTHFD1L PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|O75643|U520_HUMAN	U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens OX=9606 GN=SNRNP200 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	null	1962-UNIMOD:28,1972-UNIMOD:188,1973-UNIMOD:267	0.01	26.0	4	1	0
PRT	sp|Q8NBN7|RDH13_HUMAN	Retinol dehydrogenase 13 OS=Homo sapiens OX=9606 GN=RDH13 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.06	26.0	1	1	1
PRT	sp|P50851|LRBA_HUMAN	Lipopolysaccharide-responsive and beige-like anchor protein OS=Homo sapiens OX=9606 GN=LRBA PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	393-UNIMOD:188,405-UNIMOD:188	0.01	26.0	1	1	1
PRT	sp|Q15024|EXOS7_HUMAN	Exosome complex component RRP42 OS=Homo sapiens OX=9606 GN=EXOSC7 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.07	26.0	1	1	1
PRT	sp|P49711-2|CTCF_HUMAN	Isoform 2 of Transcriptional repressor CTCF OS=Homo sapiens OX=9606 GN=CTCF	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	111-UNIMOD:4,114-UNIMOD:4	0.03	25.0	1	1	1
PRT	sp|P40926|MDHM_HUMAN	Malate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=MDH2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.06	25.0	1	1	1
PRT	sp|Q92896|GSLG1_HUMAN	Golgi apparatus protein 1 OS=Homo sapiens OX=9606 GN=GLG1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	1079-UNIMOD:4	0.01	25.0	1	1	1
PRT	sp|Q8N573-6|OXR1_HUMAN	Isoform 6 of Oxidation resistance protein 1 OS=Homo sapiens OX=9606 GN=OXR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	22-UNIMOD:188,37-UNIMOD:188	0.06	25.0	2	1	0
PRT	sp|Q9NR45|SIAS_HUMAN	Sialic acid synthase OS=Homo sapiens OX=9606 GN=NANS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	96-UNIMOD:267	0.03	25.0	2	1	0
PRT	sp|Q13884-2|SNTB1_HUMAN	Isoform 2 of Beta-1-syntrophin OS=Homo sapiens OX=9606 GN=SNTB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.04	25.0	1	1	1
PRT	sp|P08670|VIME_HUMAN	Vimentin OS=Homo sapiens OX=9606 GN=VIM PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q01082-3|SPTB2_HUMAN	Isoform 2 of Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	668-UNIMOD:267,677-UNIMOD:267	0.01	25.0	2	1	0
PRT	sp|P23381|SYWC_HUMAN	Tryptophan--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=WARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	331-UNIMOD:188,349-UNIMOD:188	0.05	25.0	3	1	0
PRT	sp|Q9Y617-2|SERC_HUMAN	Isoform 2 of Phosphoserine aminotransferase OS=Homo sapiens OX=9606 GN=PSAT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	117-UNIMOD:188,127-UNIMOD:188	0.04	25.0	3	1	0
PRT	sp|P26639|SYTC_HUMAN	Threonine--tRNA ligase 1, cytoplasmic OS=Homo sapiens OX=9606 GN=TARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	2	1	0
PRT	sp|O15118-2|NPC1_HUMAN	Isoform 2 of NPC intracellular cholesterol transporter 1 OS=Homo sapiens OX=9606 GN=NPC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q00535-2|CDK5_HUMAN	Isoform 2 of Cyclin-dependent-like kinase 5 OS=Homo sapiens OX=9606 GN=CDK5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.04	25.0	1	1	1
PRT	sp|P47895|AL1A3_HUMAN	Aldehyde dehydrogenase family 1 member A3 OS=Homo sapiens OX=9606 GN=ALDH1A3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	109-UNIMOD:267,111-UNIMOD:267	0.03	25.0	1	1	1
PRT	sp|Q06830|PRDX1_HUMAN	Peroxiredoxin-1 OS=Homo sapiens OX=9606 GN=PRDX1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	71-UNIMOD:4,83-UNIMOD:4,92-UNIMOD:188,93-UNIMOD:188	0.13	25.0	1	1	1
PRT	sp|P53597|SUCA_HUMAN	Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=SUCLG1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.04	25.0	1	1	1
PRT	sp|Q16531|DDB1_HUMAN	DNA damage-binding protein 1 OS=Homo sapiens OX=9606 GN=DDB1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|Q562R1|ACTBL_HUMAN	Beta-actin-like protein 2 OS=Homo sapiens OX=9606 GN=ACTBL2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.05	25.0	1	1	1
PRT	sp|Q8N543-2|OGFD1_HUMAN	Isoform 2 of Prolyl 3-hydroxylase OGFOD1 OS=Homo sapiens OX=9606 GN=OGFOD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	315-UNIMOD:188	0.03	25.0	2	1	0
PRT	sp|P04080|CYTB_HUMAN	Cystatin-B OS=Homo sapiens OX=9606 GN=CSTB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	68-UNIMOD:267	0.13	25.0	1	1	1
PRT	sp|Q9Y5K3-2|PCY1B_HUMAN	Isoform 1 of Choline-phosphate cytidylyltransferase B OS=Homo sapiens OX=9606 GN=PCYT1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	94-UNIMOD:267	0.05	25.0	1	1	1
PRT	sp|P49589-2|SYCC_HUMAN	Isoform 2 of Cysteine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=CARS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	405-UNIMOD:4	0.02	25.0	1	1	1
PRT	sp|P48059|LIMS1_HUMAN	LIM and senescent cell antigen-like-containing domain protein 1 OS=Homo sapiens OX=9606 GN=LIMS1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	null	138-UNIMOD:385,138-UNIMOD:4,150-UNIMOD:188,161-UNIMOD:4,164-UNIMOD:4,166-UNIMOD:188	0.09	25.0	1	1	1
PRT	sp|Q96MU7|YTDC1_HUMAN	YTH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=YTHDC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|P11172|UMPS_HUMAN	Uridine 5'-monophosphate synthase OS=Homo sapiens OX=9606 GN=UMPS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	null	304-UNIMOD:385,304-UNIMOD:4,313-UNIMOD:267,314-UNIMOD:188	0.03	25.0	1	1	1
PRT	sp|Q969G3|SMCE1_HUMAN	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 OS=Homo sapiens OX=9606 GN=SMARCE1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	251-UNIMOD:267,255-UNIMOD:188	0.04	25.0	1	1	1
PRT	sp|P35579-2|MYH9_HUMAN	Isoform 2 of Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|P21333-2|FLNA_HUMAN	Isoform 2 of Filamin-A OS=Homo sapiens OX=9606 GN=FLNA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	2016-UNIMOD:188,2017-UNIMOD:188	0.00	24.0	1	1	1
PRT	sp|Q09666|AHNK_HUMAN	Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	5623-UNIMOD:188,5629-UNIMOD:188	0.00	24.0	1	1	1
PRT	sp|Q07955|SRSF1_HUMAN	Serine/arginine-rich splicing factor 1 OS=Homo sapiens OX=9606 GN=SRSF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	181-UNIMOD:267,191-UNIMOD:267	0.05	24.0	1	1	1
PRT	sp|Q15554-4|TERF2_HUMAN	Isoform 2 of Telomeric repeat-binding factor 2 OS=Homo sapiens OX=9606 GN=TERF2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.05	24.0	1	1	1
PRT	sp|Q9BSJ8|ESYT1_HUMAN	Extended synaptotagmin-1 OS=Homo sapiens OX=9606 GN=ESYT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	635-UNIMOD:4	0.02	24.0	1	1	1
PRT	sp|P17844-2|DDX5_HUMAN	Isoform 2 of Probable ATP-dependent RNA helicase DDX5 OS=Homo sapiens OX=9606 GN=DDX5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|O75150-3|BRE1B_HUMAN	Isoform 3 of E3 ubiquitin-protein ligase BRE1B OS=Homo sapiens OX=9606 GN=RNF40	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q99447-4|PCY2_HUMAN	Isoform 4 of Ethanolamine-phosphate cytidylyltransferase OS=Homo sapiens OX=9606 GN=PCYT2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	2	1	0
PRT	sp|P07947|YES_HUMAN	Tyrosine-protein kinase Yes OS=Homo sapiens OX=9606 GN=YES1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	248-UNIMOD:4,250-UNIMOD:188	0.02	24.0	1	1	1
PRT	sp|Q14764|MVP_HUMAN	Major vault protein OS=Homo sapiens OX=9606 GN=MVP PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q08945|SSRP1_HUMAN	FACT complex subunit SSRP1 OS=Homo sapiens OX=9606 GN=SSRP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	228-UNIMOD:188	0.02	24.0	1	1	1
PRT	sp|P55039|DRG2_HUMAN	Developmentally-regulated GTP-binding protein 2 OS=Homo sapiens OX=9606 GN=DRG2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	319-UNIMOD:4	0.03	24.0	1	1	1
PRT	sp|P38606-2|VATA_HUMAN	Isoform 2 of V-type proton ATPase catalytic subunit A OS=Homo sapiens OX=9606 GN=ATP6V1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	410-UNIMOD:188,423-UNIMOD:188	0.03	24.0	1	1	0
PRT	sp|Q92625-2|ANS1A_HUMAN	Isoform 2 of Ankyrin repeat and SAM domain-containing protein 1A OS=Homo sapiens OX=9606 GN=ANKS1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|P61978-3|HNRPK_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	292-UNIMOD:267	0.03	24.0	1	1	1
PRT	sp|Q8NF64-3|ZMIZ2_HUMAN	Isoform 3 of Zinc finger MIZ domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZMIZ2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	360-UNIMOD:4	0.03	24.0	1	1	1
PRT	sp|P46459|NSF_HUMAN	Vesicle-fusing ATPase OS=Homo sapiens OX=9606 GN=NSF PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q9GZV4|IF5A2_HUMAN	Eukaryotic translation initiation factor 5A-2 OS=Homo sapiens OX=9606 GN=EIF5A2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	67-UNIMOD:188	0.08	24.0	1	1	1
PRT	sp|Q9NZM1|MYOF_HUMAN	Myoferlin OS=Homo sapiens OX=9606 GN=MYOF PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.01	24.0	1	1	0
PRT	sp|Q9HAV4|XPO5_HUMAN	Exportin-5 OS=Homo sapiens OX=9606 GN=XPO5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null	186-UNIMOD:35,188-UNIMOD:267	0.01	24.0	1	1	1
PRT	sp|Q96RU7|TRIB3_HUMAN	Tribbles homolog 3 OS=Homo sapiens OX=9606 GN=TRIB3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null	165-UNIMOD:28,173-UNIMOD:4	0.05	24.0	1	1	1
PRT	sp|P38606|VATA_HUMAN	V-type proton ATPase catalytic subunit A OS=Homo sapiens OX=9606 GN=ATP6V1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	443-UNIMOD:188,456-UNIMOD:188	0.02	24.0	1	1	0
PRT	sp|O43304|S14L5_HUMAN	SEC14-like protein 5 OS=Homo sapiens OX=9606 GN=SEC14L5 PE=2 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|O15164-2|TIF1A_HUMAN	Isoform Short of Transcription intermediary factor 1-alpha OS=Homo sapiens OX=9606 GN=TRIM24	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	246-UNIMOD:4	0.01	23.0	1	1	1
PRT	sp|Q7Z6L1-3|TCPR1_HUMAN	Isoform 3 of Tectonin beta-propeller repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=TECPR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q92615|LAR4B_HUMAN	La-related protein 4B OS=Homo sapiens OX=9606 GN=LARP4B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	427-UNIMOD:267,444-UNIMOD:267	0.04	23.0	2	1	0
PRT	sp|O60313-13|OPA1_HUMAN	Isoform 7 of Dynamin-like 120 kDa protein, mitochondrial OS=Homo sapiens OX=9606 GN=OPA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q15293-2|RCN1_HUMAN	Isoform 2 of Reticulocalbin-1 OS=Homo sapiens OX=9606 GN=RCN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	235-UNIMOD:267	0.06	23.0	1	1	1
PRT	sp|O43488|ARK72_HUMAN	Aflatoxin B1 aldehyde reductase member 2 OS=Homo sapiens OX=9606 GN=AKR7A2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	132-UNIMOD:4,156-UNIMOD:4	0.08	23.0	1	1	1
PRT	sp|Q16864|VATF_HUMAN	V-type proton ATPase subunit F OS=Homo sapiens OX=9606 GN=ATP6V1F PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.10	23.0	1	1	1
PRT	sp|Q9Y490|TLN1_HUMAN	Talin-1 OS=Homo sapiens OX=9606 GN=TLN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|P29401|TKT_HUMAN	Transketolase OS=Homo sapiens OX=9606 GN=TKT PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	205-UNIMOD:267,206-UNIMOD:4,225-UNIMOD:4,226-UNIMOD:188	0.04	23.0	1	1	1
PRT	sp|P55072|TERA_HUMAN	Transitional endoplasmic reticulum ATPase OS=Homo sapiens OX=9606 GN=VCP PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	733-UNIMOD:267,741-UNIMOD:267	0.01	23.0	2	1	0
PRT	sp|Q14692|BMS1_HUMAN	Ribosome biogenesis protein BMS1 homolog OS=Homo sapiens OX=9606 GN=BMS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	950-UNIMOD:267,965-UNIMOD:267	0.01	23.0	1	1	1
PRT	sp|O75431-2|MTX2_HUMAN	Isoform 2 of Metaxin-2 OS=Homo sapiens OX=9606 GN=MTX2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|Q8N0Y7|PGAM4_HUMAN	Probable phosphoglycerate mutase 4 OS=Homo sapiens OX=9606 GN=PGAM4 PE=3 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.09	23.0	1	1	1
PRT	sp|Q8N3C0|ASCC3_HUMAN	Activating signal cointegrator 1 complex subunit 3 OS=Homo sapiens OX=9606 GN=ASCC3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q6P1K8|T2H2L_HUMAN	General transcription factor IIH subunit 2-like protein OS=Homo sapiens OX=9606 GN=GTF2H2C PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|P18206-2|VINC_HUMAN	Isoform 1 of Vinculin OS=Homo sapiens OX=9606 GN=VCL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q96C57|CSTOS_HUMAN	Protein CUSTOS OS=Homo sapiens OX=9606 GN=CUSTOS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.08	23.0	1	1	1
PRT	sp|Q9UBE0|SAE1_HUMAN	SUMO-activating enzyme subunit 1 OS=Homo sapiens OX=9606 GN=SAE1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	321-UNIMOD:267,335-UNIMOD:188	0.06	23.0	1	1	1
PRT	sp|Q99797|MIPEP_HUMAN	Mitochondrial intermediate peptidase OS=Homo sapiens OX=9606 GN=MIPEP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	null	443-UNIMOD:188,448-UNIMOD:4,453-UNIMOD:267	0.02	23.0	1	1	1
PRT	sp|P61019|RAB2A_HUMAN	Ras-related protein Rab-2A OS=Homo sapiens OX=9606 GN=RAB2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.08	23.0	1	1	0
PRT	sp|P0C7V0|CF217_HUMAN	Putative uncharacterized protein encoded by LINC00271 OS=Homo sapiens OX=9606 GN=LINC00271 PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	78-UNIMOD:267	0.07	23.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	HFLLEEDKPEEPTAHAFVSTLTR	1	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=8224	55.086	2	2666.334	2666.3340	R	G	1516	1539
PSM	HLQVNVTNPVQCSLHGKK	2	sp|O94832|MYO1D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	12-UNIMOD:4,17-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=4649	31.761	2	2070.1195	2070.1195	R	C	959	977
PSM	HRPQVAIICGSGLGGLTDK	3	sp|P00491|PNPH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	9-UNIMOD:4	ms_run[2]:scan=6489	43.592	2	1978.0418	1978.0418	K	L	23	42
PSM	TGISHGHTVYVVHDGFEGLAK	4	sp|P17858|PFKAL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	21-UNIMOD:188	ms_run[2]:scan=5555	37.509	2	2229.1274	2229.1274	R	G	424	445
PSM	TGISHGHTVYVVHDGFEGLAK	5	sp|P17858|PFKAL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=5557	37.521	2	2223.1073	2223.1073	R	G	424	445
PSM	HGVSHKVDDSSGSIGR	6	sp|P41250|GARS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=898	8.1419	2	1636.7917	1636.7917	R	R	641	657
PSM	IDKAVAFQNPQTHVIENLHAAAYR	7	sp|P22695|QCR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=6807	45.649	3	2705.4038	2705.4038	K	N	160	184
PSM	KLASQGDSISSQLGPIHPPPR	8	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=5570	37.607	3	2184.1651	2184.1651	K	T	122	143
PSM	DHAATTAGAASLAGGHHR	9	sp|P29083|T2EA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	18-UNIMOD:267	ms_run[2]:scan=1582	12.286	2	1709.8221	1709.8221	K	E	219	237
PSM	HLDHVAALFPGDVDR	10	sp|P11216|PYGB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=6520	43.784	2	1660.8322	1660.8322	R	L	411	426
PSM	KLASQGDSISSQLGPIHPPPR	11	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=5582	37.686	2	2184.1651	2184.1651	K	T	122	143
PSM	LKTNHIGHTGYLNTVTVSPDGSLCASGGK	12	sp|P63244|RACK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	24-UNIMOD:4	ms_run[2]:scan=5735	38.729	3	2983.4822	2983.4822	K	D	184	213
PSM	RGHVFEESQVAGTPMFVVK	13	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=7016	47.023	2	2117.0728	2117.0728	K	A	767	786
PSM	HASSGSFLPSANEHLKEDLNLR	14	sp|O76003|GLRX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=6906	46.296	2	2421.2037	2421.2037	R	L	115	137
PSM	HYNGEAYEDDEHHPR	15	sp|P31689|DNJA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=1155	9.6539	2	1867.751	1867.7510	R	G	375	390
PSM	HYNGEAYEDDEHHPR	16	sp|P31689|DNJA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	15-UNIMOD:267	ms_run[2]:scan=1154	9.6475	2	1877.7593	1877.7593	R	G	375	390
PSM	NRHEIAVMLLEGGANPDAK	17	sp|O75832-2|PSD10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=6973	46.741	2	2034.0317	2034.0317	K	D	117	136
PSM	SLENYHFVDEHGKDQGINIR	18	sp|Q14677|EPN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=5894	39.751	2	2370.1353	2370.1353	R	Q	110	130
PSM	VHELKEHNGQVTGIDWAPESNR	19	sp|O15143|ARC1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=5218	35.403	2	2515.2204	2515.2204	K	I	45	67
PSM	AIEMLGGELGSKIPVHPNDHVNK	20	sp|P07954-2|FUMH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=6948	46.569	2	2454.2689	2454.2689	R	S	118	141
PSM	ANGTTVHVGIHPSKVVITR	21	sp|Q9UNX3|RL26L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=4399	30.16	2	1985.117	1985.1170	K	L	90	109
PSM	KHEAFESDLAAHQDR	22	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=2701	19.378	2	1752.818	1752.8180	R	V	455	470
PSM	TFEEKDIELHLESSSHQETLDHIQK	23	sp|Q5BKZ1-3|ZN326_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=6636	44.542	3	2992.4414	2992.4414	R	Q	115	140
PSM	DHAATTAGAASLAGGHHR	24	sp|P29083|T2EA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=1572	12.226	2	1699.8139	1699.8139	K	E	219	237
PSM	FGHEFLEFEFRPDGK	25	sp|P61326-2|MGN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=9004	60.407	2	1853.8737	1853.8737	K	L	17	32
PSM	GNPSSSVEDHIEYHGHR	26	sp|Q8WUJ3-2|CEMIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=3219	22.683	2	1919.8511	1919.8511	K	G	276	293
PSM	HHNQSTAINLNNPESQSMHLETR	27	sp|Q14152-2|EIF3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	23-UNIMOD:267	ms_run[2]:scan=5065	34.428	3	2667.2447	2667.2447	R	L	177	200
PSM	HLEINPDHSIIETLR	28	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=7216	48.356	2	1785.9373	1785.9373	K	Q	633	648
PSM	HLEINPDHSIIETLR	29	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	15-UNIMOD:267	ms_run[2]:scan=7215	48.35	2	1795.9456	1795.9456	K	Q	633	648
PSM	KYFDFLSSYSAVNQGHCHPK	30	sp|P04181|OAT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	17-UNIMOD:4	ms_run[2]:scan=7507	50.309	2	2384.1008	2384.1008	R	I	77	97
PSM	LGGHGPSFPLKGITEQQK	31	sp|P13010|XRCC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	11-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=5779	39.012	2	1905.0511	1905.0511	R	E	185	203
PSM	LGHAGGNQSDASHLLNQSGGAGEDCQIFSTPGHPK	32	sp|Q9P2N5|RBM27_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	25-UNIMOD:4,35-UNIMOD:188	ms_run[2]:scan=6079	40.95	4	3549.6387	3549.6387	R	M	752	787
PSM	RGHDDLGDHYLDCGDLSNALK	33	sp|Q13098-5|CSN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	13-UNIMOD:4	ms_run[2]:scan=6731	45.163	2	2370.0659	2370.0659	R	C	159	180
PSM	SPLLAGGSPPQPVVPAHKDK	34	sp|Q8NFH5-2|NUP35_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=4903	33.38	2	1994.0949	1994.0949	R	S	49	69
PSM	THMQNIKDITSSIHFEAYR	35	sp|Q9UHD8-4|SEPT9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=7938	53.164	2	2290.1165	2290.1165	R	V	292	311
PSM	GKHYYEVSCHDQGLCR	36	sp|Q92499-3|DDX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	9-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=2828	20.183	2	2007.868	2007.8680	K	V	3	19
PSM	HHGDVMDLQFFDQER	37	sp|Q8NFH3-2|NUP43_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	15-UNIMOD:267	ms_run[2]:scan=8422	56.437	2	1882.8296	1882.8296	R	I	73	88
PSM	HLAGELGYQPEHIDSFTHEACPVR	38	sp|P08138-2|TNR16_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	21-UNIMOD:4,24-UNIMOD:267	ms_run[2]:scan=6466	43.444	3	2772.2954	2772.2954	R	A	267	291
PSM	HLAGELGYQPEHIDSFTHEACPVR	39	sp|P08138-2|TNR16_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	21-UNIMOD:4,24-UNIMOD:267	ms_run[2]:scan=6483	43.555	2	2772.2954	2772.2954	R	A	267	291
PSM	IDKAVAFQNPQTHVIENLHAAAYR	40	sp|P22695|QCR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=6818	45.718	2	2705.4038	2705.4038	K	N	160	184
PSM	KLASQGDSISSQLGPIHPPPR	41	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=5728	38.685	3	2184.1651	2184.1651	K	T	122	143
PSM	LLVPGKIQHILCTGNLCTK	42	sp|Q9UBQ0|VPS29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	12-UNIMOD:4,17-UNIMOD:4	ms_run[2]:scan=8586	57.527	2	2164.186	2164.1861	K	E	25	44
PSM	NITLNFGPQHPAAHGVLR	43	sp|O75306-2|NDUS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=6605	44.34	2	1941.0333	1941.0333	K	L	79	97
PSM	THINIVVIGHVDSGK	44	sp|P68104-2|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=5657	38.17	2	1587.8733	1587.8733	K	S	6	21
PSM	THMQNIKDITSSIHFEAYR	45	sp|Q9UHD8-4|SEPT9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=7935	53.146	3	2290.1165	2290.1165	R	V	292	311
PSM	VGAVDADKHHSLGGQYGVQGFPTIK	46	sp|Q15084-3|PDIA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	8-UNIMOD:188,25-UNIMOD:188	ms_run[2]:scan=6423	43.157	2	2592.3487	2592.3487	K	I	75	100
PSM	GKDHVVSDFSEHGSLK	47	sp|P54886-2|P5CS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=3277	23.049	2	1740.8431	1740.8431	R	Y	764	780
PSM	HFLLEEDKPEEPTAHAFVSTLTR	48	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=8217	55.041	3	2666.334	2666.3340	R	G	1516	1539
PSM	HGLLVPNNTTDQELQHIR	49	sp|P56537|IF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=6148	41.395	3	2084.0763	2084.0763	R	N	68	86
PSM	HHNQSTAINLNNPESQSMHLETR	50	sp|Q14152-2|EIF3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=5066	34.434	3	2657.2365	2657.2365	R	L	177	200
PSM	HLHPIQTSFQEATASK	51	sp|Q8TEM1|PO210_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=4492	30.741	2	1793.906	1793.9060	R	V	1561	1577
PSM	HLNEIDLFHCIDPNDSK	52	sp|Q15185-3|TEBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	10-UNIMOD:4	ms_run[2]:scan=8497	56.933	2	2065.9527	2065.9527	K	H	49	66
PSM	HLQLAIRNDEELNK	53	sp|Q99878|H2A1J_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=4809	32.791	2	1691.8955	1691.8955	R	L	83	97
PSM	KYFDFLSSYSAVNQGHCHPK	54	sp|P04181|OAT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:188,17-UNIMOD:4,20-UNIMOD:188	ms_run[2]:scan=7508	50.315	2	2396.1411	2396.1411	R	I	77	97
PSM	LNFSHGTHEYHAETIK	55	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=3521	24.608	2	1882.8962	1882.8962	R	N	74	90
PSM	LVDEPGHCADFHPSGTVVAIGTHSGR	56	sp|Q9HC35-2|EMAL4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	8-UNIMOD:4,26-UNIMOD:267	ms_run[2]:scan=5584	37.699	3	2725.2906	2725.2906	R	W	573	599
PSM	NITLNFGPQHPAAHGVLR	57	sp|O75306-2|NDUS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	18-UNIMOD:267	ms_run[2]:scan=6606	44.346	2	1951.0416	1951.0416	K	L	79	97
PSM	REPWLLPSQHNDIIR	58	sp|Q14697|GANAB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=7052	47.261	2	1872.9959	1872.9959	R	D	684	699
PSM	RGDFIHVMDNSDPNWWK	59	sp|P62993-2|GRB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=9092	61.006	2	2115.9585	2115.9585	R	G	138	155
PSM	RLHGLPEQFLYGTATK	60	sp|Q02880-2|TOP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=7005	46.949	2	1829.9788	1829.9788	R	H	692	708
PSM	SHLLNCCPHDVLSGTR	61	sp|Q9Y383-3|LC7L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=4887	33.281	2	1864.8672	1864.8672	K	M	35	51
PSM	TKLHQLSGSDQLESTAHSR	62	sp|O60271-4|JIP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=3051	21.575	3	2094.0454	2094.0454	R	I	177	196
PSM	ALEHSALAINHKLEIK	63	sp|P17812-2|PYRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=5101	34.655	2	1786.0101	1786.0101	K	Y	89	105
PSM	FAGAHLRPEGQNLVQEELAAR	64	sp|Q96G46-2|DUS3L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	7-UNIMOD:267,21-UNIMOD:267	ms_run[2]:scan=6868	46.034	3	2325.2093	2325.2093	R	G	179	200
PSM	HIQHDTIGYLLTR	65	sp|Q14CX7-2|NAA25_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	13-UNIMOD:267	ms_run[2]:scan=6372	42.828	2	1575.8397	1575.8397	K	Y	536	549
PSM	HLEINPDHPIVETLR	66	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=6400	43.009	2	1781.9424	1781.9424	K	Q	625	640
PSM	HLNEIDLFHCIDPNDSK	67	sp|Q15185-3|TEBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	10-UNIMOD:4	ms_run[2]:scan=8511	57.027	3	2065.9527	2065.9527	K	H	49	66
PSM	HLQVNVTNPVQCSLHGKK	68	sp|O94832|MYO1D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	12-UNIMOD:4,17-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=4646	31.743	3	2070.1195	2070.1195	R	C	959	977
PSM	HSQYHVDGSLEKDR	69	sp|Q96HS1|PGAM5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=2149	15.894	2	1669.7808	1669.7808	R	T	105	119
PSM	HYAHTDCPGHADYVK	70	sp|P49411|EFTU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	7-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=1329	10.699	2	1775.7781	1775.7781	R	N	121	136
PSM	LLHHVTEEKGNPEIDNK	71	sp|Q5TBB1-2|RNH2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=2280	16.729	2	1972.0014	1972.0014	K	K	137	154
PSM	LNFSHGTHEYHAETIK	72	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	16-UNIMOD:188	ms_run[2]:scan=3515	24.569	2	1888.9163	1888.9163	R	N	74	90
PSM	RGDQLLSVNGVSVEGEHHEK	73	sp|Q9NUP9|LIN7C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=4873	33.192	3	2189.0825	2189.0825	K	A	136	156
PSM	SFFHQHYLGGQEPTPSNIR	74	sp|P46379-4|BAG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	19-UNIMOD:267	ms_run[2]:scan=6001	40.451	2	2224.0689	2224.0689	R	M	655	674
PSM	VNESSHYDLAFTDVHFKPGQIR	75	sp|P29144|TPP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=7607	50.968	2	2559.2506	2559.2506	K	R	639	661
PSM	HGATHVFASKESEITDEDIDGILER	76	sp|O60264|SMCA5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=7849	52.56686333333333	3	2769.331104	2768.325317	R	G	656	681
PSM	HAFGCALVHTSGWK	77	sp|Q9BQ52|RNZ2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	5-UNIMOD:4,14-UNIMOD:188	ms_run[1]:scan=5452	36.86813	2	1575.773798	1575.771196	K	V	647	661
PSM	FAGAHLRPEGQNLVQEELAAR	78	sp|Q96G46-2|DUS3L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=6860	45.981	3	2305.1927	2305.1927	R	G	179	200
PSM	GLHVVEIREECGPLPIVVASPR	79	sp|P82675|RT05_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	8-UNIMOD:267,11-UNIMOD:4,22-UNIMOD:267	ms_run[2]:scan=8875	59.504	3	2446.3269	2446.3269	K	G	367	389
PSM	HGCDATCWGPGPGGCLQTLLHR	80	sp|Q9P2R3|ANFY1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:4,7-UNIMOD:4,15-UNIMOD:4,22-UNIMOD:267	ms_run[2]:scan=8777	58.822	3	2459.0921	2459.0921	R	A	710	732
PSM	HLEINPDHPIVETLR	81	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	15-UNIMOD:267	ms_run[2]:scan=6425	43.17	2	1791.9507	1791.9507	K	Q	625	640
PSM	HSVSIHSFQSTSLHNSK	82	sp|Q9ULE6|PALD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=3451	24.164	2	1894.9286	1894.9286	R	A	31	48
PSM	KPLFHGDSEIDQLFR	83	sp|P06493-2|CDK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=8536	57.192	3	1800.9159	1800.9159	K	I	144	159
PSM	KPLFHGDSEIDQLFR	84	sp|P06493-2|CDK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=8540	57.216	2	1800.9159	1800.9159	K	I	144	159
PSM	KYFDFLSSYSAVNQGHCHPK	85	sp|P04181|OAT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:188,17-UNIMOD:4,20-UNIMOD:188	ms_run[2]:scan=7506	50.303	3	2396.1411	2396.1411	R	I	77	97
PSM	LKHYGPGWVSMANAGK	86	sp|P23284|PPIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=5238	35.53	2	1714.8613	1714.8613	K	D	130	146
PSM	LVDEPGHCADFHPSGTVVAIGTHSGR	87	sp|Q9HC35-2|EMAL4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	8-UNIMOD:4	ms_run[2]:scan=5601	37.807	3	2715.2823	2715.2823	R	W	573	599
PSM	RAGLGSGLSLSGLVHPELSR	88	sp|P49748-2|ACADV_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=8697	58.275	2	2005.1069	2005.1069	R	S	490	510
PSM	REPWLLPSQHNDIIR	89	sp|Q14697|GANAB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:267,15-UNIMOD:267	ms_run[2]:scan=7044	47.206	2	1893.0124	1893.0124	R	D	684	699
PSM	RFGVPVIADGGIQNVGHIAK	90	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=7772	52.065	3	2047.1327	2047.1327	R	A	356	376
PSM	SEEAHAEDSVMDHHFR	91	sp|Q8NC51-3|PAIRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	16-UNIMOD:267	ms_run[2]:scan=3907	27.042	3	1905.7939	1905.7939	K	K	315	331
PSM	SFFHQHYLGGQEPTPSNIR	92	sp|P46379-4|BAG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=5998	40.428	2	2214.0606	2214.0606	R	M	655	674
PSM	SISFHPSGDFILVGTQHPTLR	93	sp|Q05048|CSTF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	21-UNIMOD:267	ms_run[2]:scan=8909	59.743	2	2318.2047	2318.2047	R	L	222	243
PSM	THASPADLCHYHSQESDGLVCLLK	94	sp|P43405-2|KSYK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	9-UNIMOD:4,21-UNIMOD:4,24-UNIMOD:188	ms_run[2]:scan=7252	48.603	4	2743.279	2743.2790	R	K	81	105
PSM	THINIVVIGHVDSGK	95	sp|P68104-2|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	15-UNIMOD:188	ms_run[2]:scan=5655	38.158	2	1593.8934	1593.8934	K	S	6	21
PSM	VGAVDADKHHSLGGQYGVQGFPTIK	96	sp|Q15084-3|PDIA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	8-UNIMOD:188,25-UNIMOD:188	ms_run[2]:scan=6405	43.043	3	2592.3487	2592.3487	K	I	75	100
PSM	VLQCHKPVHAEYLEK	97	sp|Q9NZJ9-3|NUDT4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:4	ms_run[2]:scan=2621	18.885	2	1849.9509	1849.9509	K	L	77	92
PSM	YHTINGHNAEVRK	98	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=952	8.460153333333334	2	1537.767187	1537.774973	K	A	174	187
PSM	LKTNHIGHTGYLNTVTVSPDGSLCASGGK	99	sp|P63244|RACK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	24-UNIMOD:4	ms_run[1]:scan=5739	38.75299166666667	2	2984.484738	2983.482169	K	D	184	213
PSM	SLENYHFVDEHGKDQGINIR	100	sp|Q14677|EPN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	13-UNIMOD:188,20-UNIMOD:267	ms_run[1]:scan=5903	39.80809333333333	2	2387.149365	2386.163670	R	Q	110	130
PSM	HRDEVVAEHPDASGEEIEELLR	101	sp|O96028|NSD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=7755	51.95259333333333	3	2530.217038	2529.209559	K	S	467	489
PSM	QGTHITVVSHSRPVGHCLEAAAVLSK	102	sp|P11177|ODPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:28,12-UNIMOD:267,17-UNIMOD:4,26-UNIMOD:188	ms_run[1]:scan=5850	39.47275333333333	3	2752.4427	2752.4408	R	E	233	259
PSM	IEHLYKNPQAHIEGNMK	103	sp|O60547|GMDS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	6-UNIMOD:188,17-UNIMOD:188	ms_run[1]:scan=3632	25.307258333333333	2	2033.044524	2033.055538	R	L	65	82
PSM	MREIVHIQAGQCGNQIGAK	104	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	1-UNIMOD:35,2-UNIMOD:267,12-UNIMOD:4,19-UNIMOD:188	ms_run[1]:scan=3962	27.392353333333332	2	2141.083062	2141.080475	-	F	1	20
PSM	ARHGFCGIPITDTGR	105	sp|P12268|IMDH2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:267,6-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=5090	34.583	2	1676.832	1676.8320	K	M	135	150
PSM	DTRDQFLDTLQAHGHDVNSFVR	106	sp|Q15021|CND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:267,22-UNIMOD:267	ms_run[2]:scan=8512	57.033	3	2590.2427	2590.2427	R	S	360	382
PSM	HADIVTTTTHKTLR	107	sp|P34897-3|GLYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=2525	18.28	2	1592.8635	1592.8635	K	G	249	263
PSM	HHNQPYCGIAPYIR	108	sp|P08621|RU17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	7-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=5355	36.264	2	1734.8288	1734.8288	K	E	33	47
PSM	HHNQSTAINLNNPESQSMHLETR	109	sp|Q14152-2|EIF3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	23-UNIMOD:267	ms_run[2]:scan=5083	34.541	2	2667.2447	2667.2447	R	L	177	200
PSM	HHNQSTAINLNNPESQSMHLETR	110	sp|Q14152-2|EIF3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=5071	34.464	2	2657.2365	2657.2365	R	L	177	200
PSM	HIADLAGNSEVILPVPAFNVINGGSHAGNK	111	sp|P06733-2|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=10271	69.567	3	3010.5625	3010.5625	R	L	40	70
PSM	HRVVGAVIDQGLITR	112	sp|E9PRG8|CK098_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=5490	37.111	3	1632.9424	1632.9424	R	H	34	49
PSM	HYAHTDCPGHADYVK	113	sp|P49411|EFTU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	7-UNIMOD:4	ms_run[2]:scan=1311	10.589	2	1769.758	1769.7580	R	N	121	136
PSM	IINEVSKPLAHHIPVEK	114	sp|P55145|MANF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=4543	31.065	2	1923.0942	1923.0942	K	I	88	105
PSM	IKGEHPGLSIGDVAK	115	sp|P09429|HMGB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=4446	30.459	2	1519.8358	1519.8358	K	K	113	128
PSM	LHFFMPGFAPLTSR	116	sp|P68371|TBB4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	5-UNIMOD:35	ms_run[2]:scan=9450	63.451	2	1635.8232	1635.8232	R	G	263	277
PSM	LKLEQIDGHIAEHNSK	117	sp|Q9NTJ3|SMC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=4471	30.616	2	1842.9991	1842.9991	K	I	1016	1032
PSM	RPTPNDDTLDEGVGLVHSNIATEHIPSPAK	118	sp|Q01581|HMCS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=7789	52.176	3	3179.5847	3179.5847	R	K	469	499
PSM	SGGASHSELIHNLRK	119	sp|P22061|PIMT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=2432	17.694	2	1604.8383	1604.8383	K	N	5	20
PSM	SISFHPSGDFILVGTQHPTLR	120	sp|Q05048|CSTF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=8901	59.684	2	2308.1964	2308.1964	R	L	222	243
PSM	SLENYHFVDEHGKDQGINIR	121	sp|Q14677|EPN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=5892	39.741	3	2370.1353	2370.1353	R	Q	110	130
PSM	SRAHLVAVFNEYQR	122	sp|P50995-2|ANX11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=5546	37.455	2	1688.8747	1688.8747	R	M	354	368
PSM	TQHHVEALVEHQNGK	123	sp|Q9H0U6|RM18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	15-UNIMOD:188	ms_run[2]:scan=1517	11.881	2	1731.8748	1731.8748	R	V	86	101
PSM	VILHLKEDQTEYLEER	124	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=6158	41.46	2	2014.0371	2014.0371	K	R	181	197
PSM	YVATLGVEVHPLVFHTNR	125	sp|P62826|RAN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=8119	54.386	2	2051.0952	2051.0952	K	G	39	57
PSM	QLFHPEQLITGKEDAANNYAR	126	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:28,12-UNIMOD:188,21-UNIMOD:267	ms_run[1]:scan=8965	60.14668	3	2413.1914	2413.1992	R	G	85	106
PSM	DLHDANTDLIGRHPK	127	sp|P53985|MOT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=3531	24.6672	2	1700.864639	1700.859431	K	Q	225	240
PSM	VHELKEHNGQVTGIDWAPESNR	128	sp|O15143|ARC1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=5515	37.26238166666666	2	2516.206058	2515.220398	K	I	45	67
PSM	YHTINGHNCEVKK	129	sp|P51991|ROA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	9-UNIMOD:4	ms_run[1]:scan=853	7.876066666666667	2	1598.765564	1598.762360	K	A	188	201
PSM	CEDRPVVFTHLLTADHGPPR	130	sp|Q6P1X6|CH082_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=8392	56.21933833333333	3	2299.1209	2299.1163	R	L	107	127
PSM	AHIKFPIDYPYSPPTFR	131	sp|Q712K3|UB2R2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=8916	59.801	2	2048.052	2048.0520	K	F	60	77
PSM	AISHEHSPSDLEAHFVPLVK	132	sp|P30153|2AAA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=6855	45.949	3	2212.1277	2212.1277	R	R	114	134
PSM	ATATQFVHHALKDSILK	133	sp|P20936-2|RASA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=6677	44.807	2	1879.0316	1879.0316	K	I	627	644
PSM	GATYGKPVHHGVNQLK	134	sp|P61313-2|RL15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=1310	10.583	2	1716.9462	1716.9462	K	F	78	94
PSM	GHFGPINSVAFHPDGK	135	sp|Q13347|EIF3I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=6029	40.628	3	1678.8216	1678.8216	K	S	283	299
PSM	GSEFMFEKAPAHHPAAISTAK	136	sp|Q5JTH9-2|RRP12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	8-UNIMOD:188,21-UNIMOD:188	ms_run[2]:scan=4832	32.929	3	2238.1294	2238.1294	K	F	166	187
PSM	HASSGSFLPSANEHLKEDLNLR	137	sp|O76003|GLRX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=6895	46.219	3	2421.2037	2421.2037	R	L	115	137
PSM	HGVSHKVDDSSGSIGR	138	sp|P41250|GARS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=899	8.1477	3	1636.7917	1636.7917	R	R	641	657
PSM	HRVIGSGCNLDSAR	139	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	8-UNIMOD:4	ms_run[2]:scan=2169	16.017	2	1540.7529	1540.7529	K	F	157	171
PSM	HYAHTDCPGHADYVK	140	sp|P49411|EFTU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=1320	10.645	2	1775.7781	1775.7781	R	N	121	136
PSM	IINEVSKPLAHHIPVEK	141	sp|P55145|MANF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=4541	31.053	2	1935.1344	1935.1344	K	I	88	105
PSM	KAGLLVLAVLSDGAGDHIR	142	sp|Q8TEX9|IPO4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=10244	69.368	3	1904.0843	1904.0843	R	Q	370	389
PSM	KHPDASVNFSEFSK	143	sp|P09429|HMGB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=5159	35.029	2	1603.8033	1603.8033	K	K	30	44
PSM	LLVPGKIQHILCTGNLCTK	144	sp|Q9UBQ0|VPS29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:188,12-UNIMOD:4,17-UNIMOD:4,19-UNIMOD:188	ms_run[2]:scan=8584	57.514	2	2176.2263	2176.2263	K	E	25	44
PSM	LNKPQPQPSPLLSTHHTQEEDISSK	145	sp|Q2NKX8|ERC6L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=4192	28.842	4	2810.4199	2810.4199	K	M	747	772
PSM	LVDEPGHCADFHPSGTVVAIGTHSGR	146	sp|Q9HC35-2|EMAL4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	8-UNIMOD:4	ms_run[2]:scan=5591	37.745	4	2715.2823	2715.2823	R	W	573	599
PSM	MLLHSEQHPGQLK	147	sp|P32322-2|P5CR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:35	ms_run[2]:scan=2529	18.307	2	1532.7769	1532.7769	K	D	216	229
PSM	RLSTLILHGGGTVCR	148	sp|Q9NYB0|TE2IP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	14-UNIMOD:4	ms_run[2]:scan=5048	34.317	2	1638.8988	1638.8988	R	V	41	56
PSM	SKPHSEAGTAFIQTQQLHAAMADTFLEHMCR	149	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:1,21-UNIMOD:35,30-UNIMOD:4	ms_run[2]:scan=9104	61.089	4	3570.6442	3570.6442	M	L	2	33
PSM	SPLLAGGSPPQPVVPAHKDK	150	sp|Q8NFH5-2|NUP35_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	18-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=4904	33.386	2	2006.1352	2006.1352	R	S	49	69
PSM	THASPADLCHYHSQESDGLVCLLK	151	sp|P43405-2|KSYK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	9-UNIMOD:4,21-UNIMOD:4,24-UNIMOD:188	ms_run[2]:scan=7257	48.637	2	2743.279	2743.2790	R	K	81	105
PSM	TVQGSGHQEHINIHK	152	sp|Q14247-3|SRC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=1202	9.9416	2	1683.8441	1683.8441	K	L	43	58
PSM	TVYCNVHKHEPLVLFCESCDTLTCR	153	sp|Q13263-2|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	4-UNIMOD:4,16-UNIMOD:4,19-UNIMOD:4,24-UNIMOD:4	ms_run[2]:scan=7378	49.45	3	3137.4191	3137.4191	R	D	124	149
PSM	VGAVDADKHHSLGGQYGVQGFPTIK	154	sp|Q15084-3|PDIA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=6410	43.073	2	2580.3085	2580.3085	K	I	75	100
PSM	VILHLKEDQTEYLEER	155	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=6151	41.417	3	2014.0371	2014.0371	K	R	181	197
PSM	SKPHSEAGTAFIQTQQLHAAMADTFLEHMCR	156	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:1,21-UNIMOD:35,30-UNIMOD:4	ms_run[1]:scan=9116	61.16815333333333	3	3570.6292	3570.6442	M	L	2	33
PSM	VHELKEHNGQVTGIDWAPESNR	157	sp|O15143|ARC1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=5406	36.576478333333334	3	2516.207053	2515.220398	K	I	45	67
PSM	QGTHITVVSHSRPVGHCLEAAAVLSK	158	sp|P11177|ODPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:28,12-UNIMOD:267,17-UNIMOD:4,26-UNIMOD:188	ms_run[1]:scan=5847	39.45558166666667	4	2752.4426	2752.4408	R	E	233	259
PSM	IEHLYKNPQAHIEGNMK	159	sp|O60547|GMDS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=3611	25.168663333333335	2	2021.004991	2021.015280	R	L	65	82
PSM	DLLHNEDRHDDYFQER	160	sp|Q8N684|CPSF7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=5421	36.674184999999994	2	2100.926373	2100.924945	R	N	440	456
PSM	DLLHNEDRHDDYFQER	161	sp|Q8N684|CPSF7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	8-UNIMOD:267,16-UNIMOD:267	ms_run[1]:scan=5424	36.692278333333334	2	2120.943485	2120.941483	R	N	440	456
PSM	MREIVHIQAGQCGNQIGAK	162	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	1-UNIMOD:35,12-UNIMOD:4	ms_run[1]:scan=3964	27.404128333333333	2	2125.055833	2125.052077	-	F	1	20
PSM	APKPDGPGGGPGGSHMGGNYGDDR	163	sp|P35637-2|FUS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=2531	18.318	3	2251.9665	2251.9665	K	R	448	472
PSM	ELPAQKWWHTGALYR	164	sp|P08195-2|4F2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8072	54.075	2	1854.9529	1854.9529	R	I	111	126
PSM	GHFGPINSVAFHPDGK	165	sp|Q13347|EIF3I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6030	40.634	2	1678.8216	1678.8216	K	S	283	299
PSM	HAHGDQYKATDFVADR	166	sp|P48735-2|IDHP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=3466	24.264	2	1829.8445	1829.8445	R	A	121	137
PSM	HHCPNTPIILVGTK	167	sp|P63000|RAC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=4650	31.767	2	1591.86	1591.8600	R	L	103	117
PSM	HHNQSTAINLNNPESQSMHLETR	168	sp|Q14152-2|EIF3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	18-UNIMOD:35	ms_run[2]:scan=4036	27.861	3	2673.2314	2673.2314	R	L	177	200
PSM	HLNLEYHSSMIADAVKK	169	sp|O43837|IDH3B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	16-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=5828	39.328	2	1967.0337	1967.0337	R	V	335	352
PSM	HYNGEAYEDDEHHPR	170	sp|P31689|DNJA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=1153	9.6413	3	1867.751	1867.7510	R	G	375	390
PSM	HYQHVLAVDPEKAAQMK	171	sp|Q06481-5|APLP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=4643	31.722	2	1963.9938	1963.9938	R	S	281	298
PSM	IAVDEVHCCSQWGHDFRPDYK	172	sp|P46063|RECQ1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	8-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=6239	41.967	3	2618.1431	2618.1431	R	A	216	237
PSM	KNGGLGHMNIALLSDLTK	173	sp|P30048-2|PRDX3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9385	63.005	2	1881.0142	1881.0142	R	Q	131	149
PSM	KYFDFLSSYSAVNQGHCHPK	174	sp|P04181|OAT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	17-UNIMOD:4	ms_run[2]:scan=7505	50.298	3	2384.1008	2384.1008	R	I	77	97
PSM	LKDAVAHCHEAER	175	sp|Q99666-2|RGPD5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	8-UNIMOD:4	ms_run[2]:scan=755	7.3161	2	1534.7311	1534.7311	R	N	181	194
PSM	LNKPQPQPSPLLSTHHTQEEDISSK	176	sp|Q2NKX8|ERC6L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=4193	28.848	3	2810.4199	2810.4199	K	M	747	772
PSM	LTVNEAVKEGVVGPELHHK	177	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5712	38.581	2	2055.1113	2055.1113	R	L	2716	2735
PSM	RDTFNHLTTWLEDAR	178	sp|P61019-2|RAB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:267,15-UNIMOD:267	ms_run[2]:scan=8808	59.044	2	1893.9236	1893.9236	R	Q	67	82
PSM	RFGVPVIADGGIQNVGHIAK	179	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=7784	52.142	2	2047.1327	2047.1327	R	A	356	376
PSM	RGSNTTSHLHQAVAK	180	sp|P22695|QCR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=753	7.3049	2	1605.8336	1605.8336	K	A	301	316
PSM	RQFHLTDDDLLR	181	sp|Q04446|GLGB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6314	42.461	2	1527.7794	1527.7794	R	Y	565	577
PSM	RYNIPHGPVVGSTR	182	sp|P50402|EMD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=4077	28.123	2	1551.827	1551.8270	R	R	18	32
PSM	SAATLITHPFHVITLR	183	sp|Q9Y6C9|MTCH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8580	57.49	2	1776.0046	1776.0046	R	S	132	148
PSM	SAATLITHPFHVITLR	184	sp|Q9Y6C9|MTCH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	16-UNIMOD:267	ms_run[2]:scan=8581	57.496	2	1786.0129	1786.0129	R	S	132	148
PSM	SAYHSHKDQALLSK	185	sp|Q5T4S7-3|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=1232	10.121	2	1583.8056	1583.8056	R	A	2548	2562
PSM	SKPHSEAGTAFIQTQQLHAAMADTFLEHMCR	186	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:1,21-UNIMOD:35,29-UNIMOD:35,30-UNIMOD:4	ms_run[2]:scan=7765	52.019	4	3586.6392	3586.6392	M	L	2	33
PSM	SLSHLPLHSSKEDAYDGVTSENMR	187	sp|Q9NUM4|T106B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5196	35.265	2	2672.25	2672.2500	K	N	4	28
PSM	TAEHFQEAMEESKTHFR	188	sp|Q9BRK5-4|CAB45_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=4846	33.021	3	2076.9323	2076.9323	K	A	131	148
PSM	VHELKEHNGQVTGIDWAPESNR	189	sp|O15143|ARC1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5221	35.424	3	2515.2204	2515.2204	K	I	45	67
PSM	YQLSIHKNPNTSEPQHLLVMK	190	sp|P05023-2|AT1A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5966	40.209	3	2476.2897	2476.2897	K	G	488	509
PSM	HLFEKELAGQSR	191	sp|O00515|LAD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=3553	24.79961	2	1413.738491	1413.736462	R	A	443	455
PSM	MNSGHSFSQTPSASFHGAGGGWGRPR	192	sp|Q9C075|K1C23_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	1-UNIMOD:1,24-UNIMOD:267,26-UNIMOD:267	ms_run[1]:scan=6181	41.60546166666666	2	2735.235009	2734.232203	-	S	1	27
PSM	AHIVFDFHQAADGIQEQQRQEQAGK	193	sp|P30520|PURA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=6840	45.86170833333333	3	2853.365069	2850.379753	R	N	133	158
PSM	ALEHSALAINHKLEIK	194	sp|P17812-2|PYRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=5105	34.682	2	1798.0504	1798.0504	K	Y	89	105
PSM	ATIAGGGVIPHIHK	195	sp|Q71UI9-3|H2AV_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:188	ms_run[2]:scan=4812	32.808	2	1375.8031	1375.8031	K	S	65	79
PSM	DCQLNAHKDHQYQFLEDAVR	196	sp|Q13263-2|TIF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:4	ms_run[2]:scan=6294	42.337	3	2486.1397	2486.1397	R	N	149	169
PSM	DHAATTAGAASLAGGHHR	197	sp|P29083|T2EA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=1589	12.331	3	1699.8139	1699.8139	K	E	219	237
PSM	DTRDQFLDTLQAHGHDVNSFVR	198	sp|Q15021|CND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:267,22-UNIMOD:267	ms_run[2]:scan=8485	56.856	4	2590.2427	2590.2427	R	S	360	382
PSM	FKSHTDQLVLIFAGK	199	sp|Q9UMX0-4|UBQL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=8309	55.639	2	1714.9809	1714.9809	R	I	69	84
PSM	HEERQDEHGYISR	200	sp|P04792|HSPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=1007	8.7744	2	1654.7448	1654.7448	K	C	124	137
PSM	HHNQPYCGIAPYIR	201	sp|P08621|RU17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	7-UNIMOD:4	ms_run[2]:scan=5337	36.151	2	1724.8205	1724.8205	K	E	33	47
PSM	HHNQSTAINLNNPESQSMHLETR	202	sp|Q14152-2|EIF3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	18-UNIMOD:35,23-UNIMOD:267	ms_run[2]:scan=4034	27.849	3	2683.2396	2683.2396	R	L	177	200
PSM	HIQHDTIGYLLTR	203	sp|Q14CX7-2|NAA25_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6375	42.849	2	1565.8314	1565.8314	K	Y	536	549
PSM	HIVLSGGSTMYPGLPSRLER	204	sp|P61160|ARP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7139	47.845	2	2169.1365	2169.1365	K	E	300	320
PSM	HQADACHAYQIIHR	205	sp|Q99538-3|LGMN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=3251	22.884	2	1728.8142	1728.8142	R	N	45	59
PSM	IMYTVFEHTFHVR	206	sp|P41250|GARS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:267	ms_run[2]:scan=8460	56.69	2	1688.8373	1688.8373	R	E	584	597
PSM	KEHFWSIDQTEFR	207	sp|Q9NZM1-5|MYOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7043	47.2	2	1721.8162	1721.8162	K	I	1382	1395
PSM	KPPQPPGPCWFCLASPEVEK	208	sp|Q69YN2-3|C19L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	9-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=9441	63.39	3	2323.1129	2323.1129	R	H	183	203
PSM	LEGHGDPLHLEEVKR	209	sp|P08034|CXB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=4504	30.821	2	1727.8955	1727.8955	R	H	108	123
PSM	LGWDPKPGEGHLDALLR	210	sp|P55786-2|PSA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=8295	55.545	2	1872.9846	1872.9846	R	G	610	627
PSM	LNKPQPQPSPLLSTHHTQEEDISSK	211	sp|Q2NKX8|ERC6L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:188,25-UNIMOD:188	ms_run[2]:scan=4201	28.9	3	2822.4601	2822.4601	K	M	747	772
PSM	LRAPIICVLGHVDTGK	212	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	7-UNIMOD:4	ms_run[2]:scan=7809	52.305	2	1747.9767	1747.9767	K	T	629	645
PSM	MIKPFFHSLSEK	213	sp|P10599|THIO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:35	ms_run[2]:scan=5530	37.355	2	1478.7592	1478.7592	K	Y	37	49
PSM	NHTHQQDIDDLKR	214	sp|P61244-3|MAX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=1483	11.669	2	1618.7812	1618.7812	K	Q	78	91
PSM	RAEQEAQAPHWWR	215	sp|Q96DV4|RM38_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:267,13-UNIMOD:267	ms_run[2]:scan=5044	34.288	3	1683.8133	1683.8133	R	T	60	73
PSM	RHVFGESDELIGQK	216	sp|P60174-4|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=4629	31.636	2	1613.8162	1613.8162	R	V	18	32
PSM	SEEAHAEDSVMDHHFR	217	sp|Q8NC51-3|PAIRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=3891	26.941	2	1895.7857	1895.7857	K	K	315	331
PSM	SEEAHAEDSVMDHHFR	218	sp|Q8NC51-3|PAIRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	16-UNIMOD:267	ms_run[2]:scan=3909	27.054	2	1905.7939	1905.7939	K	K	315	331
PSM	SIFDHIKLPQASK	219	sp|Q9NYF8-4|BCLF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	7-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=7745	51.888	2	1494.8597	1494.8597	R	S	414	427
PSM	SLSHLPLHSSKEDAYDGVTSENMR	220	sp|Q9NUM4|T106B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5195	35.259	3	2672.25	2672.2500	K	N	4	28
PSM	TAFHQEQGHQLLKK	221	sp|P51580|TPMT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=2158	15.951	2	1663.8794	1663.8794	K	H	38	52
PSM	TDNAGDQHGGGGGGGGGAGAAGGGGGGENYDDPHKTPASPVVHIR	222	sp|P14866|HNRPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=3854	26.719	5	4037.7985	4037.7985	K	G	63	108
PSM	THINIVVIGHVDSGK	223	sp|P68104-2|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5664	38.222	3	1587.8733	1587.8733	K	S	6	21
PSM	TIGGGDDSFNTFFSETGAGK	224	sp|P68363-2|TBA1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9601	64.513	2	2006.8858	2006.8858	K	H	41	61
PSM	TLEHLQLSHDQLLEVKR	225	sp|P52789|HXK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6149	41.401	3	2058.1222	2058.1222	K	R	473	490
PSM	TSPHGILDILVHER	226	sp|Q8WYP5|ELYS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9093	61.012	2	1585.8576	1585.8576	R	S	440	454
PSM	VGTTEKEHEEHVCSILASLLR	227	sp|Q8WYA6-3|CTBL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:4	ms_run[2]:scan=9670	65.031	3	2407.2166	2407.2166	K	N	144	165
PSM	YDYNSGEELESYKGHFGPIHCVR	228	sp|Q9Y3F4|STRAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	21-UNIMOD:4	ms_run[2]:scan=6582	44.189	2	2756.2289	2756.2289	K	F	250	273
PSM	HHLQPENPGPGGAAPSLEQNR	229	sp|Q14684|RRP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=3617	25.20934666666667	2	2205.057064	2205.067527	K	G	407	428
PSM	HYNGEAYEDDEHHPR	230	sp|P31689|DNJA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=1421	11.281491666666668	2	1868.728124	1867.751003	R	G	375	390
PSM	EDYKFHHTFSTEIAK	231	sp|P13667|PDIA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=4693	32.047259999999994	2	1852.872268	1851.879164	R	F	332	347
PSM	VFDEHKEEDLFELSHR	232	sp|Q9NSV4|DIAP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	6-UNIMOD:188,16-UNIMOD:267	ms_run[1]:scan=6576	44.149548333333335	2	2045.991180	2044.982518	K	L	391	407
PSM	CILPFDKETGFHR	233	sp|Q9GZT3-2|SLIRP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:4	ms_run[2]:scan=6630	44.502	3	1618.7926	1618.7926	R	G	48	61
PSM	DHSSLLQGTLAEHFGVLPGPR	234	sp|Q5VT52-2|RPRD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9851	66.36	3	2230.1495	2230.1495	K	D	1290	1311
PSM	GFHCESSAHWPIFK	235	sp|P55884|EIF3B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	4-UNIMOD:4	ms_run[2]:scan=6803	45.621	2	1701.7722	1701.7722	R	W	417	431
PSM	GGFCNFMHLKPISR	236	sp|Q01081-4|U2AF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	4-UNIMOD:4	ms_run[2]:scan=7566	50.69	2	1662.8123	1662.8123	R	E	93	107
PSM	GKDHVVSDFSEHGSLK	237	sp|P54886-2|P5CS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=3267	22.986	3	1740.8431	1740.8431	R	Y	764	780
PSM	GKHDGSHEGTVYFK	238	sp|Q15813|TBCE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=2032	15.156	2	1560.7321	1560.7321	R	C	47	61
PSM	HHCPNTPIILVGTK	239	sp|P63000|RAC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	3-UNIMOD:4	ms_run[2]:scan=4651	31.773	2	1585.8399	1585.8399	R	L	103	117
PSM	HLEINPDHSIIETLR	240	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7214	48.344	3	1785.9373	1785.9373	K	Q	633	648
PSM	HLQVNVTNPVQCSLHGKK	241	sp|O94832|MYO1D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:4	ms_run[2]:scan=4668	31.881	2	2058.0793	2058.0793	R	C	959	977
PSM	HSVDLIGRPFGSK	242	sp|Q96FX7|TRM61_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5348	36.217	2	1411.7572	1411.7572	R	V	45	58
PSM	ILHQHLGAPEER	243	sp|Q9NZM1-5|MYOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=2466	17.908	2	1398.7368	1398.7368	K	L	1231	1243
PSM	ILHQHLGAPEER	244	sp|Q9NZM1-5|MYOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:267	ms_run[2]:scan=2469	17.926	2	1408.7451	1408.7451	K	L	1231	1243
PSM	IMYTVFEHTFHVR	245	sp|P41250|GARS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8463	56.708	2	1678.829	1678.8290	R	E	584	597
PSM	IRSHAVACVNQFIISR	246	sp|Q92973-3|TNPO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	2-UNIMOD:267,8-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=6171	41.543	3	1890.0161	1890.0161	K	T	148	164
PSM	KEHFWSIDQTEFR	247	sp|Q9NZM1-5|MYOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7038	47.166	3	1721.8162	1721.8162	K	I	1382	1395
PSM	KHEAFETDFTVHK	248	sp|Q13813-3|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=4088	28.191	2	1599.8084	1599.8084	K	D	1891	1904
PSM	LKHYGPGWVSMANAGK	249	sp|P23284|PPIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5234	35.502	3	1714.8613	1714.8613	K	D	130	146
PSM	LKHYGPGWVSMANAGK	250	sp|P23284|PPIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	2-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=5239	35.536	2	1726.9016	1726.9016	K	D	130	146
PSM	LLHHVTEEKGNPEIDNK	251	sp|Q5TBB1-2|RNH2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	9-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=2275	16.699	3	1984.0417	1984.0417	K	K	137	154
PSM	LLVPGKIQHILCTGNLCTK	252	sp|Q9UBQ0|VPS29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	6-UNIMOD:188,12-UNIMOD:4,17-UNIMOD:4,19-UNIMOD:188	ms_run[2]:scan=8595	57.591	3	2176.2263	2176.2263	K	E	25	44
PSM	MIKPFFHSLSEK	253	sp|P10599|THIO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:35,3-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=5518	37.284	2	1490.7994	1490.7994	K	Y	37	49
PSM	NCVILPHIGSATHR	254	sp|Q9UBQ7|GRHPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	2-UNIMOD:4	ms_run[2]:scan=5139	34.898	2	1573.8147	1573.8147	K	T	287	301
PSM	RDHALLEEQSK	255	sp|O43707|ACTN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=1573	12.231	2	1324.6735	1324.6735	K	Q	633	644
PSM	REPFFHGQDNYDQLVR	256	sp|P19784|CSK22_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=6385	42.912	2	2039.9717	2039.9717	R	I	230	246
PSM	RGEAHLAVNDFELAR	257	sp|Q02790|FKBP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6211	41.789	2	1696.8645	1696.8645	R	A	359	374
PSM	RGHDDLGDHYLDCGDLSNALK	258	sp|Q13098-5|CSN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:4	ms_run[2]:scan=6729	45.151	3	2370.0659	2370.0659	R	C	159	180
PSM	RHVFGESDELIGQK	259	sp|P60174-4|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=4628	31.631	3	1613.8162	1613.8162	R	V	18	32
PSM	RIPHTDPVDYEFQWGPR	260	sp|Q96MG7|NSE3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7844	52.532	3	2112.0177	2112.0177	R	T	237	254
PSM	RLHTLEEVNNNVR	261	sp|Q9NZ52-3|GGA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:267,13-UNIMOD:267	ms_run[2]:scan=3285	23.101	2	1612.8548	1612.8548	K	L	92	105
PSM	RPTPNDDTLDEGVGLVHSNIATEHIPSPAK	262	sp|Q01581|HMCS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7763	52.007	4	3179.5847	3179.5847	R	K	469	499
PSM	RVNAIEHVIIPR	263	sp|Q9Y5K8|VATD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5260	35.666	2	1415.8361	1415.8361	R	I	168	180
PSM	SAYHSHKDQALLSK	264	sp|Q5T4S7-3|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	7-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=1229	10.104	2	1595.8459	1595.8459	R	A	2548	2562
PSM	SHIQTSHCEVFHK	265	sp|Q8N1G0-2|ZN687_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	8-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=1697	13.02	2	1614.7668	1614.7668	K	C	781	794
PSM	SHSAHFFEFLTK	266	sp|P30046-2|DOPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:188	ms_run[2]:scan=7427	49.772	2	1455.7242	1455.7242	R	E	76	88
PSM	SKIVGAPMHDLLLWNNATVTTCHSK	267	sp|P11586|C1TC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	2-UNIMOD:188,22-UNIMOD:4,25-UNIMOD:188	ms_run[2]:scan=8528	57.138	4	2804.4504	2804.4504	R	T	174	199
PSM	SKPHSEAGTAFIQTQQLHAAMADTFLEHMCR	268	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:1,21-UNIMOD:35,29-UNIMOD:35,30-UNIMOD:4	ms_run[2]:scan=7766	52.025	3	3586.6392	3586.6392	M	L	2	33
PSM	TLHPAVHAGILAR	269	sp|P31939-2|PUR9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:267	ms_run[2]:scan=4149	28.568	2	1364.7916	1364.7916	K	N	66	79
PSM	VHELKEHNGQVTGIDWAPESNR	270	sp|O15143|ARC1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	5-UNIMOD:188,22-UNIMOD:267	ms_run[2]:scan=5217	35.397	2	2531.2488	2527.2607	K	I	45	67
PSM	VLQCHKPVHAEYLEK	271	sp|Q9NZJ9-3|NUDT4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	4-UNIMOD:4,6-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=2622	18.891	2	1861.9911	1861.9911	K	L	77	92
PSM	QLFHPEQLITGKEDAANNYAR	272	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:28	ms_run[1]:scan=8973	60.200091666666665	3	2397.1625	2397.1708	R	G	85	106
PSM	MNSGHSFSQTPSASFHGAGGGWGRPR	273	sp|Q9C075|K1C23_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	1-UNIMOD:1,24-UNIMOD:267,26-UNIMOD:267	ms_run[1]:scan=6164	41.498490000000004	3	2734.230559	2734.232203	-	S	1	27
PSM	IEHLYKNPQAHIEGNMK	274	sp|O60547|GMDS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=3615	25.197143333333333	3	2021.004720	2021.015280	R	L	65	82
PSM	SISFHPSGDFILVGTQHPTLR	275	sp|Q05048|CSTF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	21-UNIMOD:267	ms_run[1]:scan=8894	59.635616666666664	3	2318.196762	2318.204685	R	L	222	243
PSM	CILPFDKETGFHR	276	sp|Q9GZT3|SLIRP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	1-UNIMOD:4	ms_run[1]:scan=6629	44.49597333333333	2	1619.798765	1618.792597	R	G	48	61
PSM	TVQGSGHQEHINIHK	277	sp|Q14247|SRC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	15-UNIMOD:188	ms_run[1]:scan=1203	9.946948333333333	2	1689.856887	1689.864244	K	L	43	58
PSM	HFTIDDFEIGRPLGK	278	sp|Q96GD4|AURKB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=8742	58.58894	3	1744.902785	1743.894420	R	G	71	86
PSM	GFGFVSFERHEDAQK	279	sp|P11940|PABP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=6505	43.692006666666664	2	1753.827352	1752.821983	K	A	232	247
PSM	ASALRHEEQPAPGYDTHGR	280	sp|Q07157-2|ZO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	5-UNIMOD:267,19-UNIMOD:267	ms_run[2]:scan=1880	14.192	3	2111.0048	2111.0048	R	L	1072	1091
PSM	ATIAGGGVIPHIHK	281	sp|Q71UI9-3|H2AV_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=4794	32.694	2	1369.783	1369.7830	K	S	65	79
PSM	DHAATTAGAASLAGGHHR	282	sp|P29083|T2EA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	18-UNIMOD:267	ms_run[2]:scan=1575	12.242	3	1709.8221	1709.8221	K	E	219	237
PSM	DHSSLLQGTLAEHFGVLPGPR	283	sp|Q5VT52-2|RPRD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	21-UNIMOD:267	ms_run[2]:scan=9864	66.46	3	2240.1577	2240.1577	K	D	1290	1311
PSM	DLHARPAAPGPAVPSSGR	284	sp|Q9Y4B5|MTCL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=3162	22.327	3	1754.9176	1754.9176	K	A	51	69
PSM	EAEMEEHREHIK	285	sp|Q04637-6|IF4G1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=938	8.3737	2	1536.6991	1536.6991	K	V	812	824
PSM	EDTEEHHLRDYFEEYGK	286	sp|P22626-2|ROA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6647	44.611	2	2195.9396	2195.9396	K	I	109	126
PSM	EIGTHKPLPGITVGDIGPK	287	sp|Q15067-3|ACOX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6459	43.395	2	1928.0731	1928.0731	R	F	173	192
PSM	EKANGTTVHVGIHPSK	288	sp|Q9UNX3|RL26L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=1952	14.651	2	1673.8849	1673.8849	R	V	88	104
PSM	GFHCESSAHWPIFK	289	sp|P55884|EIF3B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	4-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=6808	45.655	2	1707.7923	1707.7923	R	W	417	431
PSM	GKHYYEVSCHDQGLCR	290	sp|Q92499-3|DDX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	9-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=2826	20.171	3	2007.868	2007.8680	K	V	3	19
PSM	GLHVVEIREECGPLPIVVASPR	291	sp|P82675|RT05_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:4	ms_run[2]:scan=8884	59.564	2	2426.3104	2426.3104	K	G	367	389
PSM	GLHVVEIREECGPLPIVVASPR	292	sp|P82675|RT05_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:4	ms_run[2]:scan=8889	59.599	4	2426.3104	2426.3104	K	G	367	389
PSM	HADIVTTTTHKTLR	293	sp|P34897-3|GLYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=2518	18.24	3	1592.8635	1592.8635	K	G	249	263
PSM	HANAKPFEVPFLK	294	sp|Q9UKK9|NUDT5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7421	49.732	2	1496.814	1496.8140	K	F	206	219
PSM	HKEDVYENLHTK	295	sp|P29350-2|PTN6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=1981	14.836	2	1511.7369	1511.7369	K	N	520	532
PSM	HKEDVYENLHTK	296	sp|P29350-2|PTN6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=1982	14.841	2	1523.7771	1523.7771	K	N	520	532
PSM	HQFGTDKDVFGPR	297	sp|O95104-2|SCAF4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=4259	29.254	2	1502.7266	1502.7266	R	F	75	88
PSM	IVVEHIIMKPACPLFVR	298	sp|P57088|TMM33_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:4	ms_run[2]:scan=8482	56.833	2	2021.1318	2021.1318	R	R	213	230
PSM	KFVIHPESNNLIIIETDHNAYTEATK	299	sp|Q15393|SF3B3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7860	52.637	3	2996.5244	2996.5244	R	A	787	813
PSM	KHPDASVNFSEFSK	300	sp|P09429|HMGB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=5157	35.018	3	1603.8033	1603.8033	K	K	30	44
PSM	LEGLTDEINFLR	301	sp|P05787|K2C8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:267	ms_run[2]:scan=10336	70.045	2	1428.7488	1428.7488	R	Q	214	226
PSM	MIKNEVDMQVLHLLGPK	302	sp|P47897-2|SYQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:35,3-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=9140	61.329	3	1992.0939	1992.0939	K	L	153	170
PSM	NCVILPHIGSATHR	303	sp|Q9UBQ7|GRHPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=5142	34.919	2	1583.823	1583.8230	K	T	287	301
PSM	NFWSHETRLPSNTLDR	304	sp|P78527-2|PRKDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	8-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=6435	43.235	2	1991.9717	1991.9717	R	L	2523	2539
PSM	NVPLPEFPEHPFQEEHLK	305	sp|P14735|IDE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8328	55.769	2	2186.0797	2186.0797	K	Q	282	300
PSM	NVPLPEFPEHPFQEEHLK	306	sp|P14735|IDE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	18-UNIMOD:188	ms_run[2]:scan=8343	55.872	2	2192.0998	2192.0998	K	Q	282	300
PSM	REPYGHLGPAELLEASPAAR	307	sp|Q9H6W3|RIOX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:267,20-UNIMOD:267	ms_run[2]:scan=7345	49.208	3	2153.1132	2153.1132	R	S	94	114
PSM	RGHVFEESQVAGTPMFVVK	308	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7022	47.063	3	2117.0728	2117.0728	K	A	767	786
PSM	RLHGLPEQFLYGTATK	309	sp|Q02880-2|TOP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7004	46.943	3	1829.9788	1829.9788	R	H	692	708
PSM	RQFHLTDDDLLR	310	sp|Q04446|GLGB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:267,12-UNIMOD:267	ms_run[2]:scan=6307	42.418	2	1547.7959	1547.7959	R	Y	565	577
PSM	SATEHVQGHLGKK	311	sp|P25098|ARBK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=738	7.2195	2	1390.7317	1390.7317	K	Q	127	140
PSM	SCGSSSHENRPLDLLHK	312	sp|Q7Z6Z7-2|HUWE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:4	ms_run[2]:scan=4102	28.279	2	1935.9221	1935.9221	K	M	3242	3259
PSM	SEEAHAEDSVMDHHFR	313	sp|Q8NC51-3|PAIRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=3884	26.895	3	1895.7857	1895.7857	K	K	315	331
PSM	SIFDHIKLPQASK	314	sp|Q9NYF8-4|BCLF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7716	51.688	2	1482.8195	1482.8195	R	S	414	427
PSM	TEWLDGKHVVFGK	315	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6382	42.894	2	1514.7882	1514.7882	K	V	119	132
PSM	TGISHGHTVYVVHDGFEGLAK	316	sp|P17858|PFKAL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	21-UNIMOD:188	ms_run[2]:scan=5562	37.556	3	2229.1274	2229.1274	R	G	424	445
PSM	TLHPAVHAGILAR	317	sp|P31939-2|PUR9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=4156	28.612	2	1354.7834	1354.7834	K	N	66	79
PSM	VPFSPGPAPPPHMGELDQER	318	sp|Q6Y7W6-4|GGYF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	20-UNIMOD:267	ms_run[2]:scan=6621	44.445	3	2167.0396	2167.0396	R	L	584	604
PSM	YDYNSGEELESYKGHFGPIHCVR	319	sp|Q9Y3F4|STRAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	21-UNIMOD:4	ms_run[2]:scan=6578	44.166	3	2756.2289	2756.2289	K	F	250	273
PSM	VCHKDHEISYAK	320	sp|Q5T4S7|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	2-UNIMOD:4,4-UNIMOD:188,12-UNIMOD:188	ms_run[1]:scan=888	8.082728333333334	2	1497.751560	1497.743706	K	Y	1697	1709
PSM	IVVEHIIMKPACPLFVR	321	sp|P57088|TMM33_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	9-UNIMOD:188,12-UNIMOD:4,17-UNIMOD:267	ms_run[1]:scan=8476	56.79651833333333	3	2038.162833	2037.160228	R	R	213	230
PSM	GKDHVVSDFSEHGSLK	322	sp|P54886|P5CS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	2-UNIMOD:188,16-UNIMOD:188	ms_run[1]:scan=3276	23.043216666666666	3	1752.882277	1752.883370	R	Y	766	782
PSM	KEVVHTVSLHEIDVINSR	323	sp|Q9Y230|RUVB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	1-UNIMOD:188,18-UNIMOD:267	ms_run[1]:scan=6085	40.9849	2	2090.143075	2090.145501	R	T	236	254
PSM	MREIVHIQAGQCGNQIGAK	324	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	1-UNIMOD:35,2-UNIMOD:267,12-UNIMOD:4,19-UNIMOD:188	ms_run[1]:scan=4006	27.671101666666665	3	2141.082615	2141.080475	-	F	1	20
PSM	DTRDQFLDTLQAHGHDVNSFVR	325	sp|Q15021|CND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8493	56.909	4	2570.2262	2570.2262	R	S	360	382
PSM	FKSHTDQLVLIFAGK	326	sp|Q9UMX0-4|UBQL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8315	55.681	2	1702.9406	1702.9406	R	I	69	84
PSM	FLEHKGPVFAPPYEPLPENVK	327	sp|P11387|TOP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7967	53.361	2	2407.2576	2407.2576	K	F	219	240
PSM	GYAFIEYEHERDMHSAYK	328	sp|P08621|RU17_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5675	38.3	2	2244.9899	2244.9899	R	H	145	163
PSM	HFTILDAPGHK	329	sp|P15170|ERF3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:188	ms_run[2]:scan=4478	30.66	2	1240.666	1240.6660	K	S	153	164
PSM	HHNQPYCGIAPYIR	330	sp|P08621|RU17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	7-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=5357	36.274	3	1734.8288	1734.8288	K	E	33	47
PSM	HLDIKENSTHFSQPNSTK	331	sp|Q06787-11|FMR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	5-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=3217	22.671	3	2094.0533	2094.0533	K	V	355	373
PSM	HLEINPDHSIIETLR	332	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	15-UNIMOD:267	ms_run[2]:scan=7231	48.46	3	1795.9456	1795.9456	K	Q	633	648
PSM	HLHPIQTSFQEATASK	333	sp|Q8TEM1|PO210_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	16-UNIMOD:188	ms_run[2]:scan=4488	30.72	3	1799.9262	1799.9262	R	V	1561	1577
PSM	HLHPIQTSFQEATASK	334	sp|Q8TEM1|PO210_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	16-UNIMOD:188	ms_run[2]:scan=4496	30.769	2	1799.9262	1799.9262	R	V	1561	1577
PSM	HNNLDLVIIREQTEGEYSSLEHESAR	335	sp|O43837|IDH3B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:267,26-UNIMOD:267	ms_run[2]:scan=8590	57.556	4	3058.4859	3058.4859	R	G	155	181
PSM	HRVIGSGCNLDSAR	336	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:267,8-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=2175	16.057	3	1560.7694	1560.7694	K	F	157	171
PSM	HRVIGSGCNLDSAR	337	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	8-UNIMOD:4	ms_run[2]:scan=2168	16.012	3	1540.7529	1540.7529	K	F	157	171
PSM	HSVSIHSFQSTSLHNSK	338	sp|Q9ULE6|PALD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3450	24.158	3	1894.9286	1894.9286	R	A	31	48
PSM	HTGPGILSMANAGPNTNGSQFFICTAK	339	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	24-UNIMOD:4,27-UNIMOD:188	ms_run[2]:scan=9391	63.046	3	2796.3419	2796.3419	K	T	92	119
PSM	HTGPGILSMANAGPNTNGSQFFICTAK	340	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	24-UNIMOD:4	ms_run[2]:scan=9428	63.294	3	2790.3218	2790.3218	K	T	92	119
PSM	HYAHTDCPGHADYVK	341	sp|P49411|EFTU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	7-UNIMOD:4	ms_run[2]:scan=1330	10.705	3	1769.758	1769.7580	R	N	121	136
PSM	HYNGEAYEDDEHHPR	342	sp|P31689|DNJA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	15-UNIMOD:267	ms_run[2]:scan=1159	9.6803	3	1877.7593	1877.7593	R	G	375	390
PSM	IDKAVAFQNPQTHVIENLHAAAYR	343	sp|P22695|QCR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6815	45.701	4	2705.4038	2705.4038	K	N	160	184
PSM	IKGEHPGLSIGDVAK	344	sp|P09429|HMGB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4443	30.441	3	1519.8358	1519.8358	K	K	113	128
PSM	INFDKYHPGYFGK	345	sp|P46776|RL27A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6117	41.196	2	1584.7725	1584.7725	R	V	43	56
PSM	IRSHAVACVNQFIISR	346	sp|Q92973-3|TNPO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	8-UNIMOD:4	ms_run[2]:scan=6169	41.532	3	1869.9996	1869.9996	K	T	148	164
PSM	KISSIQSIVPALEIANAHR	347	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9077	60.905	2	2046.1586	2046.1586	K	K	250	269
PSM	KPADLQNLAPGTHPPFITFNSEVK	348	sp|Q9Y696|CLIC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8775	58.81	3	2620.3649	2620.3649	R	T	62	86
PSM	KPADLQNLAPGTHPPFITFNSEVK	349	sp|Q9Y696|CLIC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:188,24-UNIMOD:188	ms_run[2]:scan=8789	58.91	3	2632.4052	2632.4052	R	T	62	86
PSM	KPADLQNLAPGTHPPFITFNSEVK	350	sp|Q9Y696|CLIC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:188,24-UNIMOD:188	ms_run[2]:scan=8800	58.992	2	2632.4052	2632.4052	R	T	62	86
PSM	LKHYGPGWVSMANAGK	351	sp|P23284|PPIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=5235	35.508	3	1726.9016	1726.9016	K	D	130	146
PSM	LKLEPHEGLLLR	352	sp|P08195-2|4F2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6205	41.755	2	1416.8453	1416.8453	R	F	513	525
PSM	LNFSHGTHEYHAETIK	353	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3564	24.873	3	1882.8962	1882.8962	R	N	74	90
PSM	LRHVVSCSSQDSTHCAENLLK	354	sp|P18887|XRCC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	7-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=4365	29.941	3	2440.1587	2440.1587	R	A	6	27
PSM	MREIVHLQAGQCGNQIGAK	355	sp|P68371|TBB4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:4	ms_run[2]:scan=4714	32.181	3	2109.0572	2109.0572	-	F	1	20
PSM	NVLGHMQQGGAPSPFDRNFGTK	356	sp|Q01813-2|PFKAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6646	44.605	3	2357.1335	2357.1335	K	I	659	681
PSM	NVLGHMQQGGAPSPFDRNFGTK	357	sp|Q01813-2|PFKAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6648	44.617	2	2357.1335	2357.1335	K	I	659	681
PSM	RAGLGSGLSLSGLVHPELSR	358	sp|P49748-2|ACADV_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8695	58.263	3	2005.1069	2005.1069	R	S	490	510
PSM	RGSNTTSHLHQAVAK	359	sp|P22695|QCR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=757	7.3269	3	1605.8336	1605.8336	K	A	301	316
PSM	RLFQQILSGVDYCHR	360	sp|Q13131|AAPK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:4	ms_run[2]:scan=8062	54.006	3	1890.9523	1890.9523	R	H	129	144
PSM	RYNIPHGPVVGSTR	361	sp|P50402|EMD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:267,14-UNIMOD:267	ms_run[2]:scan=4079	28.134	2	1571.8435	1571.8435	R	R	18	32
PSM	SEEAHAEDSVMDHHFR	362	sp|Q8NC51-3|PAIRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:35,16-UNIMOD:267	ms_run[2]:scan=2709	19.427	3	1921.7889	1921.7889	K	K	315	331
PSM	SFFHQHYLGGQEPTPSNIR	363	sp|P46379-4|BAG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6009	40.503	3	2214.0606	2214.0606	R	M	655	674
PSM	SFFHQHYLGGQEPTPSNIR	364	sp|P46379-4|BAG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6025	40.606	3	2214.0606	2214.0606	R	M	655	674
PSM	SPLLQLPHIEEDNLRR	365	sp|Q9UGP8|SEC63_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8096	54.231	2	1929.0432	1929.0432	K	V	382	398
PSM	THMQNIKDITSSIHFEAYR	366	sp|Q9UHD8-4|SEPT9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7936	53.152	4	2290.1165	2290.1165	R	V	292	311
PSM	VLIIGSGGREHTLAWK	367	sp|P22102-2|PUR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6572	44.126	2	1735.9733	1735.9733	R	L	5	21
PSM	YHTVNGHNCEVRK	368	sp|P09651-3|ROA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	9-UNIMOD:4	ms_run[2]:scan=690	6.9539	2	1612.7529	1612.7529	K	A	167	180
PSM	QLFHPEQLITGKEDAANNYAR	369	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	12-UNIMOD:188,21-UNIMOD:267	ms_run[1]:scan=7161	47.98709166666667	3	2432.260951	2430.226270	R	G	85	106
PSM	VCHKDHEISYAK	370	sp|Q5T4S7|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	2-UNIMOD:4	ms_run[1]:scan=891	8.09962	2	1485.697123	1485.703448	K	Y	1697	1709
PSM	HHLQPENPGPGGAAPSLEQNR	371	sp|Q14684|RRP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	21-UNIMOD:267	ms_run[1]:scan=3614	25.191048333333335	3	2215.064276	2215.075796	K	G	407	428
PSM	QATYGYYLGNPAEFHDSSDHHTFKK	372	sp|Q15293|RCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:28,24-UNIMOD:188,25-UNIMOD:188	ms_run[1]:scan=6732	45.16884	3	2907.3320	2907.3286	K	M	142	167
PSM	YHTINGHNCEVKK	373	sp|P51991|ROA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	9-UNIMOD:4,12-UNIMOD:188,13-UNIMOD:188	ms_run[1]:scan=852	7.87153	2	1610.805184	1610.802618	K	A	188	201
PSM	QSQHDKIDASELSFPFHESILK	374	sp|P42166|LAP2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:28,6-UNIMOD:188,22-UNIMOD:188	ms_run[1]:scan=9695	65.20978166666667	3	2550.2703	2550.2788	K	V	479	501
PSM	VLHMVGDKPVFSFQPR	375	sp|Q9NP81|SYSM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	8-UNIMOD:188,16-UNIMOD:267	ms_run[1]:scan=7512	50.34377833333333	3	1874.022623	1872.005108	R	G	188	204
PSM	MREIVHIQAGQCGNQIGAK	376	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:35,12-UNIMOD:4	ms_run[1]:scan=3961	27.386721666666666	3	2125.054248	2125.052077	-	F	1	20
PSM	MREIVHIQAGQCGNQIGAK	377	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	2-UNIMOD:267,12-UNIMOD:4,19-UNIMOD:188	ms_run[1]:scan=4713	32.17482666666667	3	2125.084397	2125.085560	-	F	1	20
PSM	DTRDQFLDTLQAHGHDVNSFVR	378	sp|Q15021|CND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8494	56.915	3	2570.2262	2570.2262	R	S	360	382
PSM	EDTEEHHLRDYFEQYGK	379	sp|P09651-3|ROA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6565	44.08	2	2194.9556	2194.9556	K	I	114	131
PSM	EEILANGGSLSHHHGVGK	380	sp|O00116|ADAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	18-UNIMOD:188	ms_run[2]:scan=3045	21.535	2	1846.9381	1846.9381	R	L	604	622
PSM	EPFFHGHDNYDQLVR	381	sp|P68400-2|CSK21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6407	43.054	2	1872.8543	1872.8543	K	I	94	109
PSM	EQSHKVYVQHLLK	382	sp|P16435|NCPR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=3260	22.94	2	1607.8784	1607.8784	R	Q	598	611
PSM	ESKFFEHFIEGGR	383	sp|Q96FW1|OTUB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7540	50.522	2	1581.7576	1581.7576	R	T	186	199
PSM	FHHTFSTEIAK	384	sp|P13667|PDIA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=3291	23.141	2	1316.6513	1316.6513	K	F	336	347
PSM	GHFGPINSVAFHPDGK	385	sp|Q13347|EIF3I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	16-UNIMOD:188	ms_run[2]:scan=6021	40.577	2	1684.8417	1684.8417	K	S	283	299
PSM	GSEFMFEKAPAHHPAAISTAK	386	sp|Q5JTH9-2|RRP12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4830	32.918	3	2226.0892	2226.0892	K	F	166	187
PSM	GVDEVTIVNILTNR	387	sp|P07355-2|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	14-UNIMOD:267	ms_run[2]:scan=10848	75.338	2	1551.8496	1551.8496	K	S	68	82
PSM	HIADLAGNSEVILPVPAFNVINGGSHAGNK	388	sp|P06733-2|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	30-UNIMOD:188	ms_run[2]:scan=10281	69.637	3	3016.5826	3016.5826	R	L	40	70
PSM	HLNEIDLFHCIDPNDSK	389	sp|Q15185-3|TEBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=8523	57.103	2	2071.9729	2071.9729	K	H	49	66
PSM	HPGSFDVVHVK	390	sp|P62701|RS4X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:188	ms_run[2]:scan=3830	26.57	3	1226.6503	1226.6503	R	D	201	212
PSM	HPGSFDVVHVK	391	sp|P62701|RS4X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=3832	26.58	2	1220.6302	1220.6302	R	D	201	212
PSM	HSVDLIGRPFGSK	392	sp|Q96FX7|TRM61_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5347	36.212	3	1411.7572	1411.7572	R	V	45	58
PSM	HSVSIHSFQSTSLHNSK	393	sp|Q9ULE6|PALD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	17-UNIMOD:188	ms_run[2]:scan=3464	24.247	2	1900.9487	1900.9487	R	A	31	48
PSM	HYQHVLAVDPEKAAQMK	394	sp|Q06481-5|APLP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4640	31.704	3	1963.9938	1963.9938	R	S	281	298
PSM	IAQNDHDLGDMSTVADPSVISHLFSHR	395	sp|Q9NR19|ACSA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:35,27-UNIMOD:267	ms_run[2]:scan=8891	59.611	3	2987.4071	2987.4071	K	C	670	697
PSM	IAQNDHDLGDMSTVADPSVISHLFSHR	396	sp|Q9NR19|ACSA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	27-UNIMOD:267	ms_run[2]:scan=10087	68.108	3	2971.4122	2971.4122	K	C	670	697
PSM	IEQSQHLFQAHKEK	397	sp|P53367-3|ARFP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=2124	15.733	2	1721.8849	1721.8849	K	Y	110	124
PSM	IGTQGNVNFGGRPQLPGSHPASSPAQGNR	398	sp|P43405-2|KSYK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:267,29-UNIMOD:267	ms_run[2]:scan=5186	35.202	3	2920.4555	2920.4555	K	Q	262	291
PSM	IINEVSKPLAHHIPVEK	399	sp|P55145|MANF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4536	31.026	3	1923.0942	1923.0942	K	I	88	105
PSM	IISKIENHEGVR	400	sp|P14618|KPYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=2269	16.659	2	1393.7678	1393.7678	K	R	267	279
PSM	IKGEHPGLSIGDVAK	401	sp|P09429|HMGB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=4436	30.398	3	1531.8761	1531.8761	K	K	113	128
PSM	ILKHGINCFINR	402	sp|P78371-2|TCPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	8-UNIMOD:4	ms_run[2]:scan=4856	33.085	3	1483.8082	1483.8082	R	Q	235	247
PSM	ILKHGINCFINR	403	sp|P78371-2|TCPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	8-UNIMOD:4	ms_run[2]:scan=4863	33.13	2	1483.8082	1483.8082	R	Q	235	247
PSM	KHEAFETDFTVHK	404	sp|Q13813-3|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=4084	28.168	3	1599.8084	1599.8084	K	D	1891	1904
PSM	LGWDPKPGEGHLDALLR	405	sp|P55786-2|PSA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8294	55.54	3	1872.9846	1872.9846	R	G	610	627
PSM	LLHIEELRELQTK	406	sp|Q9Y224|RTRAF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6957	46.632	2	1620.9199	1620.9199	R	I	206	219
PSM	LLVPGKIQHILCTGNLCTK	407	sp|Q9UBQ0|VPS29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	6-UNIMOD:188,12-UNIMOD:4,17-UNIMOD:4,19-UNIMOD:188	ms_run[2]:scan=8596	57.597	4	2176.2263	2176.2263	K	E	25	44
PSM	LVDEPGHCADFHPSGTVVAIGTHSGR	408	sp|Q9HC35-2|EMAL4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	8-UNIMOD:4,26-UNIMOD:267	ms_run[2]:scan=5583	37.692	4	2725.2906	2725.2906	R	W	573	599
PSM	MIKNEVDMQVLHLLGPK	409	sp|P47897-2|SYQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:35,3-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=9151	61.401	2	1992.0939	1992.0939	K	L	153	170
PSM	NHTHQQDIDDLKR	410	sp|P61244-3|MAX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=1481	11.658	3	1618.7812	1618.7812	K	Q	78	91
PSM	QIFLGGVDKHTQFWR	411	sp|P12236|ADT3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7925	53.077	2	1830.9529	1830.9529	K	Y	97	112
PSM	QSQHDKIDASELSFPFHESILK	412	sp|P42166|LAP2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	6-UNIMOD:188,22-UNIMOD:188	ms_run[2]:scan=8970	60.177	2	2567.3059	2567.3059	K	V	479	501
PSM	RAGGPEGPPWLPR	413	sp|Q14166|TTL12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:267,13-UNIMOD:267	ms_run[2]:scan=6492	43.611	2	1408.7479	1408.7479	R	T	377	390
PSM	RDFNHINVELSLLGK	414	sp|P32969|RL9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8450	56.625	2	1753.9475	1753.9475	R	K	36	51
PSM	RPGQSFHVNSEVNSVLSPR	415	sp|Q14671-2|PUM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:267,19-UNIMOD:267	ms_run[2]:scan=6083	40.973	3	2129.0881	2129.0881	R	S	193	212
PSM	RYNIPHGPVVGSTR	416	sp|P50402|EMD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4063	28.032	3	1551.827	1551.8270	R	R	18	32
PSM	SHLLNCCPHDVLSGTR	417	sp|Q9Y383-3|LC7L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	6-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=4884	33.262	3	1864.8672	1864.8672	K	M	35	51
PSM	SHRVPLDVACAR	418	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	3-UNIMOD:267,10-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=3180	22.435	3	1399.7257	1399.7257	K	G	3117	3129
PSM	SHSAHFFEFLTK	419	sp|P30046-2|DOPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7419	49.72	2	1449.7041	1449.7041	R	E	76	88
PSM	SIIPLPHPVRPEDIE	420	sp|P61599|NAA20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8143	54.549	2	1710.9305	1710.9305	K	-	164	179
PSM	SIYGEKFEDENFILK	421	sp|P62937|PPIA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	6-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=8583	57.508	2	1842.9442	1842.9442	K	H	77	92
PSM	SLAPSIHGHDYVKK	422	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=2781	19.893	2	1550.8205	1550.8205	K	A	302	316
PSM	SSALQWLTPEQTSGKEHPYLFSQCQAIHCR	423	sp|P09960-3|LKHA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	24-UNIMOD:4,29-UNIMOD:4	ms_run[2]:scan=8837	59.234	3	3558.6773	3558.6773	K	A	89	119
PSM	THLSLSHQPDKK	424	sp|Q6UB35|C1TM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=1090	9.2575	2	1389.7365	1389.7365	K	G	910	922
PSM	TQHHVEALVEHQNGK	425	sp|Q9H0U6|RM18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=1511	11.841	2	1725.8547	1725.8547	R	V	86	101
PSM	TQHHVEALVEHQNGK	426	sp|Q9H0U6|RM18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=1515	11.869	3	1725.8547	1725.8547	R	V	86	101
PSM	TVYCNVHKHEPLVLFCESCDTLTCR	427	sp|Q13263-2|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	4-UNIMOD:4,16-UNIMOD:4,19-UNIMOD:4,24-UNIMOD:4	ms_run[2]:scan=7390	49.529	2	3137.4191	3137.4191	R	D	124	149
PSM	YGAHNYHPLPVALER	428	sp|P04181|OAT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5325	36.071	2	1735.8794	1735.8794	K	G	50	65
PSM	LNFSHGTHEYHAETIK	429	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=4418	30.280929999999998	2	1883.880248	1882.896211	R	N	74	90
PSM	QLPHFTSEHIKR	430	sp|O75643|U520_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28	ms_run[1]:scan=5205	35.32356666666667	2	1474.7692	1474.7676	K	C	1962	1974
PSM	HYNGEAYEDDEHHPR	431	sp|P31689|DNJA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	15-UNIMOD:267	ms_run[1]:scan=1548	12.070743333333333	2	1878.736264	1877.759272	R	G	375	390
PSM	QGTHITVVSHSRPVGHCLEAAAVLSK	432	sp|P11177|ODPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28,17-UNIMOD:4	ms_run[1]:scan=5851	39.47893333333333	3	2736.4123	2736.4124	R	E	233	259
PSM	SISFHPSGDFILVGTQHPTLR	433	sp|Q05048|CSTF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=8893	59.62949833333333	3	2308.188847	2308.196416	R	L	222	243
PSM	RLQGSGVTVNALHPGVAR	434	sp|Q8NBN7|RDH13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=4591	31.3881	3	1831.995257	1831.017663	R	T	217	235
PSM	FKAESDLFLAEHHK	435	sp|P50851|LRBA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	2-UNIMOD:188,14-UNIMOD:188	ms_run[1]:scan=5171	35.10529666666667	2	1683.878391	1682.881914	K	L	392	406
PSM	VLHASLQSVVHKEESLGPK	436	sp|Q15024|EXOS7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=5648	38.11251666666667	2	2059.137972	2057.126939	K	R	265	284
PSM	ALEHSALAINHKLEIK	437	sp|P17812-2|PYRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5095	34.615	3	1786.0101	1786.0101	K	Y	89	105
PSM	ASALRHEEQPAPGYDTHGR	438	sp|Q07157-2|ZO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	5-UNIMOD:267,19-UNIMOD:267	ms_run[2]:scan=1898	14.307	4	2111.0048	2111.0048	R	L	1072	1091
PSM	DPIPYLPPLEKLPHEK	439	sp|P08621|RU17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=8667	58.076	2	1897.0752	1897.0752	R	H	17	33
PSM	FHCPHCDTVIAR	440	sp|P49711-2|CTCF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	3-UNIMOD:4,6-UNIMOD:4	ms_run[2]:scan=3081	21.77	2	1511.6762	1511.6762	K	K	109	121
PSM	GATYGKPVHHGVNQLK	441	sp|P61313-2|RL15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=1328	10.694	2	1704.906	1704.9060	K	F	78	94
PSM	HFLLEEDKPEEPTAHAFVSTLTR	442	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8222	55.076	4	2666.334	2666.3340	R	G	1516	1539
PSM	HGVYNPNKIFGVTTLDIVR	443	sp|P40926|MDHM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9157	61.444	3	2142.1586	2142.1586	K	A	158	177
PSM	HHCAAITPGR	444	sp|Q92896|GSLG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	3-UNIMOD:4	ms_run[2]:scan=820	7.6835	2	1118.5403	1118.5403	K	G	1077	1087
PSM	HHGDVMDLQFFDQER	445	sp|Q8NFH3-2|NUP43_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8433	56.512	2	1872.8213	1872.8213	R	I	73	88
PSM	HHNQPYCGIAPYIR	446	sp|P08621|RU17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	7-UNIMOD:4	ms_run[2]:scan=5338	36.157	3	1724.8205	1724.8205	K	E	33	47
PSM	HIQHDTIGYLLTR	447	sp|Q14CX7-2|NAA25_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6374	42.844	3	1565.8314	1565.8314	K	Y	536	549
PSM	HKITSADGHIESSALLK	448	sp|Q8N573-6|OXR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=3930	27.187	3	1805.9636	1805.9636	K	E	21	38
PSM	HLEFSHDQYR	449	sp|Q9NR45|SIAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:267	ms_run[2]:scan=2950	20.953	2	1340.6137	1340.6137	R	E	87	97
PSM	HLEFSHDQYR	450	sp|Q9NR45|SIAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2945	20.92	2	1330.6054	1330.6054	R	E	87	97
PSM	HLGWLAEKVPGESK	451	sp|Q13884-2|SNTB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5835	39.376	2	1549.8253	1549.8253	R	K	325	339
PSM	HLREYQDLLNVK	452	sp|P08670|VIME_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5947	40.088	2	1526.8205	1526.8205	R	M	379	391
PSM	HQLLEADISAHEDRLK	453	sp|Q13813-3|SPTN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=4986	33.917	3	1873.9646	1873.9646	K	D	1680	1696
PSM	HRAFEDEMSGR	454	sp|Q01082-3|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:267,11-UNIMOD:267	ms_run[2]:scan=2558	18.487	2	1353.5999	1353.5999	K	S	667	678
PSM	HRVIGSGCNLDSAR	455	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:267,8-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=2166	16.001	2	1560.7694	1560.7694	K	F	157	171
PSM	HRVVGAVIDQGLITR	456	sp|E9PRG8|CK098_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:267,15-UNIMOD:267	ms_run[2]:scan=5486	37.084	3	1652.9589	1652.9589	R	H	34	49
PSM	IAQNDHDLGDMSTVADPSVISHLFSHR	457	sp|Q9NR19|ACSA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10094	68.16	3	2961.4039	2961.4039	K	C	670	697
PSM	IGYPKPALLHSTFFPALQGAQTK	458	sp|P23381|SYWC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	5-UNIMOD:188,23-UNIMOD:188	ms_run[2]:scan=9561	64.231	2	2496.3932	2496.3932	R	M	327	350
PSM	KFGTINIVHPK	459	sp|Q9Y617-2|SERC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=4637	31.686	2	1252.7292	1252.7292	K	L	117	128
PSM	LADFGVLHRNELSGALTGLTR	460	sp|P26639|SYTC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9378	62.957	3	2239.2073	2239.2073	R	V	434	455
PSM	LADFGVLHRNELSGALTGLTR	461	sp|P26639|SYTC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9397	63.087	2	2239.2073	2239.2073	R	V	434	455
PSM	LEKEYFDQHFGPFFR	462	sp|O15118-2|NPC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9131	61.271	2	1958.9315	1958.9315	R	T	140	155
PSM	LHDVLHSDKK	463	sp|Q00535-2|CDK5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=1054	9.0512	2	1190.6408	1190.6408	R	L	66	76
PSM	LLHQLADLVERDR	464	sp|P47895|AL1A3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:267,13-UNIMOD:267	ms_run[2]:scan=7448	49.916	2	1596.8851	1596.8851	R	A	99	112
PSM	LNCQVIGASVDSHFCHLAWVNTPKK	465	sp|Q06830|PRDX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	3-UNIMOD:4,15-UNIMOD:4,24-UNIMOD:188,25-UNIMOD:188	ms_run[2]:scan=8372	56.08	3	2892.4566	2892.4566	K	Q	69	94
PSM	LNFSHGTHEYHAETIK	466	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	16-UNIMOD:188	ms_run[2]:scan=3520	24.603	3	1888.9163	1888.9163	R	N	74	90
PSM	MIKNEVDMQVLHLLGPK	467	sp|P47897-2|SYQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:35	ms_run[2]:scan=9158	61.45	3	1980.0536	1980.0536	K	L	153	170
PSM	REPWLLPSQHNDIIR	468	sp|Q14697|GANAB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:267,15-UNIMOD:267	ms_run[2]:scan=7076	47.417	3	1893.0124	1893.0124	R	D	684	699
PSM	REPWLLPSQHNDIIR	469	sp|Q14697|GANAB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7061	47.32	3	1872.9959	1872.9959	R	D	684	699
PSM	RFGVPVIADGGIQNVGHIAK	470	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:267,20-UNIMOD:188	ms_run[2]:scan=7767	52.031	3	2063.1611	2059.1730	R	A	356	376
PSM	RFGVPVIADGGIQNVGHIAK	471	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:267,20-UNIMOD:188	ms_run[2]:scan=7781	52.123	2	2063.1611	2059.1730	R	A	356	376
PSM	RHIEIFTDLSSR	472	sp|P13010|XRCC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6011	40.515	3	1472.7736	1472.7736	K	F	130	142
PSM	RHIEIFTDLSSR	473	sp|P13010|XRCC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:267,12-UNIMOD:267	ms_run[2]:scan=6031	40.64	2	1492.7901	1492.7901	K	F	130	142
PSM	RLHTLEEVNNNVR	474	sp|Q9NZ52-3|GGA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:267,13-UNIMOD:267	ms_run[2]:scan=3278	23.055	3	1612.8548	1612.8548	K	L	92	105
PSM	RMGHAGAIIAGGK	475	sp|P53597|SUCA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=1874	14.151	2	1237.6714	1237.6714	R	G	296	309
PSM	SAATLITHPFHVITLR	476	sp|Q9Y6C9|MTCH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	16-UNIMOD:267	ms_run[2]:scan=8575	57.456	3	1786.0129	1786.0129	R	S	132	148
PSM	SHRVPLDVACAR	477	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:4	ms_run[2]:scan=3185	22.467	3	1379.7092	1379.7092	K	G	3117	3129
PSM	SKIVGAPMHDLLLWNNATVTTCHSK	478	sp|P11586|C1TC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:188,22-UNIMOD:4,25-UNIMOD:188	ms_run[2]:scan=8514	57.044	3	2804.4504	2804.4504	R	T	174	199
PSM	SRAHLVAVFNEYQR	479	sp|P50995-2|ANX11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:267,14-UNIMOD:267	ms_run[2]:scan=5549	37.473	3	1708.8912	1708.8912	R	M	354	368
PSM	SVGKIEHSFWR	480	sp|Q16531|DDB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5270	35.726	2	1344.6939	1344.6939	K	S	1064	1075
PSM	SYELPDGQVITIGNER	481	sp|Q562R1|ACTBL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8937	59.948	2	1789.8846	1789.8846	R	F	240	256
PSM	TFEEKDIELHLESSSHQETLDHIQK	482	sp|Q5BKZ1-3|ZN326_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	5-UNIMOD:188,25-UNIMOD:188	ms_run[2]:scan=6650	44.63	2	3004.4817	3004.4817	R	Q	115	140
PSM	TGHYTLIHDHSK	483	sp|Q8N543-2|OGFD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:188	ms_run[2]:scan=1494	11.736	2	1413.7096	1413.7096	K	A	304	316
PSM	THASPADLCHYHSQESDGLVCLLK	484	sp|P43405-2|KSYK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	9-UNIMOD:4,21-UNIMOD:4	ms_run[2]:scan=7264	48.683	2	2737.2588	2737.2588	R	K	81	105
PSM	TQHHVEALVEHQNGK	485	sp|Q9H0U6|RM18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	15-UNIMOD:188	ms_run[2]:scan=1513	11.852	3	1731.8748	1731.8748	R	V	86	101
PSM	VHVGDEDFVHLR	486	sp|P04080|CYTB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:267	ms_run[2]:scan=5713	38.588	3	1431.7134	1431.7134	K	V	57	69
PSM	VNESSHYDLAFTDVHFKPGQIR	487	sp|P29144|TPP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7594	50.884	3	2559.2506	2559.2506	K	R	639	661
PSM	VYADGIFDLFHSGHAR	488	sp|Q9Y5K3-2|PCY1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	16-UNIMOD:267	ms_run[2]:scan=9984	67.313	2	1813.8775	1813.8775	R	A	79	95
PSM	YFLHTGHLTIAGCK	489	sp|P49589-2|SYCC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	13-UNIMOD:4	ms_run[2]:scan=5923	39.935	2	1616.8133	1616.8133	R	M	393	407
PSM	YHTINGHNAEVRK	490	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	12-UNIMOD:267,13-UNIMOD:188	ms_run[1]:scan=1063	9.10362	2	1554.784585	1553.803371	K	A	174	187
PSM	QATYGYYLGNPAEFHDSSDHHTFKK	491	sp|Q15293|RCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28	ms_run[1]:scan=6743	45.23721666666667	3	2895.2916	2895.2883	K	M	142	167
PSM	QATYGYYLGNPAEFHDSSDHHTFKK	492	sp|Q15293|RCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28,24-UNIMOD:188,25-UNIMOD:188	ms_run[1]:scan=6764	45.375325	3	2907.3320	2907.3286	K	M	142	167
PSM	HYNGEAYEDDEHHPR	493	sp|P31689|DNJA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	15-UNIMOD:267	ms_run[1]:scan=1724	13.188263333333333	3	1878.736964	1877.759272	R	G	375	390
PSM	CHAIIDEQPLIFKNDPYHPDHFNCANCGK	494	sp|P48059|LIMS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:385,1-UNIMOD:4,13-UNIMOD:188,24-UNIMOD:4,27-UNIMOD:4,29-UNIMOD:188	ms_run[1]:scan=8359	55.99220833333334	4	3504.5888	3504.5835	K	E	138	167
PSM	SAHLTNPWNEHKPVK	495	sp|Q96MU7|YTDC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=3480	24.350826666666666	2	1756.907990	1756.900902	K	I	458	473
PSM	CHEFLIFEDRK	496	sp|P11172|UMPS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:385,1-UNIMOD:4,10-UNIMOD:267,11-UNIMOD:188	ms_run[1]:scan=8842	59.27021333333333	2	1491.7174	1491.7146	K	F	304	315
PSM	LEAELLQIEERHQEK	497	sp|Q969G3|SMCE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	11-UNIMOD:267,15-UNIMOD:188	ms_run[1]:scan=4123	28.405685	2	1882.030194	1879.997439	K	K	241	256
PSM	HTGPGILSMANAGPNTNGSQFFICTAK	498	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	24-UNIMOD:4,27-UNIMOD:188	ms_run[1]:scan=9611	64.58800666666667	3	2797.313424	2796.341898	K	T	92	119
PSM	AGVLAHLEEERDLK	499	sp|P35579-2|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5730	38.697	2	1578.8366	1578.8366	R	I	629	643
PSM	DHRDNLEFFLAGIGR	500	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:267,15-UNIMOD:267	ms_run[2]:scan=10294	69.725	3	1778.8967	1778.8967	K	L	788	803
PSM	DPIPYLPPLEKLPHEK	501	sp|P08621|RU17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=8664	58.059	2	1885.0349	1885.0349	R	H	17	33
PSM	EKANGTTVHVGIHPSK	502	sp|Q9UNX3|RL26L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=1929	14.502	2	1685.9252	1685.9252	R	V	88	104
PSM	ETGEHLVHVKK	503	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=1032	8.9268	2	1287.7338	1287.7338	K	N	2007	2018
PSM	FAGGLHFSGPKVEGGVK	504	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=5777	38.996	3	1697.9292	1697.9292	K	G	5613	5630
PSM	FLEHKGPVFAPPYEPLPENVK	505	sp|P11387|TOP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	5-UNIMOD:188,21-UNIMOD:188	ms_run[2]:scan=7978	53.435	2	2419.2979	2419.2979	K	F	219	240
PSM	FRSHEGETAYIR	506	sp|Q07955|SRSF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:267,12-UNIMOD:267	ms_run[2]:scan=2548	18.426	2	1484.7275	1484.7275	K	V	180	192
PSM	GIPHLVTHDAR	507	sp|P62701|RS4X_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2991	21.209	2	1214.652	1214.6520	K	T	135	146
PSM	GKHYYEVSCHDQGLCR	508	sp|Q92499-3|DDX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:188,9-UNIMOD:4,15-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=2827	20.177	2	2023.8964	2019.9082	K	V	3	19
PSM	GRHEPGLGGPAER	509	sp|Q15554-4|TERF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=1306	10.556	2	1331.6694	1331.6694	R	G	71	84
PSM	GSSVDAPPRPCHTTPDSQFGTEHVLR	510	sp|Q9BSJ8|ESYT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:4	ms_run[2]:scan=4802	32.745	3	2847.3358	2847.3358	R	I	625	651
PSM	HFTILDAPGHK	511	sp|P15170|ERF3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4480	30.671	2	1234.6459	1234.6459	K	S	153	164
PSM	HGKAPILIATDVASR	512	sp|P17844-2|DDX5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5128	34.829	3	1547.8784	1547.8784	K	G	310	325
PSM	HHCPNTPIILVGTK	513	sp|P63000|RAC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=4642	31.716	3	1591.86	1591.8600	R	L	103	117
PSM	HHCPNTPIILVGTK	514	sp|P63000|RAC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:4	ms_run[2]:scan=4654	31.795	3	1585.8399	1585.8399	R	L	103	117
PSM	HHGDVMDLQFFDQER	515	sp|Q8NFH3-2|NUP43_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	15-UNIMOD:267	ms_run[2]:scan=8426	56.466	3	1882.8296	1882.8296	R	I	73	88
PSM	HIEHMESDELGLQKK	516	sp|O75150-3|BRE1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=3318	23.316	3	1792.8778	1792.8778	R	L	426	441
PSM	HIVLSGGSTMYPGLPSRLER	517	sp|P61160|ARP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	17-UNIMOD:267,20-UNIMOD:267	ms_run[2]:scan=7142	47.867	2	2189.153	2189.1530	K	E	300	320
PSM	HKGPPVFTQEER	518	sp|Q99447-4|PCY2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2498	18.109	3	1423.7208	1423.7208	K	Y	33	45
PSM	HKITSADGHIESSALLK	519	sp|Q8N573-6|OXR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=3920	27.123	3	1818.0038	1818.0038	K	E	21	38
PSM	HKPLLIDMNK	520	sp|Q15149-7|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:188,10-UNIMOD:188	ms_run[2]:scan=3864	26.778	2	1219.715	1219.7150	R	V	168	178
PSM	HLQLAIRNDEELNK	521	sp|Q99878|H2A1J_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	7-UNIMOD:267,14-UNIMOD:188	ms_run[2]:scan=4810	32.797	2	1707.9239	1703.9357	R	L	83	97
PSM	HLQVNVTNPVQCSLHGKK	522	sp|O94832|MYO1D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:4	ms_run[2]:scan=4658	31.816	3	2058.0793	2058.0793	R	C	959	977
PSM	HRAFEDEMSGR	523	sp|Q01082-3|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:267,11-UNIMOD:267	ms_run[2]:scan=2551	18.443	3	1353.5999	1353.5999	K	S	667	678
PSM	HRDYETATLSDIK	524	sp|O43707|ACTN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4232	29.091	2	1547.758	1547.7580	K	A	438	451
PSM	HRVVGAVIDQGLITR	525	sp|E9PRG8|CK098_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:267,15-UNIMOD:267	ms_run[2]:scan=5488	37.095	2	1652.9589	1652.9589	R	H	34	49
PSM	HSQYHVDGSLEKDR	526	sp|Q96HS1|PGAM5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2148	15.888	3	1669.7808	1669.7808	R	T	105	119
PSM	HYTEHADGLCHK	527	sp|P07947|YES_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:4,12-UNIMOD:188	ms_run[2]:scan=908	8.2004	2	1472.6562	1472.6562	K	L	239	251
PSM	IPPYHYIHVLDQNSNVSR	528	sp|Q14764|MVP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6379	42.872	3	2151.0861	2151.0861	R	V	10	28
PSM	IYPTFLHLHGK	529	sp|Q08945|SSRP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:188	ms_run[2]:scan=6340	42.625	2	1330.7493	1330.7493	R	T	218	229
PSM	KFGTINIVHPK	530	sp|Q9Y617-2|SERC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=4630	31.642	2	1264.7694	1264.7694	K	L	117	128
PSM	KGASVEHVCHR	531	sp|P55039|DRG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:4	ms_run[2]:scan=576	6.3129	2	1278.6251	1278.6251	R	I	311	322
PSM	KHFPSVNWLISYSK	532	sp|P38606-2|VATA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=8488	56.875	3	1716.939	1716.9390	R	Y	410	424
PSM	LGGHGPSFPLKGITEQQK	533	sp|P13010|XRCC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=5773	38.972	3	1905.0511	1905.0511	R	E	185	203
PSM	LLIHQGPSHTR	534	sp|Q92625-2|ANS1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=1721	13.171	2	1257.6942	1257.6942	R	V	131	142
PSM	LLVPGKIQHILCTGNLCTK	535	sp|Q9UBQ0|VPS29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:4,17-UNIMOD:4	ms_run[2]:scan=8579	57.484	3	2164.186	2164.1861	K	E	25	44
PSM	NLPLPPPPPPR	536	sp|P61978-3|HNRPK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:267	ms_run[2]:scan=5857	39.519	2	1203.7003	1203.7003	R	G	282	293
PSM	NRHEIAVMLLEGGANPDAK	537	sp|O75832-2|PSD10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6978	46.775	3	2034.0317	2034.0317	K	D	117	136
PSM	QSQHDKIDASELSFPFHESILK	538	sp|P42166|LAP2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=8972	60.194	2	2555.2656	2555.2656	K	V	479	501
PSM	RGHVFEESQVAGTPMFVVK	539	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:267,19-UNIMOD:188	ms_run[2]:scan=7010	46.983	2	2133.1012	2129.1131	K	A	767	786
PSM	RYNIPHGPVVGSTR	540	sp|P50402|EMD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:267,14-UNIMOD:267	ms_run[2]:scan=4074	28.105	3	1571.8435	1571.8435	R	R	18	32
PSM	SHIRTDDVHAK	541	sp|Q92499-3|DDX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=656	6.7549	2	1277.6476	1277.6476	K	D	334	345
PSM	SLDMDSIIAEVK	542	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:188	ms_run[2]:scan=10128	68.433	2	1325.6844	1325.6844	R	A	253	265
PSM	SLDMDSIIAEVK	543	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10129	68.438	2	1319.6643	1319.6643	R	A	253	265
PSM	SPFLPDLKPNLNSLHSSPSGSGPCDELR	544	sp|Q8NF64-3|ZMIZ2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	24-UNIMOD:4	ms_run[2]:scan=8770	58.774	4	3020.4662	3020.4662	K	L	337	365
PSM	SPLLAGGSPPQPVVPAHKDK	545	sp|Q8NFH5-2|NUP35_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	18-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=4901	33.368	3	2006.1352	2006.1352	R	S	49	69
PSM	SRAHLVAVFNEYQR	546	sp|P50995-2|ANX11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5551	37.484	3	1688.8747	1688.8747	R	M	354	368
PSM	TEWLDGKHVVFGK	547	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	7-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=6381	42.889	2	1526.8284	1526.8284	K	V	119	132
PSM	TFEEKDIELHLESSSHQETLDHIQK	548	sp|Q5BKZ1-3|ZN326_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6637	44.548	4	2992.4414	2992.4414	R	Q	115	140
PSM	THPSVVPGSIAFSLPQRK	549	sp|P46459|NSF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6987	46.835	2	1920.0581	1920.0581	K	W	51	69
PSM	VHLVGIDIFTGK	550	sp|Q9GZV4|IF5A2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:188	ms_run[2]:scan=9417	63.218	2	1303.7596	1303.7596	K	K	56	68
PSM	VNESSHYDLAFTDVHFKPGQIR	551	sp|P29144|TPP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	17-UNIMOD:188,22-UNIMOD:267	ms_run[2]:scan=7606	50.962	2	2575.279	2571.2909	K	R	639	661
PSM	VPFSPGPAPPPHMGELDQER	552	sp|Q6Y7W6-4|GGYF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6612	44.388	3	2157.0313	2157.0313	R	L	584	604
PSM	YHTINGHNAEVRK	553	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1212	10.000391666666667	3	1538.754483	1537.774973	K	A	174	187
PSM	QLPHFTSEHIKR	554	sp|O75643|U520_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:28,11-UNIMOD:188,12-UNIMOD:267	ms_run[1]:scan=5204	35.317926666666665	3	1490.8010	1490.7960	K	C	1962	1974
PSM	KEHFWSIDQTEFR	555	sp|Q9NZM1|MYOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=7067	47.35522666666667	2	1722.817353	1721.816169	K	I	1866	1879
PSM	RDIQQTLTQNMER	556	sp|Q9HAV4|XPO5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	11-UNIMOD:35,13-UNIMOD:267	ms_run[1]:scan=7344	49.20234333333333	2	1657.8192	1657.8072	R	I	176	189
PSM	QMATALAHCHQHGLVLR	557	sp|Q96RU7|TRIB3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:28,9-UNIMOD:4	ms_run[1]:scan=6074	40.915325	3	1924.9632	1924.9512	R	D	165	182
PSM	HAFGCALVHTSGWK	558	sp|Q9BQ52|RNZ2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	5-UNIMOD:4,14-UNIMOD:188	ms_run[1]:scan=5451	36.86246333333334	3	1575.776888	1575.771196	K	V	647	661
PSM	KHFPSVNWLISYSK	559	sp|P38606|VATA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:188,14-UNIMOD:188	ms_run[1]:scan=8539	57.210069999999995	2	1717.944419	1716.939035	R	Y	443	457
PSM	EEILANGGSLSHHHGVGK	560	sp|O00116|ADAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=3066	21.671878333333332	2	1840.923877	1840.918009	R	L	604	622
PSM	GDVVFSLYHTKQAPR	561	sp|O43304|S14L5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0		ms_run[1]:scan=6707	45.007286666666666	2	1717.9282	1716.8942	R	L	545	560
PSM	AVFVDLEPTVIDEVR	562	sp|P68363-2|TBA1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	15-UNIMOD:267	ms_run[2]:scan=10401	70.615	2	1710.9068	1710.9068	R	T	65	80
PSM	DCQLLEHKEHR	563	sp|O15164-2|TIF1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	2-UNIMOD:4	ms_run[2]:scan=1918	14.433	2	1463.6939	1463.6939	R	Y	245	256
PSM	DTRDQFLDTLQAHGHDVNSFVR	564	sp|Q15021|CND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8505	56.986	2	2570.2262	2570.2262	R	S	360	382
PSM	EARPNTHPGPAPTPAELPWTNIDLK	565	sp|Q7Z6L1-3|TCPR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8939	59.96	3	2721.3875	2721.3875	R	E	399	424
PSM	ELYERPPHLFAIADAAYK	566	sp|O94832|MYO1D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	5-UNIMOD:267,18-UNIMOD:188	ms_run[2]:scan=8451	56.631	2	2119.1073	2115.1192	R	A	70	88
PSM	FKSHTDQLVLIFAGK	567	sp|Q9UMX0-4|UBQL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8305	55.61	3	1702.9406	1702.9406	R	I	69	84
PSM	FLEHKGPVFAPPYEPLPENVK	568	sp|P11387|TOP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	5-UNIMOD:188,21-UNIMOD:188	ms_run[2]:scan=7972	53.395	3	2419.2979	2419.2979	K	F	219	240
PSM	GKHDGSHEGTVYFK	569	sp|Q15813|TBCE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	2-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=2043	15.224	2	1572.7724	1572.7724	R	C	47	61
PSM	GVDEVTIVNILTNR	570	sp|P07355-2|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	14-UNIMOD:267	ms_run[2]:scan=10854	75.385	3	1551.8496	1551.8496	K	S	68	82
PSM	HAIPSAERGPGLLESPSIFNFTADR	571	sp|Q92615|LAR4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9903	66.748	4	2681.3562	2681.3562	R	L	420	445
PSM	HAIPSAERGPGLLESPSIFNFTADR	572	sp|Q92615|LAR4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	8-UNIMOD:267,25-UNIMOD:267	ms_run[2]:scan=9917	66.844	4	2701.3727	2701.3727	R	L	420	445
PSM	HHGDVMDLQFFDQER	573	sp|Q8NFH3-2|NUP43_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8427	56.472	3	1872.8213	1872.8213	R	I	73	88
PSM	HIQHDTIGYLLTR	574	sp|Q14CX7-2|NAA25_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	13-UNIMOD:267	ms_run[2]:scan=6370	42.815	3	1575.8397	1575.8397	K	Y	536	549
PSM	HKGPPVFTQEER	575	sp|Q99447-4|PCY2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=2521	18.257	2	1423.7208	1423.7208	K	Y	33	45
PSM	HKWNDFAEDSLR	576	sp|O60313-13|OPA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=5619	37.924	2	1516.7059	1516.7059	R	V	676	688
PSM	HLEINPDHPIVETLR	577	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6391	42.952	3	1781.9424	1781.9424	K	Q	625	640
PSM	HLHPIQTSFQEATASK	578	sp|Q8TEM1|PO210_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=4481	30.676	3	1793.906	1793.9060	R	V	1561	1577
PSM	HPGSFDVVHVK	579	sp|P62701|RS4X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:188	ms_run[2]:scan=3831	26.574	2	1226.6503	1226.6503	R	D	201	212
PSM	HWILPQDYDHAQAEAR	580	sp|Q15293-2|RCN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	16-UNIMOD:267	ms_run[2]:scan=6019	40.565	3	1958.9263	1958.9263	R	H	220	236
PSM	IAVDEVHCCSQWGHDFRPDYK	581	sp|P46063|RECQ1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	8-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=6251	42.047	2	2618.1431	2618.1431	R	A	216	237
PSM	IGYPKPALLHSTFFPALQGAQTK	582	sp|P23381|SYWC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9567	64.279	3	2484.3529	2484.3529	R	M	327	350
PSM	IGYPKPALLHSTFFPALQGAQTK	583	sp|P23381|SYWC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	5-UNIMOD:188,23-UNIMOD:188	ms_run[2]:scan=9577	64.349	3	2496.3932	2496.3932	R	M	327	350
PSM	KFGTINIVHPK	584	sp|Q9Y617-2|SERC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=4627	31.627	3	1264.7694	1264.7694	K	L	117	128
PSM	KHEAFESDLAAHQDR	585	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=2703	19.39	3	1752.818	1752.8180	R	V	455	470
PSM	KIHPQTIIAGWR	586	sp|P78371-2|TCPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=5884	39.689	2	1418.8147	1418.8147	K	E	73	85
PSM	KISSIQSIVPALEIANAHR	587	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9084	60.953	3	2046.1586	2046.1586	K	K	250	269
PSM	LEGHGDPLHLEEVKR	588	sp|P08034|CXB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	14-UNIMOD:188,15-UNIMOD:267	ms_run[2]:scan=4518	30.905	2	1743.9239	1739.9357	R	H	108	123
PSM	LGGHGPSFPLKGITEQQK	589	sp|P13010|XRCC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=5775	38.984	2	1893.0108	1893.0108	R	E	185	203
PSM	LKDAVAHCHEAER	590	sp|Q99666-2|RGPD5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	2-UNIMOD:188,8-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=750	7.2847	2	1550.7595	1546.7713	R	N	181	194
PSM	LLHHVTEEKGNPEIDNK	591	sp|Q5TBB1-2|RNH2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=2274	16.693	3	1972.0014	1972.0014	K	K	137	154
PSM	LQCPQVDLFYLHAPDHGTPVEETLHACQR	592	sp|O43488|ARK72_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	3-UNIMOD:4,27-UNIMOD:4	ms_run[2]:scan=8994	60.342	3	3430.6187	3430.6187	R	L	130	159
PSM	LRAPIICVLGHVDTGK	593	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	7-UNIMOD:4	ms_run[2]:scan=7796	52.223	3	1747.9767	1747.9767	K	T	629	645
PSM	LTVNEAVKEGVVGPELHHK	594	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	8-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=5705	38.536	3	2067.1515	2067.1515	R	L	2716	2735
PSM	LTVNEAVKEGVVGPELHHK	595	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=5694	38.462	2	2055.1113	2055.1113	R	L	2716	2735
PSM	LTVNEAVKEGVVGPELHHK	596	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=5719	38.627	3	2055.1113	2055.1113	R	L	2716	2735
PSM	MIKPFFHSLSEK	597	sp|P10599|THIO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:35	ms_run[2]:scan=5529	37.349	3	1478.7592	1478.7592	K	Y	37	49
PSM	NHICNFFDFDTFGGHIK	598	sp|Q8WUJ3-2|CEMIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	4-UNIMOD:4	ms_run[2]:scan=9986	67.325	3	2067.9261	2067.9261	R	F	513	530
PSM	NRHPNFLVVEK	599	sp|Q16864|VATF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=4116	28.362	2	1351.7361	1351.7361	K	D	31	42
PSM	QKLHTDDELNWLDHGR	600	sp|Q9Y490|TLN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6128	41.265	3	1975.95	1975.9500	K	T	163	179
PSM	RAQLADSFHLQQFFR	601	sp|Q13813-3|SPTN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9508	63.859	2	1862.954	1862.9540	R	D	566	581
PSM	RCEAFGWHAIIVDGHSVEELCK	602	sp|P29401|TKT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:267,2-UNIMOD:4,21-UNIMOD:4,22-UNIMOD:188	ms_run[2]:scan=8197	54.913	3	2628.2548	2624.2667	K	A	205	227
PSM	RDHFEEAMR	603	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:267,9-UNIMOD:267	ms_run[2]:scan=2095	15.554	2	1209.5464	1209.5464	R	F	733	742
PSM	RDHFEEAMR	604	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=2096	15.559	2	1189.5298	1189.5298	R	F	733	742
PSM	RFQTIPLYYIEDHNGR	605	sp|Q14692|BMS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=8216	55.034	3	2041.0284	2041.0284	R	Q	950	966
PSM	RGHDDLGDHYLDCGDLSNALK	606	sp|Q13098-5|CSN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:267,13-UNIMOD:4,21-UNIMOD:188	ms_run[2]:scan=6730	45.157	3	2386.0943	2382.1061	R	C	159	180
PSM	RGSNTTSHLHQAVAK	607	sp|P22695|QCR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:267,15-UNIMOD:188	ms_run[2]:scan=754	7.3104	3	1621.8619	1617.8738	K	A	301	316
PSM	RHVFGESDELIGQK	608	sp|P60174-4|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:267,14-UNIMOD:188	ms_run[2]:scan=4623	31.599	3	1629.8446	1625.8564	R	V	18	32
PSM	RIEQHYFEDR	609	sp|O75431-2|MTX2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=3168	22.367	3	1391.6582	1391.6582	R	G	238	248
PSM	RQFHLTDDDLLR	610	sp|Q04446|GLGB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6313	42.456	3	1527.7794	1527.7794	R	Y	565	577
PSM	RSYDVPPPPMEPDHPFYSNISK	611	sp|Q8N0Y7|PGAM4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6872	46.057	3	2572.2057	2572.2057	R	D	117	139
PSM	SFFHQHYLGGQEPTPSNIR	612	sp|P46379-4|BAG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	19-UNIMOD:267	ms_run[2]:scan=5996	40.416	3	2224.0689	2224.0689	R	M	655	674
PSM	SHSPAKPVLIFVSSR	613	sp|Q8N3C0|ASCC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6097	41.065	3	1623.9097	1623.9097	R	R	1551	1566
PSM	SLAPSIHGHDYVKK	614	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	13-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=2801	20.015	2	1562.8608	1562.8608	K	A	302	316
PSM	SPLLQLPHIEEDNLRR	615	sp|Q9UGP8|SEC63_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	15-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=8107	54.305	2	1949.0597	1949.0597	K	V	382	398
PSM	SSALQWLTPEQTSGKEHPYLFSQCQAIHCR	616	sp|P09960-3|LKHA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	24-UNIMOD:4,29-UNIMOD:4	ms_run[2]:scan=8821	59.133	4	3558.6773	3558.6773	K	A	89	119
PSM	TGHYTLIHDHSK	617	sp|Q8N543-2|OGFD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=1506	11.812	2	1407.6895	1407.6895	K	A	304	316
PSM	THASPADLCHYHSQESDGLVCLLK	618	sp|P43405-2|KSYK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:4,21-UNIMOD:4,24-UNIMOD:188	ms_run[2]:scan=7246	48.562	3	2743.279	2743.2790	R	K	81	105
PSM	THINIVVIGHVDSGK	619	sp|P68104-2|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	15-UNIMOD:188	ms_run[2]:scan=5647	38.107	3	1593.8934	1593.8934	K	S	6	21
PSM	VFEHHGQVR	620	sp|Q6P1K8|T2H2L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=901	8.1579	2	1107.5574	1107.5574	R	L	46	55
PSM	VREAFQPQEPDFPPPPPDLEQLR	621	sp|P18206-2|VINC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9557	64.201	3	2701.35	2701.3500	K	L	831	854
PSM	QLPHFTSEHIKR	622	sp|O75643|U520_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28	ms_run[1]:scan=5214	35.37916333333334	3	1474.7721	1474.7676	K	C	1962	1974
PSM	QLPHFTSEHIKR	623	sp|O75643|U520_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28,11-UNIMOD:188,12-UNIMOD:267	ms_run[1]:scan=5216	35.39098333333333	2	1490.7982	1490.7960	K	C	1962	1974
PSM	HGLLVPNNTTDQELQHIR	624	sp|P56537|IF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	18-UNIMOD:267	ms_run[1]:scan=6145	41.37652	3	2095.095862	2094.084569	R	N	68	86
PSM	KLASQGDSISSQLGPIHPPPR	625	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	21-UNIMOD:267	ms_run[1]:scan=5717	38.615116666666665	3	2196.179790	2194.173384	K	T	122	143
PSM	HYNGEAYEDDEHHPR	626	sp|P31689|DNJA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1722	13.176698333333334	3	1868.728323	1867.751003	R	G	375	390
PSM	QGTHITVVSHSRPVGHCLEAAAVLSK	627	sp|P11177|ODPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28,17-UNIMOD:4	ms_run[1]:scan=5856	39.514070000000004	4	2736.4131	2736.4124	R	E	233	259
PSM	HKVNEHEQDGNELQTTPEFR	628	sp|Q96C57|CSTOS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=3642	25.37429	3	2407.103105	2407.115265	R	A	64	84
PSM	DLLHNEDRHDDYFQER	629	sp|Q8N684|CPSF7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=5415	36.63366666666667	3	2100.926835	2100.924945	R	N	440	456
PSM	ALSQRDPPHNNFFFFDGMK	630	sp|Q9UBE0|SAE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:267,19-UNIMOD:188	ms_run[1]:scan=9356	62.809821666666664	2	2283.078912	2283.086605	K	G	317	336
PSM	ADKPHQDCHFTIR	631	sp|Q99797|MIPEP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	3-UNIMOD:188,8-UNIMOD:4,13-UNIMOD:267	ms_run[1]:scan=2393	17.440855	2	1641.7732	1639.7852	R	G	441	454
PSM	RDTFNHLTTWLEDAR	632	sp|P61019|RAB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=8809	59.05055333333333	2	1874.913643	1873.907110	R	Q	91	106
PSM	PSTPARAPATSAPMMYSR	633	sp|P0C7V0|CF217_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	18-UNIMOD:267	ms_run[1]:scan=7565	50.683638333333334	3	1900.913883	1900.916307	R	R	61	79
PSM	GFGFVSFERHEDAQK	634	sp|P11940|PABP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=6496	43.63755	2	1753.827352	1752.821983	K	A	232	247