MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000208 -- new
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220618\20220618002634800212^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\111222_HL20.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220618\20220618002634800212^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\111222_HL20.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Acetyl (Protein N-term),Label:13C(6) (K),Label:13C(6)15N(4) (R),Oxidation (M)
MTD	software[1]-setting	maxMissedCleavages=1
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=40
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Label:13C(6) (K),Label:13C(6)15N(4) (R),Acetyl (Protein N-term)
MTD	software[2]-setting	TOL(-)=20
MTD	software[2]-setting	TOL(+)=20
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=1000
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=1
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Acetyl (Protein N-term),Label:13C(6) (K),Label:13C(6)15N(4) (R),Oxidation (M)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=1
MTD	software[3]-setting	peptide_mass_tolerance=20
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:1, Acetyl,]
MTD	variable_mod[1]-site	N-term
MTD	variable_mod[1]-position	Protein N-term
MTD	variable_mod[2]	[UNIMOD, UNIMOD:188, Label:13C(6),]
MTD	variable_mod[2]-site	K
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:267, Label:13C(6)15N(4),]
MTD	variable_mod[3]-site	R
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[4]-site	M
MTD	variable_mod[4]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P14618|KPYM_HUMAN	Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null	422-UNIMOD:188,89-UNIMOD:188	0.08	48.0	7	2	0
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null	121-UNIMOD:267,387-UNIMOD:188,389-UNIMOD:188	0.08	48.0	4	2	1
PRT	sp|Q9UN37|VPS4A_HUMAN	Vacuolar protein sorting-associated protein 4A OS=Homo sapiens OX=9606 GN=VPS4A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null		0.05	47.0	1	1	1
PRT	sp|A8MXV4|NUD19_HUMAN	Nucleoside diphosphate-linked moiety X motif 19 OS=Homo sapiens OX=9606 GN=NUDT19 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	72-UNIMOD:267	0.06	46.0	1	1	1
PRT	sp|O75367|H2AY_HUMAN	Core histone macro-H2A.1 OS=Homo sapiens OX=9606 GN=MACROH2A1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	189-UNIMOD:188	0.06	45.0	2	1	0
PRT	sp|Q12769|NU160_HUMAN	Nuclear pore complex protein Nup160 OS=Homo sapiens OX=9606 GN=NUP160 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	1029-UNIMOD:267	0.02	45.0	4	1	0
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	43.0	null	2242-UNIMOD:267,2263-UNIMOD:267,1523-UNIMOD:188,1538-UNIMOD:267,1240-UNIMOD:35	0.03	43.0	8	3	1
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	314-UNIMOD:188	0.05	43.0	4	3	2
PRT	sp|O95571|ETHE1_HUMAN	Persulfide dioxygenase ETHE1, mitochondrial OS=Homo sapiens OX=9606 GN=ETHE1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	80-UNIMOD:4,92-UNIMOD:267	0.09	43.0	2	1	0
PRT	sp|O43707|ACTN4_HUMAN	Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	779-UNIMOD:188,791-UNIMOD:188,455-UNIMOD:188,469-UNIMOD:267	0.06	42.0	7	3	1
PRT	sp|O94913|PCF11_HUMAN	Pre-mRNA cleavage complex 2 protein Pcf11 OS=Homo sapiens OX=9606 GN=PCF11 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	1184-UNIMOD:267	0.02	42.0	2	1	0
PRT	sp|Q15075|EEA1_HUMAN	Early endosome antigen 1 OS=Homo sapiens OX=9606 GN=EEA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.02	42.0	1	1	1
PRT	sp|Q06830|PRDX1_HUMAN	Peroxiredoxin-1 OS=Homo sapiens OX=9606 GN=PRDX1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	71-UNIMOD:4,83-UNIMOD:4,68-UNIMOD:188,92-UNIMOD:188	0.13	42.0	2	1	0
PRT	sp|P12268|IMDH2_HUMAN	Inosine-5'-monophosphate dehydrogenase 2 OS=Homo sapiens OX=9606 GN=IMPDH2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.04	42.0	2	1	0
PRT	sp|O15143|ARC1B_HUMAN	Actin-related protein 2/3 complex subunit 1B OS=Homo sapiens OX=9606 GN=ARPC1B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.06	42.0	2	1	0
PRT	sp|Q8IYS1|P20D2_HUMAN	Peptidase M20 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=PM20D2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	60-UNIMOD:267	0.04	41.0	1	1	1
PRT	sp|P11216|PYGB_HUMAN	Glycogen phosphorylase, brain form OS=Homo sapiens OX=9606 GN=PYGB PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	425-UNIMOD:267	0.02	41.0	3	1	0
PRT	sp|P62826|RAN_HUMAN	GTP-binding nuclear protein Ran OS=Homo sapiens OX=9606 GN=RAN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.09	41.0	2	1	0
PRT	sp|Q8NC51-4|PAIRB_HUMAN	Isoform 4 of Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	319-UNIMOD:35	0.05	41.0	3	1	0
PRT	sp|Q32P51|RA1L2_HUMAN	Heterogeneous nuclear ribonucleoprotein A1-like 2 OS=Homo sapiens OX=9606 GN=HNRNPA1L2 PE=2 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null	113-UNIMOD:188,122-UNIMOD:267	0.05	41.0	4	1	0
PRT	sp|P05783|K1C18_HUMAN	Keratin, type I cytoskeletal 18 OS=Homo sapiens OX=9606 GN=KRT18 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	41.0	null	407-UNIMOD:188,402-UNIMOD:35,370-UNIMOD:188	0.09	41.0	5	2	1
PRT	sp|P61981|1433G_HUMAN	14-3-3 protein gamma OS=Homo sapiens OX=9606 GN=YWHAG PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	42-UNIMOD:267,162-UNIMOD:188,172-UNIMOD:267	0.15	40.0	5	2	1
PRT	sp|P46926|GNPI1_HUMAN	Glucosamine-6-phosphate isomerase 1 OS=Homo sapiens OX=9606 GN=GNPDA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	118-UNIMOD:4,124-UNIMOD:188,126-UNIMOD:188	0.11	40.0	3	1	0
PRT	sp|P15170-2|ERF3A_HUMAN	Isoform 2 of Eukaryotic peptide chain release factor GTP-binding subunit ERF3A OS=Homo sapiens OX=9606 GN=GSPT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	209-UNIMOD:188,224-UNIMOD:188	0.05	40.0	4	2	0
PRT	sp|Q15366-4|PCBP2_HUMAN	Isoform 4 of Poly(rC)-binding protein 2 OS=Homo sapiens OX=9606 GN=PCBP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.10	40.0	1	1	1
PRT	sp|P11413|G6PD_HUMAN	Glucose-6-phosphate 1-dehydrogenase OS=Homo sapiens OX=9606 GN=G6PD PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	385-UNIMOD:4	0.03	40.0	2	1	0
PRT	sp|Q96FX7|TRM61_HUMAN	tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRMT61A OS=Homo sapiens OX=9606 GN=TRMT61A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	140-UNIMOD:267	0.06	40.0	2	1	0
PRT	sp|P19784|CSK22_HUMAN	Casein kinase II subunit alpha' OS=Homo sapiens OX=9606 GN=CSNK2A2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	279-UNIMOD:267	0.05	40.0	2	1	0
PRT	sp|P04181|OAT_HUMAN	Ornithine aminotransferase, mitochondrial OS=Homo sapiens OX=9606 GN=OAT PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	93-UNIMOD:4	0.09	39.0	2	2	2
PRT	sp|P27708|PYR1_HUMAN	CAD protein OS=Homo sapiens OX=9606 GN=CAD PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	1636-UNIMOD:4,1652-UNIMOD:267	0.01	39.0	3	1	0
PRT	sp|Q9BX66-7|SRBS1_HUMAN	Isoform 7 of Sorbin and SH3 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SORBS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	605-UNIMOD:267	0.03	39.0	1	1	1
PRT	sp|P22695|QCR2_HUMAN	Cytochrome b-c1 complex subunit 2, mitochondrial OS=Homo sapiens OX=9606 GN=UQCRC2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.05	39.0	3	1	0
PRT	sp|P49773|HINT1_HUMAN	Histidine triad nucleotide-binding protein 1 OS=Homo sapiens OX=9606 GN=HINT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	119-UNIMOD:267,96-UNIMOD:35,38-UNIMOD:4,57-UNIMOD:188	0.37	39.0	11	2	0
PRT	sp|P22314-2|UBA1_HUMAN	Isoform 2 of Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	328-UNIMOD:267,194-UNIMOD:4,199-UNIMOD:267	0.03	39.0	3	2	1
PRT	sp|P50238|CRIP1_HUMAN	Cysteine-rich protein 1 OS=Homo sapiens OX=9606 GN=CRIP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	49-UNIMOD:188,52-UNIMOD:4,56-UNIMOD:4,64-UNIMOD:188	0.38	39.0	2	1	0
PRT	sp|P09874|PARP1_HUMAN	Poly [ADP-ribose] polymerase 1 OS=Homo sapiens OX=9606 GN=PARP1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	65-UNIMOD:267,78-UNIMOD:267	0.04	39.0	4	2	1
PRT	sp|P62266|RS23_HUMAN	40S ribosomal protein S23 OS=Homo sapiens OX=9606 GN=RPS23 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.14	38.0	1	1	1
PRT	sp|P49411|EFTU_HUMAN	Elongation factor Tu, mitochondrial OS=Homo sapiens OX=9606 GN=TUFM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	55-UNIMOD:188,70-UNIMOD:188	0.04	38.0	3	1	0
PRT	sp|Q8IVT2|MISP_HUMAN	Mitotic interactor and substrate of PLK1 OS=Homo sapiens OX=9606 GN=MISP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	512-UNIMOD:267,537-UNIMOD:267	0.04	38.0	1	1	1
PRT	sp|P21333-2|FLNA_HUMAN	Isoform 2 of Filamin-A OS=Homo sapiens OX=9606 GN=FLNA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	1515-UNIMOD:267	0.01	38.0	1	1	1
PRT	sp|Q7Z6Z7-2|HUWE1_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens OX=9606 GN=HUWE1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	3317-UNIMOD:4,3318-UNIMOD:267	0.01	38.0	3	2	1
PRT	sp|O14776-2|TCRG1_HUMAN	Isoform 2 of Transcription elongation regulator 1 OS=Homo sapiens OX=9606 GN=TCERG1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.02	38.0	1	1	1
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	306-UNIMOD:188,639-UNIMOD:267	0.05	38.0	5	3	1
PRT	sp|Q13509-2|TBB3_HUMAN	Isoform 2 of Tubulin beta-3 chain OS=Homo sapiens OX=9606 GN=TUBB3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.07	38.0	2	1	0
PRT	sp|P55072|TERA_HUMAN	Transitional endoplasmic reticulum ATPase OS=Homo sapiens OX=9606 GN=VCP PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	2-UNIMOD:1	0.04	37.0	2	2	2
PRT	sp|Q00688|FKBP3_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP3 OS=Homo sapiens OX=9606 GN=FKBP3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null	42-UNIMOD:188,48-UNIMOD:188	0.10	37.0	3	1	0
PRT	sp|P12694|ODBA_HUMAN	2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=BCKDHA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	445-UNIMOD:188	0.04	37.0	2	1	0
PRT	sp|P22626-2|ROA2_HUMAN	Isoform A2 of Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.09	37.0	3	2	1
PRT	sp|Q12905|ILF2_HUMAN	Interleukin enhancer-binding factor 2 OS=Homo sapiens OX=9606 GN=ILF2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	80-UNIMOD:188	0.05	37.0	2	1	0
PRT	sp|O60313-13|OPA1_HUMAN	Isoform 7 of Dynamin-like 120 kDa protein, mitochondrial OS=Homo sapiens OX=9606 GN=OPA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	292-UNIMOD:188,306-UNIMOD:188	0.02	37.0	2	1	0
PRT	sp|P68104-2|EF1A1_HUMAN	Isoform 2 of Elongation factor 1-alpha 1 OS=Homo sapiens OX=9606 GN=EEF1A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	20-UNIMOD:188,30-UNIMOD:188	0.06	37.0	8	2	0
PRT	sp|P84090|ERH_HUMAN	Enhancer of rudimentary homolog OS=Homo sapiens OX=9606 GN=ERH PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	28-UNIMOD:4,33-UNIMOD:4,34-UNIMOD:188	0.17	37.0	1	1	1
PRT	sp|P34897-3|GLYM_HUMAN	Isoform 3 of Serine hydroxymethyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=SHMT2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	248-UNIMOD:188,259-UNIMOD:188	0.09	37.0	2	2	1
PRT	sp|Q9UGV2|NDRG3_HUMAN	Protein NDRG3 OS=Homo sapiens OX=9606 GN=NDRG3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	54-UNIMOD:267,68-UNIMOD:188	0.05	37.0	2	1	0
PRT	sp|P38646|GRP75_HUMAN	Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	284-UNIMOD:267	0.03	37.0	2	1	0
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	215-UNIMOD:188,217-UNIMOD:4,238-UNIMOD:188,61-UNIMOD:188	0.13	36.0	3	3	3
PRT	sp|Q8NFW8-2|NEUA_HUMAN	Isoform 2 of N-acylneuraminate cytidylyltransferase OS=Homo sapiens OX=9606 GN=CMAS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.06	36.0	2	1	0
PRT	sp|Q13616|CUL1_HUMAN	Cullin-1 OS=Homo sapiens OX=9606 GN=CUL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.03	36.0	1	1	1
PRT	sp|Q96EU6-2|RRP36_HUMAN	Isoform 2 of Ribosomal RNA processing protein 36 homolog OS=Homo sapiens OX=9606 GN=RRP36	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.07	36.0	1	1	1
PRT	sp|O75369-5|FLNB_HUMAN	Isoform 5 of Filamin-B OS=Homo sapiens OX=9606 GN=FLNB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	1956-UNIMOD:267,1969-UNIMOD:267	0.01	36.0	2	1	0
PRT	sp|P54577|SYYC_HUMAN	Tyrosine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=YARS1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.03	36.0	1	1	1
PRT	sp|P46379-4|BAG6_HUMAN	Isoform 4 of Large proline-rich protein BAG6 OS=Homo sapiens OX=9606 GN=BAG6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	673-UNIMOD:267	0.02	36.0	2	1	0
PRT	sp|P12644|BMP4_HUMAN	Bone morphogenetic protein 4 OS=Homo sapiens OX=9606 GN=BMP4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	139-UNIMOD:267	0.05	36.0	1	1	1
PRT	sp|Q15046|SYK_HUMAN	Lysine--tRNA ligase OS=Homo sapiens OX=9606 GN=KARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	2-UNIMOD:1	0.03	35.0	1	1	1
PRT	sp|Q9NZN3-2|EHD3_HUMAN	Isoform 2 of EH domain-containing protein 3 OS=Homo sapiens OX=9606 GN=EHD3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	58-UNIMOD:188,71-UNIMOD:188	0.18	35.0	2	1	0
PRT	sp|Q09666|AHNK_HUMAN	Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	730-UNIMOD:188,748-UNIMOD:188	0.02	35.0	1	1	1
PRT	sp|P60842-2|IF4A1_HUMAN	Isoform 2 of Eukaryotic initiation factor 4A-I OS=Homo sapiens OX=9606 GN=EIF4A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	82-UNIMOD:188	0.04	35.0	2	1	0
PRT	sp|P61586|RHOA_HUMAN	Transforming protein RhoA OS=Homo sapiens OX=9606 GN=RHOA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	107-UNIMOD:4,118-UNIMOD:188,119-UNIMOD:188	0.08	35.0	3	1	0
PRT	sp|O15027-2|SC16A_HUMAN	Isoform 2 of Protein transport protein Sec16A OS=Homo sapiens OX=9606 GN=SEC16A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	504-UNIMOD:4,528-UNIMOD:267	0.01	35.0	2	1	0
PRT	sp|Q9H2U1-3|DHX36_HUMAN	Isoform 3 of ATP-dependent DNA/RNA helicase DHX36 OS=Homo sapiens OX=9606 GN=DHX36	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	3	1	0
PRT	sp|Q99538-3|LGMN_HUMAN	Isoform 3 of Legumain OS=Homo sapiens OX=9606 GN=LGMN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	50-UNIMOD:4	0.04	35.0	1	1	1
PRT	sp|O15391|TYY2_HUMAN	Transcription factor YY2 OS=Homo sapiens OX=9606 GN=YY2 PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	313-UNIMOD:4,318-UNIMOD:4,309-UNIMOD:188,320-UNIMOD:188	0.06	35.0	2	1	0
PRT	sp|O60271-5|JIP4_HUMAN	Isoform 5 of C-Jun-amino-terminal kinase-interacting protein 4 OS=Homo sapiens OX=9606 GN=SPAG9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	176-UNIMOD:267	0.02	35.0	1	1	1
PRT	sp|P02545-2|LMNA_HUMAN	Isoform C of Prelamin-A/C OS=Homo sapiens OX=9606 GN=LMNA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	571-UNIMOD:267	0.05	35.0	4	1	0
PRT	sp|P30405|PPIF_HUMAN	Peptidyl-prolyl cis-trans isomerase F, mitochondrial OS=Homo sapiens OX=9606 GN=PPIF PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	167-UNIMOD:188,175-UNIMOD:188	0.08	35.0	2	1	0
PRT	sp|P43034|LIS1_HUMAN	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens OX=9606 GN=PAFAH1B1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	390-UNIMOD:188	0.04	35.0	1	1	1
PRT	sp|P34897|GLYM_HUMAN	Serine hydroxymethyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=SHMT2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null		0.04	35.0	1	1	0
PRT	sp|Q96QV6|H2A1A_HUMAN	Histone H2A type 1-A OS=Homo sapiens OX=9606 GN=HIST1H2AA PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null		0.11	35.0	1	1	1
PRT	sp|P61326-2|MGN_HUMAN	Isoform 2 of Protein mago nashi homolog OS=Homo sapiens OX=9606 GN=MAGOH	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.15	34.0	2	1	0
PRT	sp|P11387|TOP1_HUMAN	DNA topoisomerase 1 OS=Homo sapiens OX=9606 GN=TOP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	223-UNIMOD:188,239-UNIMOD:188	0.03	34.0	1	1	1
PRT	sp|P58546|MTPN_HUMAN	Myotrophin OS=Homo sapiens OX=9606 GN=MTPN PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	83-UNIMOD:4	0.25	34.0	2	1	0
PRT	sp|Q96T51-2|RUFY1_HUMAN	Isoform 2 of RUN and FYVE domain-containing protein 1 OS=Homo sapiens OX=9606 GN=RUFY1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	540-UNIMOD:4	0.03	34.0	1	1	1
PRT	sp|P63104|1433Z_HUMAN	14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	41-UNIMOD:267	0.14	34.0	3	2	1
PRT	sp|Q8WVV9-5|HNRLL_HUMAN	Isoform 5 of Heterogeneous nuclear ribonucleoprotein L-like OS=Homo sapiens OX=9606 GN=HNRNPLL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	269-UNIMOD:267	0.03	34.0	2	1	0
PRT	sp|Q9UPN3-3|MACF1_HUMAN	Isoform 3 of Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	3374-UNIMOD:188,3392-UNIMOD:188	0.00	34.0	2	1	0
PRT	sp|P61764|STXB1_HUMAN	Syntaxin-binding protein 1 OS=Homo sapiens OX=9606 GN=STXBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	1	1	1
PRT	sp|P36542|ATPG_HUMAN	ATP synthase subunit gamma, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1C PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	103-UNIMOD:4	0.08	34.0	1	1	1
PRT	sp|Q96HV5|TM41A_HUMAN	Transmembrane protein 41A OS=Homo sapiens OX=9606 GN=TMEM41A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	261-UNIMOD:267	0.06	34.0	3	1	0
PRT	sp|P46783|RS10_HUMAN	40S ribosomal protein S10 OS=Homo sapiens OX=9606 GN=RPS10 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	38-UNIMOD:188,47-UNIMOD:188	0.14	34.0	4	2	1
PRT	sp|Q96CB9-3|NSUN4_HUMAN	Isoform 3 of 5-methylcytosine rRNA methyltransferase NSUN4 OS=Homo sapiens OX=9606 GN=NSUN4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.08	34.0	1	1	1
PRT	sp|P06744|G6PI_HUMAN	Glucose-6-phosphate isomerase OS=Homo sapiens OX=9606 GN=GPI PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null	401-UNIMOD:35,404-UNIMOD:4,400-UNIMOD:188	0.09	34.0	3	2	1
PRT	sp|Q16822-3|PCKGM_HUMAN	Isoform 3 of Phosphoenolpyruvate carboxykinase [GTP], mitochondrial OS=Homo sapiens OX=9606 GN=PCK2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.04	34.0	1	1	1
PRT	sp|P22059|OSBP1_HUMAN	Oxysterol-binding protein 1 OS=Homo sapiens OX=9606 GN=OSBP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	517-UNIMOD:4,534-UNIMOD:188	0.03	34.0	2	1	0
PRT	sp|P56270-4|MAZ_HUMAN	Isoform 4 of Myc-associated zinc finger protein OS=Homo sapiens OX=9606 GN=MAZ	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	116-UNIMOD:4,119-UNIMOD:4,121-UNIMOD:188	0.09	34.0	2	1	0
PRT	sp|P61081|UBC12_HUMAN	NEDD8-conjugating enzyme Ubc12 OS=Homo sapiens OX=9606 GN=UBE2M PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	47-UNIMOD:4,61-UNIMOD:188	0.09	34.0	1	1	1
PRT	sp|Q13885|TBB2A_HUMAN	Tubulin beta-2A chain OS=Homo sapiens OX=9606 GN=TUBB2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	1-UNIMOD:35,2-UNIMOD:267,12-UNIMOD:4,19-UNIMOD:188	0.04	34.0	4	1	0
PRT	sp|P41250|GARS_HUMAN	Glycine--tRNA ligase OS=Homo sapiens OX=9606 GN=GARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	442-UNIMOD:4,444-UNIMOD:4	0.03	33.0	2	1	0
PRT	sp|P53396|ACLY_HUMAN	ATP-citrate synthase OS=Homo sapiens OX=9606 GN=ACLY PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	546-UNIMOD:188,554-UNIMOD:188	0.01	33.0	2	1	0
PRT	sp|Q15654|TRIP6_HUMAN	Thyroid receptor-interacting protein 6 OS=Homo sapiens OX=9606 GN=TRIP6 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	43-UNIMOD:267	0.04	33.0	1	1	1
PRT	sp|Q01518-2|CAP1_HUMAN	Isoform 2 of Adenylyl cyclase-associated protein 1 OS=Homo sapiens OX=9606 GN=CAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	1	1	1
PRT	sp|P06733-2|ENOA_HUMAN	Isoform MBP-1 of Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	69-UNIMOD:188	0.09	33.0	2	1	0
PRT	sp|Q15185-3|TEBP_HUMAN	Isoform 3 of Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	58-UNIMOD:4,65-UNIMOD:188	0.14	33.0	2	1	0
PRT	sp|Q00839-2|HNRPU_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	1	1	1
PRT	sp|P12814-2|ACTN1_HUMAN	Isoform 2 of Alpha-actinin-1 OS=Homo sapiens OX=9606 GN=ACTN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	3	1	0
PRT	sp|Q8WVV4-3|POF1B_HUMAN	Isoform 3 of Protein POF1B OS=Homo sapiens OX=9606 GN=POF1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	274-UNIMOD:4	0.05	33.0	1	1	1
PRT	sp|Q96DI7|SNR40_HUMAN	U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens OX=9606 GN=SNRNP40 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.08	33.0	1	1	1
PRT	sp|Q9NZB2-2|F120A_HUMAN	Isoform B of Constitutive coactivator of PPAR-gamma-like protein 1 OS=Homo sapiens OX=9606 GN=FAM120A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	557-UNIMOD:267	0.03	33.0	2	1	0
PRT	sp|O75569-3|PRKRA_HUMAN	Isoform 3 of Interferon-inducible double-stranded RNA-dependent protein kinase activator A OS=Homo sapiens OX=9606 GN=PRKRA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	116-UNIMOD:267	0.07	33.0	2	1	0
PRT	sp|Q8WUA4-2|TF3C2_HUMAN	Isoform 2 of General transcription factor 3C polypeptide 2 OS=Homo sapiens OX=9606 GN=GTF3C2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.05	33.0	1	1	1
PRT	sp|Q9BTV4|TMM43_HUMAN	Transmembrane protein 43 OS=Homo sapiens OX=9606 GN=TMEM43 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	299-UNIMOD:267	0.06	33.0	2	1	0
PRT	sp|Q15029-2|U5S1_HUMAN	Isoform 2 of 116 kDa U5 small nuclear ribonucleoprotein component OS=Homo sapiens OX=9606 GN=EFTUD2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	2	1	0
PRT	sp|Q9NR30-2|DDX21_HUMAN	Isoform 2 of Nucleolar RNA helicase 2 OS=Homo sapiens OX=9606 GN=DDX21	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	2	1	0
PRT	sp|Q12788|TBL3_HUMAN	Transducin beta-like protein 3 OS=Homo sapiens OX=9606 GN=TBL3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	613-UNIMOD:4	0.02	33.0	1	1	1
PRT	sp|P17844|DDX5_HUMAN	Probable ATP-dependent RNA helicase DDX5 OS=Homo sapiens OX=9606 GN=DDX5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	164-UNIMOD:267	0.03	33.0	2	1	0
PRT	sp|P16422|EPCAM_HUMAN	Epithelial cell adhesion molecule OS=Homo sapiens OX=9606 GN=EPCAM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	218-UNIMOD:188	0.05	33.0	2	1	0
PRT	sp|Q13263-2|TIF1B_HUMAN	Isoform 2 of Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	127-UNIMOD:4,139-UNIMOD:4,142-UNIMOD:4,147-UNIMOD:4	0.03	33.0	1	1	1
PRT	sp|Q96PK6-3|RBM14_HUMAN	Isoform 3 of RNA-binding protein 14 OS=Homo sapiens OX=9606 GN=RBM14	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	61-UNIMOD:267,64-UNIMOD:267	0.13	32.0	1	1	1
PRT	sp|P30153|2AAA_HUMAN	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Homo sapiens OX=9606 GN=PPP2R1A PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	133-UNIMOD:188	0.04	32.0	4	1	0
PRT	sp|P28482-2|MK01_HUMAN	Isoform 2 of Mitogen-activated protein kinase 1 OS=Homo sapiens OX=9606 GN=MAPK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.05	32.0	1	1	1
PRT	sp|P00558-2|PGK1_HUMAN	Isoform 2 of Phosphoglycerate kinase 1 OS=Homo sapiens OX=9606 GN=PGK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	339-UNIMOD:4,351-UNIMOD:4,352-UNIMOD:4,354-UNIMOD:188	0.05	32.0	1	1	1
PRT	sp|Q9BV20|MTNA_HUMAN	Methylthioribose-1-phosphate isomerase OS=Homo sapiens OX=9606 GN=MRI1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	285-UNIMOD:4,288-UNIMOD:267	0.05	32.0	2	1	0
PRT	sp|O75643|U520_HUMAN	U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens OX=9606 GN=SNRNP200 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.01	32.0	2	1	0
PRT	sp|P68400-2|CSK21_HUMAN	Isoform 2 of Casein kinase II subunit alpha OS=Homo sapiens OX=9606 GN=CSNK2A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.07	32.0	1	1	1
PRT	sp|Q92945|FUBP2_HUMAN	Far upstream element-binding protein 2 OS=Homo sapiens OX=9606 GN=KHSRP PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|Q99447-4|PCY2_HUMAN	Isoform 4 of Ethanolamine-phosphate cytidylyltransferase OS=Homo sapiens OX=9606 GN=PCYT2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.06	32.0	1	1	1
PRT	sp|P02786|TFR1_HUMAN	Transferrin receptor protein 1 OS=Homo sapiens OX=9606 GN=TFRC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	53-UNIMOD:188	0.02	32.0	2	1	0
PRT	sp|O43684-2|BUB3_HUMAN	Isoform 2 of Mitotic checkpoint protein BUB3 OS=Homo sapiens OX=9606 GN=BUB3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	52-UNIMOD:188,62-UNIMOD:4,80-UNIMOD:188	0.10	32.0	2	1	0
PRT	sp|Q9UNE7-2|CHIP_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase CHIP OS=Homo sapiens OX=9606 GN=STUB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	82-UNIMOD:267,95-UNIMOD:267	0.06	32.0	1	1	1
PRT	sp|Q9Y2B0|CNPY2_HUMAN	Protein canopy homolog 2 OS=Homo sapiens OX=9606 GN=CNPY2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	167-UNIMOD:267,171-UNIMOD:4	0.09	32.0	2	1	0
PRT	sp|P22061|PIMT_HUMAN	Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Homo sapiens OX=9606 GN=PCMT1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.07	32.0	1	1	1
PRT	sp|Q9C0C9|UBE2O_HUMAN	(E3-independent) E2 ubiquitin-conjugating enzyme OS=Homo sapiens OX=9606 GN=UBE2O PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	585-UNIMOD:4	0.02	32.0	1	1	1
PRT	sp|P26641|EF1G_HUMAN	Elongation factor 1-gamma OS=Homo sapiens OX=9606 GN=EEF1G PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	45-UNIMOD:267	0.04	32.0	3	1	0
PRT	sp|P08727|K1C19_HUMAN	Keratin, type I cytoskeletal 19 OS=Homo sapiens OX=9606 GN=KRT19 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	330-UNIMOD:267	0.04	31.0	2	1	0
PRT	sp|Q96KP4-2|CNDP2_HUMAN	Isoform 2 of Cytosolic non-specific dipeptidase OS=Homo sapiens OX=9606 GN=CNDP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	217-UNIMOD:188,218-UNIMOD:188	0.04	31.0	2	1	0
PRT	sp|P62701|RS4X_HUMAN	40S ribosomal protein S4, X isoform OS=Homo sapiens OX=9606 GN=RPS4X PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.05	31.0	2	1	0
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	591-UNIMOD:4	0.02	31.0	1	1	1
PRT	sp|Q13418-2|ILK_HUMAN	Isoform 2 of Integrin-linked protein kinase OS=Homo sapiens OX=9606 GN=ILK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.04	31.0	2	1	0
PRT	sp|Q16864|VATF_HUMAN	V-type proton ATPase subunit F OS=Homo sapiens OX=9606 GN=ATP6V1F PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.24	31.0	1	1	1
PRT	sp|P62244|RS15A_HUMAN	40S ribosomal protein S15a OS=Homo sapiens OX=9606 GN=RPS15A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.14	31.0	1	1	1
PRT	sp|Q13765|NACA_HUMAN	Nascent polypeptide-associated complex subunit alpha OS=Homo sapiens OX=9606 GN=NACA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.07	31.0	1	1	1
PRT	sp|Q9Y2H1-2|ST38L_HUMAN	Isoform 2 of Serine/threonine-protein kinase 38-like OS=Homo sapiens OX=9606 GN=STK38L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.07	31.0	1	1	0
PRT	sp|Q13813-3|SPTN1_HUMAN	Isoform 3 of Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.01	31.0	2	2	2
PRT	sp|P20700|LMNB1_HUMAN	Lamin-B1 OS=Homo sapiens OX=9606 GN=LMNB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	250-UNIMOD:267,258-UNIMOD:267	0.03	31.0	2	1	0
PRT	sp|Q96QK1|VPS35_HUMAN	Vacuolar protein sorting-associated protein 35 OS=Homo sapiens OX=9606 GN=VPS35 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|Q9H9A5-5|CNO10_HUMAN	Isoform 5 of CCR4-NOT transcription complex subunit 10 OS=Homo sapiens OX=9606 GN=CNOT10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.04	31.0	1	1	1
PRT	sp|P55795|HNRH2_HUMAN	Heterogeneous nuclear ribonucleoprotein H2 OS=Homo sapiens OX=9606 GN=HNRNPH2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	167-UNIMOD:188	0.04	31.0	1	1	1
PRT	sp|Q07020-2|RL18_HUMAN	Isoform 2 of 60S ribosomal protein L18 OS=Homo sapiens OX=9606 GN=RPL18	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	62-UNIMOD:267	0.09	31.0	2	1	0
PRT	sp|P10155-3|RO60_HUMAN	Isoform 3 of 60 kDa SS-A/Ro ribonucleoprotein OS=Homo sapiens OX=9606 GN=RO60	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	239-UNIMOD:267,252-UNIMOD:267	0.03	31.0	2	1	0
PRT	sp|P05198|IF2A_HUMAN	Eukaryotic translation initiation factor 2 subunit 1 OS=Homo sapiens OX=9606 GN=EIF2S1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	288-UNIMOD:267	0.04	31.0	1	1	1
PRT	sp|Q9Y3F4|STRAP_HUMAN	Serine-threonine kinase receptor-associated protein OS=Homo sapiens OX=9606 GN=STRAP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	270-UNIMOD:4	0.07	31.0	1	1	1
PRT	sp|Q9NR30|DDX21_HUMAN	Nucleolar RNA helicase 2 OS=Homo sapiens OX=9606 GN=DDX21 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	224-UNIMOD:188,231-UNIMOD:267	0.02	31.0	2	1	0
PRT	sp|P33993|MCM7_HUMAN	DNA replication licensing factor MCM7 OS=Homo sapiens OX=9606 GN=MCM7 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	545-UNIMOD:267	0.02	31.0	1	1	0
PRT	sp|Q15424|SAFB1_HUMAN	Scaffold attachment factor B1 OS=Homo sapiens OX=9606 GN=SAFB PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	null	463-UNIMOD:385,463-UNIMOD:4	0.02	31.0	1	1	1
PRT	sp|Q13418|ILK_HUMAN	Integrin-linked protein kinase OS=Homo sapiens OX=9606 GN=ILK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	80-UNIMOD:267	0.04	31.0	1	1	0
PRT	sp|Q71U36|TBA1A_HUMAN	Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	96-UNIMOD:188,105-UNIMOD:267	0.05	31.0	1	1	1
PRT	sp|P47755-2|CAZA2_HUMAN	Isoform 2 of F-actin-capping protein subunit alpha-2 OS=Homo sapiens OX=9606 GN=CAPZA2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	2-UNIMOD:1	0.09	30.0	1	1	1
PRT	sp|P62424|RL7A_HUMAN	60S ribosomal protein L7a OS=Homo sapiens OX=9606 GN=RPL7A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	150-UNIMOD:188	0.05	30.0	2	1	0
PRT	sp|Q16891-3|MIC60_HUMAN	Isoform 3 of MICOS complex subunit MIC60 OS=Homo sapiens OX=9606 GN=IMMT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|P36578|RL4_HUMAN	60S ribosomal protein L4 OS=Homo sapiens OX=9606 GN=RPL4 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	33-UNIMOD:267,45-UNIMOD:267	0.04	30.0	1	1	1
PRT	sp|Q9HB71-2|CYBP_HUMAN	Isoform 2 of Calcyclin-binding protein OS=Homo sapiens OX=9606 GN=CACYBP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	2-UNIMOD:1	0.18	30.0	1	1	1
PRT	sp|P27348|1433T_HUMAN	14-3-3 protein theta OS=Homo sapiens OX=9606 GN=YWHAQ PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	41-UNIMOD:267	0.06	30.0	1	1	1
PRT	sp|Q14192-2|FHL2_HUMAN	Isoform 2 of Four and a half LIM domains protein 2 OS=Homo sapiens OX=9606 GN=FHL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	7-UNIMOD:4,10-UNIMOD:4,17-UNIMOD:188,18-UNIMOD:188	0.10	30.0	3	1	0
PRT	sp|P07355-2|ANXA2_HUMAN	Isoform 2 of Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	81-UNIMOD:267	0.04	30.0	1	1	1
PRT	sp|P04792|HSPB1_HUMAN	Heat shock protein beta-1 OS=Homo sapiens OX=9606 GN=HSPB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	127-UNIMOD:267,136-UNIMOD:267	0.07	30.0	2	1	0
PRT	sp|Q8N2K0-3|ABD12_HUMAN	Isoform 3 of Lysophosphatidylserine lipase ABHD12 OS=Homo sapiens OX=9606 GN=ABHD12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	285-UNIMOD:4,304-UNIMOD:267	0.07	30.0	1	1	1
PRT	sp|Q96EL2|RT24_HUMAN	28S ribosomal protein S24, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS24 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.13	30.0	1	1	1
PRT	sp|P33993-3|MCM7_HUMAN	Isoform 3 of DNA replication licensing factor MCM7 OS=Homo sapiens OX=9606 GN=MCM7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	369-UNIMOD:267	0.03	30.0	2	1	0
PRT	sp|P10599|THIO_HUMAN	Thioredoxin OS=Homo sapiens OX=9606 GN=TXN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	37-UNIMOD:35,39-UNIMOD:188,48-UNIMOD:188	0.12	30.0	3	1	0
PRT	sp|O75306-2|NDUS2_HUMAN	Isoform 2 of NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFS2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	96-UNIMOD:267	0.04	30.0	1	1	1
PRT	sp|O43169|CYB5B_HUMAN	Cytochrome b5 type B OS=Homo sapiens OX=9606 GN=CYB5B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	39-UNIMOD:188,48-UNIMOD:267	0.09	30.0	2	1	0
PRT	sp|P26368-2|U2AF2_HUMAN	Isoform 2 of Splicing factor U2AF 65 kDa subunit OS=Homo sapiens OX=9606 GN=U2AF2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	228-UNIMOD:267,260-UNIMOD:188	0.07	30.0	3	1	0
PRT	sp|P16401|H15_HUMAN	Histone H1.5 OS=Homo sapiens OX=9606 GN=H1-5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	2-UNIMOD:1,17-UNIMOD:188,21-UNIMOD:188	0.09	30.0	2	1	0
PRT	sp|P53618|COPB_HUMAN	Coatomer subunit beta OS=Homo sapiens OX=9606 GN=COPB1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	1	1	1
PRT	sp|P07108|ACBP_HUMAN	Acyl-CoA-binding protein OS=Homo sapiens OX=9606 GN=DBI PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	2-UNIMOD:1	0.16	30.0	1	1	1
PRT	sp|P49736|MCM2_HUMAN	DNA replication licensing factor MCM2 OS=Homo sapiens OX=9606 GN=MCM2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	216-UNIMOD:188	0.01	30.0	1	1	1
PRT	sp|P49023-4|PAXI_HUMAN	Isoform 4 of Paxillin OS=Homo sapiens OX=9606 GN=PXN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	217-UNIMOD:4,220-UNIMOD:4,227-UNIMOD:267	0.05	30.0	1	1	1
PRT	sp|Q14643-4|ITPR1_HUMAN	Isoform 4 of Inositol 1,4,5-trisphosphate receptor type 1 OS=Homo sapiens OX=9606 GN=ITPR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	1284-UNIMOD:4	0.01	30.0	1	1	1
PRT	sp|P51665|PSMD7_HUMAN	26S proteasome non-ATPase regulatory subunit 7 OS=Homo sapiens OX=9606 GN=PSMD7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	25-UNIMOD:267	0.06	30.0	2	1	0
PRT	sp|Q32MZ4|LRRF1_HUMAN	Leucine-rich repeat flightless-interacting protein 1 OS=Homo sapiens OX=9606 GN=LRRFIP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|P53985-2|MOT1_HUMAN	Isoform 2 of Monocarboxylate transporter 1 OS=Homo sapiens OX=9606 GN=SLC16A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.04	29.0	1	1	1
PRT	sp|P16144-4|ITB4_HUMAN	Isoform Beta-4D of Integrin beta-4 OS=Homo sapiens OX=9606 GN=ITGB4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	1	1	1
PRT	sp|Q9UHR4|BI2L1_HUMAN	Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 1 OS=Homo sapiens OX=9606 GN=BAIAP2L1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|Q9NVP1|DDX18_HUMAN	ATP-dependent RNA helicase DDX18 OS=Homo sapiens OX=9606 GN=DDX18 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	531-UNIMOD:267,539-UNIMOD:267	0.03	29.0	1	1	1
PRT	sp|P78527-2|PRKDC_HUMAN	Isoform 2 of DNA-dependent protein kinase catalytic subunit OS=Homo sapiens OX=9606 GN=PRKDC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.00	29.0	1	1	1
PRT	sp|P0DPB6|RPAC2_HUMAN	DNA-directed RNA polymerases I and III subunit RPAC2 OS=Homo sapiens OX=9606 GN=POLR1D PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	39-UNIMOD:4,56-UNIMOD:267	0.15	29.0	2	1	0
PRT	sp|P62745|RHOB_HUMAN	Rho-related GTP-binding protein RhoB OS=Homo sapiens OX=9606 GN=RHOB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	107-UNIMOD:4	0.08	29.0	1	1	1
PRT	sp|O00151|PDLI1_HUMAN	PDZ and LIM domain protein 1 OS=Homo sapiens OX=9606 GN=PDLIM1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	283-UNIMOD:4,286-UNIMOD:4,289-UNIMOD:4	0.05	29.0	1	1	1
PRT	sp|Q9Y2R5|RT17_HUMAN	28S ribosomal protein S17, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS17 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	78-UNIMOD:188,87-UNIMOD:188	0.10	29.0	2	1	0
PRT	sp|Q1ED39|KNOP1_HUMAN	Lysine-rich nucleolar protein 1 OS=Homo sapiens OX=9606 GN=KNOP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.04	29.0	1	1	1
PRT	sp|Q8IW45-4|NNRD_HUMAN	Isoform 4 of ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Homo sapiens OX=9606 GN=NAXD	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.08	29.0	1	1	1
PRT	sp|O75976-2|CBPD_HUMAN	Isoform 2 of Carboxypeptidase D OS=Homo sapiens OX=9606 GN=CPD	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	1091-UNIMOD:267,1102-UNIMOD:267	0.01	29.0	1	1	1
PRT	sp|Q9NTZ6|RBM12_HUMAN	RNA-binding protein 12 OS=Homo sapiens OX=9606 GN=RBM12 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|P55084-2|ECHB_HUMAN	Isoform 2 of Trifunctional enzyme subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=HADHB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	413-UNIMOD:4	0.06	29.0	1	1	1
PRT	sp|Q9Y281-3|COF2_HUMAN	Isoform 3 of Cofilin-2 OS=Homo sapiens OX=9606 GN=CFL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	75-UNIMOD:188	0.08	29.0	2	1	0
PRT	sp|Q9UMS4|PRP19_HUMAN	Pre-mRNA-processing factor 19 OS=Homo sapiens OX=9606 GN=PRPF19 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	230-UNIMOD:4	0.06	29.0	1	1	1
PRT	sp|Q07020|RL18_HUMAN	60S ribosomal protein L18 OS=Homo sapiens OX=9606 GN=RPL18 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null		0.08	29.0	1	1	1
PRT	sp|P52565|GDIR1_HUMAN	Rho GDP-dissociation inhibitor 1 OS=Homo sapiens OX=9606 GN=ARHGDIA PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.08	28.0	1	1	1
PRT	sp|P25098|ARBK1_HUMAN	Beta-adrenergic receptor kinase 1 OS=Homo sapiens OX=9606 GN=GRK2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|P15559-3|NQO1_HUMAN	Isoform 3 of NAD(P)H dehydrogenase [quinone] 1 OS=Homo sapiens OX=9606 GN=NQO1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	224-UNIMOD:188	0.05	28.0	1	1	1
PRT	sp|Q9Y5S1|TRPV2_HUMAN	Transient receptor potential cation channel subfamily V member 2 OS=Homo sapiens OX=9606 GN=TRPV2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|P49821-2|NDUV1_HUMAN	Isoform 2 of NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFV1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	133-UNIMOD:4	0.04	28.0	1	1	1
PRT	sp|P04920-2|B3A2_HUMAN	Isoform B1 of Anion exchange protein 2 OS=Homo sapiens OX=9606 GN=SLC4A2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|P11142-2|HSP7C_HUMAN	Isoform 2 of Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|O94875-9|SRBS2_HUMAN	Isoform 9 of Sorbin and SH3 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=SORBS2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|Q9P0M9|RM27_HUMAN	39S ribosomal protein L27, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL27 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.12	28.0	1	1	1
PRT	sp|Q96IR7|HPDL_HUMAN	4-hydroxyphenylpyruvate dioxygenase-like protein OS=Homo sapiens OX=9606 GN=HPDL PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	9-UNIMOD:4	0.05	28.0	1	1	1
PRT	sp|Q7Z4V5-2|HDGR2_HUMAN	Isoform 2 of Hepatoma-derived growth factor-related protein 2 OS=Homo sapiens OX=9606 GN=HDGFL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	6-UNIMOD:188,14-UNIMOD:188	0.02	28.0	1	1	1
PRT	sp|P49756-2|RBM25_HUMAN	Isoform 2 of RNA-binding protein 25 OS=Homo sapiens OX=9606 GN=RBM25	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.05	28.0	1	1	1
PRT	sp|Q86U86-6|PB1_HUMAN	Isoform 6 of Protein polybromo-1 OS=Homo sapiens OX=9606 GN=PBRM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|Q8IZL8|PELP1_HUMAN	Proline-, glutamic acid- and leucine-rich protein 1 OS=Homo sapiens OX=9606 GN=PELP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|P50402|EMD_HUMAN	Emerin OS=Homo sapiens OX=9606 GN=EMD PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	18-UNIMOD:267,31-UNIMOD:267	0.06	28.0	1	1	1
PRT	sp|Q06210-2|GFPT1_HUMAN	Isoform 2 of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 OS=Homo sapiens OX=9606 GN=GFPT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|Q9BQG0|MBB1A_HUMAN	Myb-binding protein 1A OS=Homo sapiens OX=9606 GN=MYBBP1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	678-UNIMOD:4,684-UNIMOD:267	0.01	28.0	1	1	1
PRT	sp|Q9NWH9-3|SLTM_HUMAN	Isoform 2 of SAFB-like transcription modulator OS=Homo sapiens OX=9606 GN=SLTM	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|Q96QC0|PP1RA_HUMAN	Serine/threonine-protein phosphatase 1 regulatory subunit 10 OS=Homo sapiens OX=9606 GN=PPP1R10 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	463-UNIMOD:4	0.03	28.0	1	1	1
PRT	sp|Q9BX66|SRBS1_HUMAN	Sorbin and SH3 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SORBS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|Q15942|ZYX_HUMAN	Zyxin OS=Homo sapiens OX=9606 GN=ZYX PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	null		0.09	28.0	1	1	1
PRT	sp|Q9NTK5|OLA1_HUMAN	Obg-like ATPase 1 OS=Homo sapiens OX=9606 GN=OLA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	117-UNIMOD:4,125-UNIMOD:267	0.07	28.0	1	1	1
PRT	sp|Q9NZM5|NOP53_HUMAN	Ribosome biogenesis protein NOP53 OS=Homo sapiens OX=9606 GN=NOP53 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	231-UNIMOD:188,268-UNIMOD:267	0.09	28.0	1	1	1
PRT	sp|O75419|CDC45_HUMAN	Cell division control protein 45 homolog OS=Homo sapiens OX=9606 GN=CDC45 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	267-UNIMOD:4	0.03	28.0	1	1	1
PRT	sp|P26639|SYTC_HUMAN	Threonine--tRNA ligase 1, cytoplasmic OS=Homo sapiens OX=9606 GN=TARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	null	254-UNIMOD:385,254-UNIMOD:4,261-UNIMOD:4	0.02	28.0	1	1	1
PRT	sp|Q13501-2|SQSTM_HUMAN	Isoform 2 of Sequestosome-1 OS=Homo sapiens OX=9606 GN=SQSTM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	58-UNIMOD:4,61-UNIMOD:4,67-UNIMOD:4,70-UNIMOD:4,73-UNIMOD:188	0.05	27.0	1	1	1
PRT	sp|Q8IVM0|CCD50_HUMAN	Coiled-coil domain-containing protein 50 OS=Homo sapiens OX=9606 GN=CCDC50 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.10	27.0	1	1	1
PRT	sp|P55265-5|DSRAD_HUMAN	Isoform 5 of Double-stranded RNA-specific adenosine deaminase OS=Homo sapiens OX=9606 GN=ADAR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|P53004|BIEA_HUMAN	Biliverdin reductase A OS=Homo sapiens OX=9606 GN=BLVRA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	28-UNIMOD:267,45-UNIMOD:267	0.07	27.0	1	1	1
PRT	sp|O00410-2|IPO5_HUMAN	Isoform 2 of Importin-5 OS=Homo sapiens OX=9606 GN=IPO5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|Q147X3-2|NAA30_HUMAN	Isoform 2 of N-alpha-acetyltransferase 30 OS=Homo sapiens OX=9606 GN=NAA30	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.06	27.0	1	1	1
PRT	sp|Q9Y490|TLN1_HUMAN	Talin-1 OS=Homo sapiens OX=9606 GN=TLN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	1927-UNIMOD:4	0.01	27.0	1	1	1
PRT	sp|Q9NSE4|SYIM_HUMAN	Isoleucine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=IARS2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	155-UNIMOD:4,163-UNIMOD:188	0.02	27.0	1	1	1
PRT	sp|Q53H82|LACB2_HUMAN	Endoribonuclease LACTB2 OS=Homo sapiens OX=9606 GN=LACTB2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	191-UNIMOD:188,209-UNIMOD:188	0.07	27.0	1	1	1
PRT	sp|Q9H773|DCTP1_HUMAN	dCTP pyrophosphatase 1 OS=Homo sapiens OX=9606 GN=DCTPP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	45-UNIMOD:267,54-UNIMOD:267	0.11	27.0	1	1	1
PRT	sp|P55060-3|XPO2_HUMAN	Isoform 3 of Exportin-2 OS=Homo sapiens OX=9606 GN=CSE1L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|O60664-2|PLIN3_HUMAN	Isoform 2 of Perilipin-3 OS=Homo sapiens OX=9606 GN=PLIN3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.05	27.0	1	1	1
PRT	sp|P62258|1433E_HUMAN	14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	1-UNIMOD:1	0.05	27.0	1	1	1
PRT	sp|Q13123|RED_HUMAN	Protein Red OS=Homo sapiens OX=9606 GN=IK PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.05	27.0	1	1	1
PRT	sp|P26583|HMGB2_HUMAN	High mobility group protein B2 OS=Homo sapiens OX=9606 GN=HMGB2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	106-UNIMOD:4	0.08	27.0	1	1	1
PRT	sp|P11177-3|ODPB_HUMAN	Isoform 3 of Pyruvate dehydrogenase E1 component subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=PDHB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	231-UNIMOD:4	0.08	27.0	1	1	1
PRT	sp|P49750-3|YLPM1_HUMAN	Isoform 3 of YLP motif-containing protein 1 OS=Homo sapiens OX=9606 GN=YLPM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|O15498-2|YKT6_HUMAN	Isoform 2 of Synaptobrevin homolog YKT6 OS=Homo sapiens OX=9606 GN=YKT6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.16	27.0	1	1	1
PRT	sp|Q9C075|K1C23_HUMAN	Keratin, type I cytoskeletal 23 OS=Homo sapiens OX=9606 GN=KRT23 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	30-UNIMOD:267,42-UNIMOD:267	0.04	27.0	1	1	1
PRT	sp|P50395-2|GDIB_HUMAN	Isoform 2 of Rab GDP dissociation inhibitor beta OS=Homo sapiens OX=9606 GN=GDI2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	157-UNIMOD:4	0.04	27.0	1	1	1
PRT	sp|P61978-3|HNRPK_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.04	27.0	1	1	1
PRT	sp|Q8WYA6-3|CTBL1_HUMAN	Isoform 3 of Beta-catenin-like protein 1 OS=Homo sapiens OX=9606 GN=CTNNBL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	118-UNIMOD:4	0.08	27.0	1	1	1
PRT	sp|Q99878|H2A1J_HUMAN	Histone H2A type 1-J OS=Homo sapiens OX=9606 GN=H2AC14 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.16	27.0	1	1	1
PRT	sp|P35222|CTNB1_HUMAN	Catenin beta-1 OS=Homo sapiens OX=9606 GN=CTNNB1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	213-UNIMOD:4,225-UNIMOD:267	0.02	27.0	1	1	1
PRT	sp|Q03426|KIME_HUMAN	Mevalonate kinase OS=Homo sapiens OX=9606 GN=MVK PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	26-UNIMOD:188	0.04	27.0	1	1	1
PRT	sp|Q9Y2H1|ST38L_HUMAN	Serine/threonine-protein kinase 38-like OS=Homo sapiens OX=9606 GN=STK38L PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	378-UNIMOD:188,392-UNIMOD:267	0.05	27.0	1	1	0

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	LAPITSDPTEATAVGAVEASFK	1	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	22-UNIMOD:188	ms_run[2]:scan=10049	68.975	2	2180.1308	2180.1308	R	C	401	423
PSM	LVQDVANNTNEEAGDGTTTATVLAR	2	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0		ms_run[2]:scan=5851	39.737	2	2559.2413	2559.2413	K	S	97	122
PSM	LHLGSTPHNLTDANIHELAR	3	sp|Q9UN37|VPS4A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0		ms_run[2]:scan=5874	39.878	2	2208.14	2208.1400	R	K	305	325
PSM	SPHQGFMPGAHVFSGGVLDAADR	4	sp|A8MXV4|NUD19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	23-UNIMOD:267	ms_run[2]:scan=7511	50.801	2	2362.1152	2362.1152	R	S	50	73
PSM	AASADSTTEGTPADGFTVLSTK	5	sp|O75367|H2AY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=6968	47.153	2	2126.0015	2126.0015	K	S	168	190
PSM	HHLDLGHNSQAYEALTQIPDSSR	6	sp|Q12769|NU160_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	23-UNIMOD:267	ms_run[2]:scan=6583	44.525	2	2598.245	2598.2450	K	Q	1007	1030
PSM	LVQDVANNTNEEAGDGTTTATVLAR	7	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	25-UNIMOD:267	ms_run[2]:scan=5850	39.731	2	2569.2495	2569.2495	K	S	97	122
PSM	HFLLEEDKPEEPTAHAFVSTLTR	8	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=7957	54.104	2	2666.334	2666.3340	R	G	1516	1539
PSM	HHLDLGHNSQAYEALTQIPDSSR	9	sp|Q12769|NU160_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=6575	44.472	2	2588.2368	2588.2368	K	Q	1007	1030
PSM	KHLEINPDHSIIETLR	10	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=5972	40.506	2	1914.0323	1914.0323	K	Q	632	648
PSM	LLYAVNTHCHADHITGSGLLR	11	sp|O95571|ETHE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	9-UNIMOD:4,21-UNIMOD:267	ms_run[2]:scan=5916	40.148	2	2357.1938	2357.1938	R	S	72	93
PSM	ASFNHFDKDHGGALGPEEFK	12	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	8-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=5284	36.085	2	2214.0533	2214.0533	R	A	772	792
PSM	HEQIFDSPQGPNFNGPHGPGNQSFSNPLNR	13	sp|O94913|PCF11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	30-UNIMOD:267	ms_run[2]:scan=7331	49.613	3	3298.5168	3298.5168	R	A	1155	1185
PSM	HYEAVHDAGNDSGHGGESNLALKR	14	sp|Q15075|EEA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=2596	18.808	3	2533.1694	2533.1694	K	D	59	83
PSM	KLNCQVIGASVDSHFCHLAWVNTPK	15	sp|Q06830|PRDX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	4-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=8062	54.806	3	2880.4163	2880.4163	K	K	68	93
PSM	LAPITSDPTEATAVGAVEASFK	16	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=10048	68.968	2	2174.1107	2174.1107	R	C	401	423
PSM	RFGVPVIADGGIQNVGHIAK	17	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=7459	50.467	3	2047.1327	2047.1327	R	A	356	376
PSM	VHELKEHNGQVTGIDWAPESNR	18	sp|O15143|ARC1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=4988	34.171	2	2515.2204	2515.2204	K	I	45	67
PSM	AIWSQPELAYEEHHAHR	19	sp|Q8IYS1|P20D2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	17-UNIMOD:267	ms_run[2]:scan=5602	38.135	2	2082.9899	2082.9899	R	V	44	61
PSM	HLDHVAALFPGDVDR	20	sp|P11216|PYGB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=6376	43.169	2	1660.8322	1660.8322	R	L	411	426
PSM	KYVATLGVEVHPLVFHTNR	21	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=6846	46.346	2	2179.1902	2179.1902	K	G	38	57
PSM	SKSEEAHAEDSVMDHHFR	22	sp|Q8NC51-4|PAIRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=3360	23.613	2	2110.9127	2110.9127	K	K	307	325
PSM	IFVGGIKEDTEEHHLR	23	sp|Q32P51|RA1L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	7-UNIMOD:188,16-UNIMOD:267	ms_run[1]:scan=4545	31.28863333333333	2	1894.990519	1894.987209	K	D	107	123
PSM	LLEDGEDFNLGDALDSSNSMQTIQK	24	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0		ms_run[1]:scan=9844	67.50211166666666	2	2739.243343	2739.254520	R	T	383	408
PSM	AYSEAHEISKEHMQPTHPIR	25	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=3004	21.377	2	2360.1332	2360.1332	K	L	153	173
PSM	HIDIHPENTHILDGNAVDLQAECDAFEEKIK	26	sp|P46926|GNPI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	23-UNIMOD:4,29-UNIMOD:188,31-UNIMOD:188	ms_run[2]:scan=8904	60.756	3	3582.7452	3582.7452	K	A	96	127
PSM	KEHVNVVFIGHVDAGK	27	sp|P15170-2|ERF3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=4618	31.746	2	1759.9772	1759.9772	K	S	209	225
PSM	LHQLAMQQSHFPMTHGNTGFSGIESSSPEVK	28	sp|Q15366-4|PCBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=6659	45.051	3	3381.587	3381.5870	K	G	211	242
PSM	LQFHDVAGDIFHQQCKR	29	sp|P11413|G6PD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	15-UNIMOD:4	ms_run[2]:scan=6795	45.985	2	2098.0167	2098.0167	R	N	371	388
PSM	TIAPTGHLHTVEFHQQR	30	sp|Q96FX7|TRM61_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=3866	26.926	2	1971.0075	1971.0075	R	A	124	141
PSM	YHIDLDPHFNDILGQHSR	31	sp|P19784|CSK22_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=8313	56.536	2	2176.045	2176.0450	K	K	262	280
PSM	EYKYGAHNYHPLPVALER	32	sp|P04181|OAT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=5280	36.057	2	2156.0803	2156.0803	R	G	47	65
PSM	GLPVTCEVAPHHLFLSHDDLER	33	sp|P27708|PYR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:4	ms_run[2]:scan=6923	46.867	2	2541.2434	2541.2434	R	L	1631	1653
PSM	HLEINPDHSIIETLR	34	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=7014	47.47	2	1785.9373	1785.9373	K	Q	633	648
PSM	HTGVIPTHHQFITNER	35	sp|Q9BX66-7|SRBS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	16-UNIMOD:267	ms_run[2]:scan=3267	23.038	2	1895.963	1895.9630	R	F	590	606
PSM	IGKVTSEELHYFVQNHFTSAR	36	sp|P22695|QCR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=7448	50.397	2	2462.2343	2462.2343	R	M	197	218
PSM	LNSVQSSERPLFLVHPIEGSTTVFHSLASR	37	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	9-UNIMOD:267,30-UNIMOD:267	ms_run[2]:scan=9468	64.708	3	3327.7479	3327.7479	R	L	2234	2264
PSM	MVVNEGSDGGQSVYHVHLHVLGGR	38	sp|P49773|HINT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	24-UNIMOD:267	ms_run[2]:scan=6249	42.357	2	2556.2531	2556.2531	R	Q	96	120
PSM	NEEDAAELVALAQAVNAR	39	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	18-UNIMOD:267	ms_run[2]:scan=10207	70.146	2	1892.9467	1892.9467	R	A	311	329
PSM	TLTSGGHAEHEGKPYCNHPCYAAMFGPK	40	sp|P50238|CRIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	13-UNIMOD:188,16-UNIMOD:4,20-UNIMOD:4,28-UNIMOD:188	ms_run[2]:scan=4600	31.638	3	3128.4094	3128.4094	K	G	37	65
PSM	VGHSIRHPDVEVDGFSELR	41	sp|P09874|PARP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:267,19-UNIMOD:267	ms_run[2]:scan=5827	39.583	2	2168.0878	2168.0878	K	W	60	79
PSM	IFVGGIKEDTEEHHLR	42	sp|Q32P51|RA1L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	7-UNIMOD:188,16-UNIMOD:267	ms_run[1]:scan=4379	30.232236666666665	2	1894.989299	1894.987209	K	D	107	123
PSM	AHLGTALKANPFGGASHAK	43	sp|P62266|RS23_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=4083	28.326	2	1846.9802	1846.9802	K	G	30	49
PSM	ASFNHFDKDHGGALGPEEFK	44	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=5291	36.128	2	2202.013	2202.0130	R	A	772	792
PSM	DKPHVNVGTIGHVDHGK	45	sp|P49411|EFTU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=2663	19.226	2	1808.9282	1808.9282	R	T	54	71
PSM	FRAPDEPQQAQVPHVWGWEVAGAPALR	46	sp|Q8IVT2|MISP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	2-UNIMOD:267,27-UNIMOD:267	ms_run[2]:scan=9312	63.588	3	3031.532	3031.5320	R	L	511	538
PSM	GLVEPVDVVDNADGTQTVNYVPSR	47	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	24-UNIMOD:267	ms_run[2]:scan=8249	56.092	2	2553.2586	2553.2586	K	E	1492	1516
PSM	HASGGSTVHIHPQAAPVVCR	48	sp|Q7Z6Z7-2|HUWE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	19-UNIMOD:4	ms_run[2]:scan=2940	20.973	2	2080.0385	2080.0385	K	H	3299	3319
PSM	HIDIHPENTHILDGNAVDLQAECDAFEEKIK	49	sp|P46926|GNPI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	23-UNIMOD:4,29-UNIMOD:188,31-UNIMOD:188	ms_run[2]:scan=8892	60.676	4	3582.7452	3582.7452	K	A	96	127
PSM	IKSDFFELLSNHHLDSQSR	50	sp|O14776-2|TCRG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=8366	56.876	2	2272.1236	2272.1236	K	W	774	793
PSM	KHEAFESDLAAHQDR	51	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=2654	19.174	2	1752.818	1752.8180	R	V	455	470
PSM	KHLEINPDHPIVETLR	52	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=5154	35.223	2	1910.0374	1910.0374	K	Q	624	640
PSM	KLNCQVIGASVDSHFCHLAWVNTPK	53	sp|Q06830|PRDX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:188,4-UNIMOD:4,16-UNIMOD:4,25-UNIMOD:188	ms_run[2]:scan=8076	54.9	2	2892.4566	2892.4566	K	K	68	93
PSM	MVVNEGSDGGQSVYHVHLHVLGGR	54	sp|P49773|HINT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	24-UNIMOD:267	ms_run[2]:scan=6247	42.346	3	2556.2531	2556.2531	R	Q	96	120
PSM	SGAFGHLFRPDNFIFGQSGAGNNWAK	55	sp|Q13509-2|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=10177	69.937	3	2794.3364	2794.3364	R	G	6	32
PSM	TIAPTGHLHTVEFHQQR	56	sp|Q96FX7|TRM61_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	17-UNIMOD:267	ms_run[2]:scan=3860	26.888	2	1981.0158	1981.0158	R	A	124	141
PSM	YHIDLDPHFNDILGQHSR	57	sp|P19784|CSK22_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	18-UNIMOD:267	ms_run[2]:scan=8315	56.549	2	2186.0533	2186.0533	K	K	262	280
PSM	LLEDGEDFNLGDALDSSNSMQTIQK	58	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	25-UNIMOD:188	ms_run[1]:scan=9848	67.531035	3	2745.264265	2745.274649	R	T	383	408
PSM	ASGADSKGDDLSTAILK	59	sp|P55072|TERA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:1	ms_run[2]:scan=6571	44.445	2	1689.8421	1689.8421	M	Q	2	19
PSM	DKPHVNVGTIGHVDHGK	60	sp|P49411|EFTU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=2665	19.237	2	1820.9684	1820.9684	R	T	54	71
PSM	FLQEHGSDSFLAEHKLLGNIK	61	sp|Q00688|FKBP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=7368	49.853	2	2382.2332	2382.2332	K	N	28	49
PSM	HASGGSTVHIHPQAAPVVCR	62	sp|Q7Z6Z7-2|HUWE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	19-UNIMOD:4,20-UNIMOD:267	ms_run[2]:scan=2937	20.955	2	2090.0467	2090.0467	K	H	3299	3319
PSM	HLQTYGEHYPLDHFDK	63	sp|P12694|ODBA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	16-UNIMOD:188	ms_run[2]:scan=4993	34.206	2	2004.9426	2004.9426	R	-	430	446
PSM	LFVGGIKEDTEEHHLR	64	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=4378	30.226	2	1878.9588	1878.9588	K	D	102	118
PSM	LFVGGIKEDTEEHHLR	65	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=4546	31.294	2	1878.9588	1878.9588	K	D	102	118
PSM	LNFSHGTHEYHAETIK	66	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	16-UNIMOD:188	ms_run[2]:scan=3470	24.381	2	1888.9163	1888.9163	R	N	74	90
PSM	LNSVQSSERPLFLVHPIEGSTTVFHSLASR	67	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=9440	64.51	3	3307.7313	3307.7313	R	L	2234	2264
PSM	LVQDVANNTNEEAGDGTTTATVLAR	68	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	25-UNIMOD:267	ms_run[2]:scan=5845	39.697	3	2569.2495	2569.2495	K	S	97	122
PSM	MVVNEGSDGGQSVYHVHLHVLGGR	69	sp|P49773|HINT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:35,24-UNIMOD:267	ms_run[2]:scan=5754	39.12	3	2572.248	2572.2480	R	Q	96	120
PSM	NQDLAPNSAEQASILSLVTK	70	sp|Q12905|ILF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	20-UNIMOD:188	ms_run[2]:scan=10053	68.999	2	2104.1107	2104.1107	R	I	61	81
PSM	SPVKVTLSEGPHHVALFK	71	sp|O60313-13|OPA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	4-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=5728	38.949	2	1957.1188	1957.1188	R	D	289	307
PSM	THINIVVIGHVDSGK	72	sp|P68104-2|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=5430	37.02	2	1587.8733	1587.8733	K	S	6	21
PSM	TYADYESVNECMEGVCK	73	sp|P84090|ERH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	11-UNIMOD:4,16-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=6457	43.689	2	2059.8269	2059.8269	R	M	18	35
PSM	VGHSIRHPDVEVDGFSELR	74	sp|P09874|PARP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=5826	39.577	2	2148.0712	2148.0712	K	W	60	79
PSM	VIPSPFKHADIVTTTTHK	75	sp|P34897-3|GLYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=5150	35.197	2	2003.1243	2003.1243	K	T	242	260
PSM	GNRPVILTYHDIGLNHK	76	sp|Q9UGV2|NDRG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=5570	37.93503666666666	2	1947.052839	1946.048629	K	S	52	69
PSM	STNGDTFLGGEDFDQALLR	77	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	19-UNIMOD:267	ms_run[1]:scan=10384	71.505705	2	2065.938672	2064.962782	K	H	266	285
PSM	EKLCYVALDFEQEMATAASSSSLEK	78	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	2-UNIMOD:188,4-UNIMOD:4,25-UNIMOD:188	ms_run[2]:scan=11269	79.108	3	2818.3444	2818.3444	K	S	214	239
PSM	ETTDTDTADQVIASFK	79	sp|O43707|ACTN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=8323	56.602	2	1740.8054	1740.8054	R	V	838	854
PSM	GLPVTCEVAPHHLFLSHDDLER	80	sp|P27708|PYR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:4,22-UNIMOD:267	ms_run[2]:scan=6917	46.829	2	2551.2517	2551.2517	R	L	1631	1653
PSM	GVEKPPHLAALILAR	81	sp|Q8NFW8-2|NEUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=7143	48.363	2	1583.9511	1583.9511	R	G	38	53
PSM	HFLLEEDKPEEPTAHAFVSTLTR	82	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=7949	54.049	3	2666.334	2666.3340	R	G	1516	1539
PSM	HLEIFHTEFQNLLDADKNEDLGR	83	sp|Q13616|CUL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=9649	66.135	3	2753.3409	2753.3409	K	M	299	322
PSM	HLSGEEHEKLQQLLQR	84	sp|Q96EU6-2|RRP36_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=5060	34.618	2	1944.0177	1944.0177	K	M	153	169
PSM	LNFSHGTHEYHAETIK	85	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=3319	23.361	2	1882.8962	1882.8962	R	N	74	90
PSM	MVVNEGSDGGQSVYHVHLHVLGGR	86	sp|P49773|HINT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:35,24-UNIMOD:267	ms_run[2]:scan=5755	39.126	2	2572.248	2572.2480	R	Q	96	120
PSM	RFGVPVIADGGIQNVGHIAK	87	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=7487	50.652	2	2047.1327	2047.1327	R	A	356	376
PSM	RLPNNHIGISFIPR	88	sp|O75369-5|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:267,14-UNIMOD:267	ms_run[2]:scan=6504	43.986	2	1652.9378	1652.9378	K	E	1956	1970
PSM	RSHHAASTTTAPTPAAR	89	sp|Q7Z6Z7-2|HUWE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=705	7.0295	2	1731.8765	1731.8765	R	S	1083	1100
PSM	RVHLMNPMVPGLTGSK	90	sp|P54577|SYYC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=6405	43.349	2	1735.9226	1735.9226	K	M	207	223
PSM	SFFHQHYLGGQEPTPSNIR	91	sp|P46379-4|BAG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	19-UNIMOD:267	ms_run[2]:scan=5805	39.445	2	2224.0689	2224.0689	R	M	655	674
PSM	SFHHEEHLENIPGTSENSAFR	92	sp|P12644|BMP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	21-UNIMOD:267	ms_run[2]:scan=4884	33.498	2	2447.113	2447.1130	R	F	119	140
PSM	THINIVVIGHVDSGKSTTTGHLIYK	93	sp|P68104-2|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	15-UNIMOD:188,25-UNIMOD:188	ms_run[2]:scan=5995	40.665	3	2701.4954	2701.4954	K	C	6	31
PSM	AAVQAAEVKVDGSEPK	94	sp|Q15046|SYK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:1	ms_run[2]:scan=5899	40.04	2	1639.8417	1639.8417	M	L	2	18
PSM	FHEFHSPALEDADFDNKPMVLLVGQYSTGK	95	sp|Q9NZN3-2|EHD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	17-UNIMOD:188,30-UNIMOD:188	ms_run[2]:scan=9713	66.589	3	3403.6586	3403.6586	R	T	42	72
PSM	GLPVTCEVAPHHLFLSHDDLER	96	sp|P27708|PYR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:4	ms_run[2]:scan=6921	46.856	3	2541.2434	2541.2434	R	L	1631	1653
PSM	GPKVDIDAPDVDVHGPDWHLK	97	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:188,21-UNIMOD:188	ms_run[2]:scan=6987	47.283	2	2321.1843	2321.1843	K	M	728	749
PSM	GYDVIAQAQSGTGK	98	sp|P60842-2|IF4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=4683	32.166	2	1393.6838	1393.6838	K	T	69	83
PSM	HFCPNVPIILVGNKK	99	sp|P61586|RHOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:4	ms_run[2]:scan=6827	46.201	2	1734.9603	1734.9603	K	D	105	120
PSM	HFCPNVPIILVGNKK	100	sp|P61586|RHOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:4,14-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=6821	46.164	2	1747.0006	1747.0006	K	D	105	120
PSM	HGAVCHTGAPDATLHTVHPDSVSSSYSSR	101	sp|O15027-2|SC16A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	5-UNIMOD:4	ms_run[2]:scan=3738	26.117	3	3032.3795	3032.3795	R	S	500	529
PSM	HHLDLGHNSQAYEALTQIPDSSR	102	sp|Q12769|NU160_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=6577	44.485	3	2588.2368	2588.2368	K	Q	1007	1030
PSM	HLMELNALDKQEELTPLGVHLAR	103	sp|Q9H2U1-3|DHX36_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=8577	58.401	3	2626.3901	2626.3901	R	L	673	696
PSM	HQADACHAYQIIHR	104	sp|Q99538-3|LGMN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:4	ms_run[2]:scan=3143	22.257	2	1718.806	1718.8060	R	N	45	59
PSM	HQLVHTGEKPFQCTFEGCGK	105	sp|O15391|TYY2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	13-UNIMOD:4,18-UNIMOD:4	ms_run[2]:scan=4456	30.731	2	2359.0838	2359.0838	R	R	301	321
PSM	HTEMIHNYMEHLER	106	sp|O60271-5|JIP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	14-UNIMOD:267	ms_run[2]:scan=5117	34.983	2	1848.8275	1848.8275	R	T	163	177
PSM	IMGLDLPDGGHLTHGYMSDVKR	107	sp|P34897-3|GLYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=7670	51.851	2	2411.1726	2411.1726	R	I	140	162
PSM	KYVATLGVEVHPLVFHTNR	108	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=6850	46.373	3	2179.1902	2179.1902	K	G	38	57
PSM	LLYAVNTHCHADHITGSGLLR	109	sp|O95571|ETHE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	9-UNIMOD:4,21-UNIMOD:267	ms_run[2]:scan=5921	40.181	3	2357.1938	2357.1938	R	S	72	93
PSM	NPDDITQEEYGEFYK	110	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:188	ms_run[2]:scan=6985	47.271	2	1852.8099	1852.8099	R	S	292	307
PSM	SKSEEAHAEDSVMDHHFR	111	sp|Q8NC51-4|PAIRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	13-UNIMOD:35	ms_run[2]:scan=2479	18.055	2	2126.9076	2126.9076	K	K	307	325
PSM	SVTVVEDDEDEDGDDLLHHHHVSGSR	112	sp|P02545-2|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=4676	32.125	3	2898.2652	2898.2652	R	R	546	572
PSM	TDWLDGKHVVFGHVK	113	sp|P30405|PPIF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=6385	43.225	2	1736.8998	1736.8998	K	E	161	176
PSM	TLNAHEHFVTSLDFHK	114	sp|P43034|LIS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	16-UNIMOD:188	ms_run[2]:scan=5607	38.169	2	1900.9527	1900.9527	K	T	375	391
PSM	VIPSPFKHADIVTTTTHK	115	sp|P34897|GLYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=5105	34.90228833333334	2	1992.085356	1991.084011	K	T	263	281
PSM	HLQLAIRNDEELNK	116	sp|Q96QV6|H2A1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=4554	31.341338333333336	2	1693.904843	1691.895482	R	L	83	97
PSM	FGHEFLEFEFRPDGK	117	sp|P61326-2|MGN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=8692	59.198	2	1853.8737	1853.8737	K	L	17	32
PSM	FLEHKGPVFAPPYEPLPENVK	118	sp|P11387|TOP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	5-UNIMOD:188,21-UNIMOD:188	ms_run[2]:scan=7557	51.097	2	2419.2979	2419.2979	K	F	219	240
PSM	GADINAPDKHHITPLLSAVYEGHVSCVK	119	sp|P58546|MTPN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	26-UNIMOD:4	ms_run[2]:scan=6900	46.71	3	3027.5236	3027.5236	K	L	58	86
PSM	GHAWLKDDEATHCR	120	sp|Q96T51-2|RUFY1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	13-UNIMOD:4	ms_run[2]:scan=2431	17.749	2	1694.7583	1694.7583	K	Q	528	542
PSM	GIVDQSQQAYQEAFEISK	121	sp|P63104|1433Z_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=8809	60.078	2	2039.98	2039.9800	K	K	140	158
PSM	GYDVIAQAQSGTGK	122	sp|P60842-2|IF4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:188	ms_run[2]:scan=4685	32.182	2	1399.7039	1399.7039	K	T	69	83
PSM	HDGYGSHGPLLPLPSR	123	sp|Q8WVV9-5|HNRLL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=5736	39.001	2	1701.8587	1701.8587	R	Y	254	270
PSM	HKALEEDIENHATDVHQAVK	124	sp|Q9UPN3-3|MACF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=4022	27.937	3	2283.1244	2283.1244	R	I	3373	3393
PSM	HKHIAEVSQEVTR	125	sp|P61764|STXB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=1505	11.879	2	1532.8059	1532.8059	R	S	293	306
PSM	HLLIGVSSDRGLCGAIHSSIAK	126	sp|P36542|ATPG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	13-UNIMOD:4	ms_run[2]:scan=6580	44.502	2	2290.2216	2290.2216	K	Q	91	113
PSM	HLQLNETSTANHIHSR	127	sp|Q96HV5|TM41A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	16-UNIMOD:267	ms_run[2]:scan=2617	18.94	2	1866.9324	1866.9324	K	K	246	262
PSM	HLQLNETSTANHIHSR	128	sp|Q96HV5|TM41A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=2619	18.952	2	1856.9242	1856.9242	K	K	246	262
PSM	HPELADKNVPNLHVMK	129	sp|P46783|RS10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=4608	31.687	2	1840.9618	1840.9618	K	A	32	48
PSM	HSLHEEENNIFKR	130	sp|Q96CB9-3|NSUN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=3788	26.434	2	1651.8067	1651.8067	R	S	65	78
PSM	IQEIIEQLDVTTSEYEKEK	131	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	17-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=8998	61.389	2	2306.1932	2306.1932	R	L	371	390
PSM	LNFSHGTHEYHAETIK	132	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	16-UNIMOD:188	ms_run[2]:scan=3318	23.355	2	1888.9163	1888.9163	R	N	74	90
PSM	LNFSHGTHEYHAETIK	133	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=3471	24.386	2	1882.8962	1882.8962	R	N	74	90
PSM	LQFHDVAGDIFHQQCKR	134	sp|P11413|G6PD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	15-UNIMOD:4	ms_run[2]:scan=6794	45.978	3	2098.0167	2098.0167	R	N	371	388
PSM	MIPCDFLIPVQTQHPIRK	135	sp|P06744|G6PI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:35,4-UNIMOD:4	ms_run[2]:scan=7492	50.682	2	2208.1547	2208.1548	K	G	401	419
PSM	RDEAGHFLWPGFGENAR	136	sp|Q16822-3|PCKGM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=7879	53.537	2	1957.9183	1957.9183	R	V	403	420
PSM	SKSEEAHAEDSVMDHHFR	137	sp|Q8NC51-4|PAIRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=3346	23.524	3	2110.9127	2110.9127	K	K	307	325
PSM	SLCEQVSHHPPAAAHHAESK	138	sp|P22059|OSBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:4	ms_run[2]:scan=1518	11.963	2	2192.0181	2192.0181	R	N	515	535
PSM	SVTEQGAELSNEER	139	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=3249	22.924	2	1547.7063	1547.7063	K	N	28	42
PSM	THINIVVIGHVDSGK	140	sp|P68104-2|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	15-UNIMOD:188	ms_run[2]:scan=5431	37.025	2	1593.8934	1593.8934	K	S	6	21
PSM	VHSQGPHHVCELCNK	141	sp|P56270-4|MAZ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	10-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=1132	9.5742	2	1800.8148	1800.8148	K	G	107	122
PSM	TCDISFSDPDDLLNFK	142	sp|P61081|UBC12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	2-UNIMOD:4,16-UNIMOD:188	ms_run[1]:scan=10488	72.32024166666666	2	1892.854031	1891.860524	K	L	46	62
PSM	MREIVHIQAGQCGNQIGAK	143	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	1-UNIMOD:35,2-UNIMOD:267,12-UNIMOD:4,19-UNIMOD:188	ms_run[1]:scan=3813	26.590786666666663	2	2141.080938	2141.080475	-	F	1	20
PSM	FGHEFLEFEFRPDGK	144	sp|P61326-2|MGN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=8705	59.291	2	1853.8737	1853.8737	K	L	17	32
PSM	FLQEHGSDSFLAEHKLLGNIK	145	sp|Q00688|FKBP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=7365	49.835	3	2382.2332	2382.2332	K	N	28	49
PSM	FRQHMENEMAHYACDCWDAESK	146	sp|P41250|GARS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	14-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=6338	42.926	3	2814.1043	2814.1043	R	T	429	451
PSM	FYWGHKEILIPVFK	147	sp|P53396|ACLY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=9779	67.053	2	1775.9763	1775.9763	K	N	541	555
PSM	GTPGPPPAHGAALQPHPR	148	sp|Q15654|TRIP6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	18-UNIMOD:267	ms_run[2]:scan=2509	18.252	2	1766.9204	1766.9204	R	V	26	44
PSM	HAEMVHTGLKLER	149	sp|Q01518-2|CAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=3283	23.138	2	1519.7929	1519.7929	K	A	71	84
PSM	HGAVCHTGAPDATLHTVHPDSVSSSYSSR	150	sp|O15027-2|SC16A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	5-UNIMOD:4,29-UNIMOD:267	ms_run[2]:scan=3736	26.105	3	3042.3878	3042.3878	R	S	500	529
PSM	HIADLAGNSEVILPVPAFNVINGGSHAGNK	151	sp|P06733-2|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=10118	69.478	3	3010.5625	3010.5625	R	L	40	70
PSM	HIDIHPENTHILDGNAVDLQAECDAFEEKIK	152	sp|P46926|GNPI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	23-UNIMOD:4	ms_run[2]:scan=8893	60.682	4	3570.7049	3570.7049	K	A	96	127
PSM	HLDHVAALFPGDVDR	153	sp|P11216|PYGB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	15-UNIMOD:267	ms_run[2]:scan=6382	43.208	2	1670.8404	1670.8404	R	L	411	426
PSM	HLEINPDHPIVETLR	154	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	15-UNIMOD:267	ms_run[2]:scan=6271	42.494	2	1791.9507	1791.9507	K	Q	625	640
PSM	HLNEIDLFHCIDPNDSK	155	sp|Q15185-3|TEBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	10-UNIMOD:4	ms_run[2]:scan=8196	55.737	3	2065.9527	2065.9527	K	H	49	66
PSM	HLYTKDIDIHEVR	156	sp|Q00839-2|HNRPU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=4070	28.24	2	1637.8526	1637.8526	R	I	329	342
PSM	IDQLEGDHQLIQEALIFDNKHTNYTMEHIR	157	sp|P12814-2|ACTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=9433	64.463	3	3620.7682	3620.7682	K	V	685	715
PSM	KNTDLYHCLLEHLQR	158	sp|Q8WVV4-3|POF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	8-UNIMOD:4	ms_run[2]:scan=8728	59.46	2	1938.9734	1938.9734	R	I	267	282
PSM	LLEDGEDFNLGDALDSSNSMQTIQK	159	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	20-UNIMOD:35,25-UNIMOD:188	ms_run[2]:scan=9152	62.478	2	2761.2696	2761.2696	R	T	383	408
PSM	LPGHAGSINEVAFHPDEPIIISASSDKR	160	sp|Q96DI7|SNR40_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=7264	49.158	3	2956.5043	2956.5043	K	L	323	351
PSM	NHMDITTPPLPPVAPEVLR	161	sp|Q9NZB2-2|F120A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=9040	61.676	2	2096.1088	2096.1088	R	V	539	558
PSM	NQLNPIGSLQELAIHHGWR	162	sp|O75569-3|PRKRA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=10333	71.114	2	2182.1396	2182.1396	K	L	98	117
PSM	RPQQPNPPSAPLVPGLLDQSNPLSTPMPK	163	sp|Q8WUA4-2|TF3C2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=9731	66.722	3	3075.6175	3075.6175	K	K	113	142
PSM	SGDTLLLLHHGDFSAEEVFHR	164	sp|Q9BTV4|TMM43_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	21-UNIMOD:267	ms_run[2]:scan=8578	58.407	2	2389.169	2389.1690	K	E	279	300
PSM	SIVIRPLEPQPAPHLAR	165	sp|Q15029-2|U5S1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=5958	40.42	2	1893.0949	1893.0949	K	E	880	897
PSM	SVTEQGAELSNEER	166	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	14-UNIMOD:267	ms_run[2]:scan=3246	22.907	2	1557.7146	1557.7146	K	N	28	42
PSM	SVTVVEDDEDEDGDDLLHHHHVSGSR	167	sp|P02545-2|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	26-UNIMOD:267	ms_run[2]:scan=4677	32.13	3	2908.2735	2908.2735	R	R	546	572
PSM	TFHHVYSGKDLIAQAR	168	sp|Q9NR30-2|DDX21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=4193	29.005	2	1841.9537	1841.9537	K	T	148	164
PSM	THINIVVIGHVDSGKSTTTGHLIYK	169	sp|P68104-2|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=6000	40.697	3	2689.4551	2689.4551	K	C	6	31
PSM	THINIVVIGHVDSGKSTTTGHLIYK	170	sp|P68104-2|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=6005	40.731	2	2689.4551	2689.4551	K	C	6	31
PSM	TLDAHEDKVWGLHCSR	171	sp|Q12788|TBL3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	14-UNIMOD:4	ms_run[2]:scan=4359	30.116	2	1922.9057	1922.9057	R	L	600	616
PSM	TLSYLLPAIVHINHQPFLER	172	sp|P17844|DDX5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=10502	72.418	2	2360.3005	2360.3005	K	G	145	165
PSM	TQNDVDIADVAYYFEK	173	sp|P16422|EPCAM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	16-UNIMOD:188	ms_run[2]:scan=10758	74.554	2	1895.8885	1895.8885	K	D	203	219
PSM	TVYCNVHKHEPLVLFCESCDTLTCR	174	sp|Q13263-2|TIF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	4-UNIMOD:4,16-UNIMOD:4,19-UNIMOD:4,24-UNIMOD:4	ms_run[2]:scan=7082	47.962	3	3137.4191	3137.4191	R	D	124	149
PSM	VHELKEHNGQVTGIDWAPESNR	175	sp|O15143|ARC1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=4986	34.159	3	2515.2204	2515.2204	K	I	45	67
PSM	IFVGGIKEDTEEHHLR	176	sp|Q32P51|RA1L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	7-UNIMOD:188,16-UNIMOD:267	ms_run[1]:scan=4541	31.26944166666667	3	1894.990109	1894.987209	K	D	107	123
PSM	MREIVHIQAGQCGNQIGAK	177	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	1-UNIMOD:35,12-UNIMOD:4	ms_run[1]:scan=3816	26.608596666666667	2	2125.053164	2125.052077	-	F	1	20
PSM	AIEALHGHELRPGR	178	sp|Q96PK6-3|RBM14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	11-UNIMOD:267,14-UNIMOD:267	ms_run[2]:scan=2947	21.018	2	1574.8544	1574.8544	R	A	51	65
PSM	AISHEHSPSDLEAHFVPLVK	179	sp|P30153|2AAA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	20-UNIMOD:188	ms_run[2]:scan=6685	45.234	2	2218.1478	2218.1478	R	R	114	134
PSM	CLAFHDISPQAPTHFLVIPK	180	sp|P49773|HINT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:4	ms_run[2]:scan=9102	62.107	2	2290.1932	2290.1932	R	K	38	58
PSM	DNPGVVTCLDEAR	181	sp|P22314-2|UBA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	8-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=5619	38.243	2	1454.6699	1454.6699	K	H	187	200
PSM	FRHENIIGINDIIR	182	sp|P28482-2|MK01_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7449	50.403	2	1708.9373	1708.9373	R	A	78	92
PSM	GCITIIGGGDTATCCAK	183	sp|P00558-2|PGK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:4,14-UNIMOD:4,15-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=5461	37.225	2	1759.7999	1759.7999	R	W	338	355
PSM	HDGYGSHGPLLPLPSR	184	sp|Q8WVV9-5|HNRLL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	16-UNIMOD:267	ms_run[2]:scan=5729	38.955	2	1711.867	1711.8670	R	Y	254	270
PSM	HHGIPFYVAAPSSSCDLR	185	sp|Q9BV20|MTNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	15-UNIMOD:4	ms_run[2]:scan=6296	42.655	2	2012.9527	2012.9527	K	L	271	289
PSM	HKALEEDIENHATDVHQAVK	186	sp|Q9UPN3-3|MACF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=4021	27.931	3	2295.1646	2295.1646	R	I	3373	3393
PSM	HPELADKNVPNLHVMK	187	sp|P46783|RS10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=4616	31.735	2	1853.002	1853.0020	K	A	32	48
PSM	IMEHAGKNQVLVFVHSR	188	sp|O75643|U520_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=5032	34.447	2	1964.0414	1964.0414	K	K	712	729
PSM	KEPFFHGHDNYDQLVR	189	sp|P68400-2|CSK21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=5224	35.679	2	2000.9493	2000.9493	R	I	93	109
PSM	KLASQGDSISSQLGPIHPPPR	190	sp|Q92945|FUBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=5406	36.861	3	2184.1651	2184.1651	K	T	122	143
PSM	LAERPYIIAGLHFDQEVNHYK	191	sp|Q99447-4|PCY2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=8025	54.558	3	2512.2863	2512.2863	R	G	207	228
PSM	LAVDEEENADNNTK	192	sp|P02786|TFR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	14-UNIMOD:188	ms_run[2]:scan=2597	18.814	2	1566.7105	1566.7105	K	A	40	54
PSM	LKYQHTGAVLDCAFYDPTHAWSGGLDHQLK	193	sp|O43684-2|BUB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:188,12-UNIMOD:4,30-UNIMOD:188	ms_run[2]:scan=8404	57.137	4	3439.6811	3439.6811	R	M	51	81
PSM	RIHQESELHSYLSR	194	sp|Q9UNE7-2|CHIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:267,14-UNIMOD:267	ms_run[2]:scan=3665	25.66	2	1773.9025	1773.9025	R	L	82	96
PSM	RTDLCDHALHISHDEL	195	sp|Q9Y2B0|CNPY2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:267,5-UNIMOD:4	ms_run[2]:scan=5298	36.173	2	1940.9038	1940.9038	K	-	167	183
PSM	SGGASHSELIHNLRK	196	sp|P22061|PIMT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=2349	17.225	2	1604.8383	1604.8383	K	N	5	20
PSM	SNDLFPVHHLDNNEFCPGDFVVDKR	197	sp|Q9C0C9|UBE2O_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	16-UNIMOD:4	ms_run[2]:scan=8667	59.028	3	2970.3719	2970.3719	R	V	570	595
PSM	VHSQGPHHVCELCNK	198	sp|P56270-4|MAZ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	10-UNIMOD:4,13-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=1133	9.5802	2	1806.8349	1806.8349	K	G	107	122
PSM	VLSAPPHFHFGQTNR	199	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	15-UNIMOD:267	ms_run[2]:scan=5357	36.549	2	1716.8724	1716.8724	R	T	31	46
PSM	VVSEDFLQDVSASTK	200	sp|P09874|PARP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=8220	55.9	2	1623.7992	1623.7992	R	S	453	468
PSM	AALEDTLAETEAR	201	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5896	40.023	2	1388.6783	1388.6783	K	F	318	331
PSM	AISHEHSPSDLEAHFVPLVK	202	sp|P30153|2AAA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6681	45.21	2	2212.1277	2212.1277	R	R	114	134
PSM	AYSEAHEISKEHMQPTHPIR	203	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=2994	21.313	3	2360.1332	2360.1332	K	L	153	173
PSM	DVGAQILLHSHKK	204	sp|Q96KP4-2|CNDP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=3600	25.242	2	1444.815	1444.8150	K	D	206	219
PSM	ERHPGSFDVVHVK	205	sp|P62701|RS4X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=3204	22.649	2	1505.7739	1505.7739	R	D	199	212
PSM	ETVSEESNVLCLSK	206	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	11-UNIMOD:4	ms_run[2]:scan=6261	42.431	2	1593.7556	1593.7556	R	S	581	595
PSM	GDDTPLHLAASHGHR	207	sp|Q13418-2|ILK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=2913	20.804	2	1582.7601	1582.7601	R	D	66	81
PSM	HALDAHQQSIPAVLEIPSKEHPYDAAK	208	sp|Q16864|VATF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6349	42.996	3	2964.5094	2964.5094	R	D	76	103
PSM	HGYIGEFEIIDDHRAGK	209	sp|P62244|RS15A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6121	41.524	2	1955.949	1955.9490	K	I	44	61
PSM	HHLDLGHNSQAYEALTQIPDSSR	210	sp|Q12769|NU160_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	23-UNIMOD:267	ms_run[2]:scan=6576	44.479	3	2598.245	2598.2450	K	Q	1007	1030
PSM	HLNEIDLFHCIDPNDSK	211	sp|Q15185-3|TEBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	10-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=8189	55.69	2	2071.9729	2071.9729	K	H	49	66
PSM	HQLVHTGEKPFQCTFEGCGK	212	sp|O15391|TYY2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:188,13-UNIMOD:4,18-UNIMOD:4,20-UNIMOD:188	ms_run[2]:scan=4452	30.706	3	2371.124	2371.1240	R	R	301	321
PSM	IDQLEGDHQLIQEALIFDNKHTNYTMEHIR	213	sp|P12814-2|ACTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9432	64.457	4	3620.7682	3620.7682	K	V	685	715
PSM	IEDLSQQAQLAAAEK	214	sp|Q13765|NACA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5576	37.97	2	1613.8261	1613.8261	K	F	128	143
PSM	IGNSGVEEIKGHPFFEGVDWEHIR	215	sp|Q9Y2H1-2|ST38L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8760	59.692	3	2751.3405	2751.3405	R	E	276	300
PSM	KEHVNVVFIGHVDAGK	216	sp|P15170-2|ERF3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=4619	31.752	3	1759.9772	1759.9772	K	S	209	225
PSM	KHQLLEADISAHEDR	217	sp|Q13813-3|SPTN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=3350	23.548	3	1760.8806	1760.8806	K	L	1679	1694
PSM	LAPITSDPTEATAVGAVEASFK	218	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10057	69.028	3	2174.1107	2174.1107	R	C	401	423
PSM	LAQALHEMREQHDAQVR	219	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=3041	21.612	2	2031.0068	2031.0068	K	L	242	259
PSM	NEEDAAELVALAQAVNAR	220	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10202	70.11	2	1882.9385	1882.9385	R	A	311	329
PSM	NHMDITTPPLPPVAPEVLR	221	sp|Q9NZB2-2|F120A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	19-UNIMOD:267	ms_run[2]:scan=9052	61.757	2	2106.1171	2106.1171	R	V	539	558
PSM	NPDDITQEEYGEFYK	222	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6984	47.265	2	1846.7897	1846.7897	R	S	292	307
PSM	NQDLAPNSAEQASILSLVTK	223	sp|Q12905|ILF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10052	68.993	2	2098.0906	2098.0906	R	I	61	81
PSM	SEDPDQQYLILNTAR	224	sp|Q96QK1|VPS35_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=7217	48.848	2	1761.8533	1761.8533	R	K	500	515
PSM	SHDGDKFIPAPPSSPLR	225	sp|Q9H9A5-5|CNO10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5655	38.482	2	1819.9217	1819.9217	K	K	215	232
PSM	SPVKVTLSEGPHHVALFK	226	sp|O60313-13|OPA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5730	38.961	2	1945.0785	1945.0785	R	D	289	307
PSM	STGEAFVQFASQEIAEK	227	sp|P55795|HNRH2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	17-UNIMOD:188	ms_run[2]:scan=9728	66.7	2	1846.9044	1846.9044	R	A	151	168
PSM	TAVVVGTITDDVR	228	sp|Q07020-2|RL18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:267	ms_run[2]:scan=6348	42.991	2	1354.7332	1354.7332	K	V	50	63
PSM	TFHHVYSGKDLIAQAR	229	sp|Q9NR30-2|DDX21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=4219	29.191	3	1841.9537	1841.9537	K	T	148	164
PSM	THINIVVIGHVDSGKSTTTGHLIYK	230	sp|P68104-2|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	15-UNIMOD:188,25-UNIMOD:188	ms_run[2]:scan=6015	40.807	2	2701.4954	2701.4954	K	C	6	31
PSM	TRDELEVIHLIEEHR	231	sp|P10155-3|RO60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:267,15-UNIMOD:267	ms_run[2]:scan=8014	54.489	3	1907.9968	1907.9968	R	L	238	253
PSM	TRDELEVIHLIEEHR	232	sp|P10155-3|RO60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8022	54.539	2	1887.9803	1887.9803	R	L	238	253
PSM	VVTDTDETELAR	233	sp|P05198|IF2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	12-UNIMOD:267	ms_run[2]:scan=3712	25.954	2	1357.6601	1357.6601	K	Q	277	289
PSM	YDYNSGEELESYKGHFGPIHCVR	234	sp|Q9Y3F4|STRAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	21-UNIMOD:4	ms_run[2]:scan=6438	43.567	2	2756.2289	2756.2289	K	F	250	273
PSM	TFHHVYSGKDLIAQAR	235	sp|Q9NR30|DDX21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	9-UNIMOD:188,16-UNIMOD:267	ms_run[1]:scan=4213	29.150688333333335	3	1859.006515	1857.982064	K	T	216	232
PSM	LAQHITYVHQHSR	236	sp|P33993|MCM7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	13-UNIMOD:267	ms_run[1]:scan=1541	12.103315	2	1598.824514	1598.830527	R	Q	533	546
PSM	CINHLHKTELHGK	237	sp|Q15424|SAFB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=2737	19.68396166666667	2	1568.7850	1568.7877	K	M	463	476
PSM	GDDTPLHLAASHGHR	238	sp|Q13418|ILK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	15-UNIMOD:267	ms_run[1]:scan=2916	20.825421666666667	2	1592.764870	1592.768320	R	D	66	81
PSM	QLFHPEQLITGKEDAANNYAR	239	sp|Q71U36|TBA1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	12-UNIMOD:188,21-UNIMOD:267	ms_run[1]:scan=6961	47.106635	3	2431.233107	2430.226270	R	G	85	106
PSM	AALEDTLAETEAR	240	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:267	ms_run[2]:scan=5891	39.988	2	1398.6866	1398.6866	K	F	318	331
PSM	ADLEEQLSDEEKVR	241	sp|P47755-2|CAZA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:1	ms_run[2]:scan=7588	51.301	2	1701.8057	1701.8057	M	I	2	16
PSM	AGVNTVTTLVENK	242	sp|P62424|RL7A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:188	ms_run[2]:scan=6157	41.764	2	1350.745	1350.7450	R	K	138	151
PSM	AISHEHSPSDLEAHFVPLVK	243	sp|P30153|2AAA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	20-UNIMOD:188	ms_run[2]:scan=6670	45.132	3	2218.1478	2218.1478	R	R	114	134
PSM	ALEHHRSEIQAEQDR	244	sp|Q16891-3|MIC60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=1033	8.9728	2	1817.8769	1817.8769	K	K	420	435
PSM	APIRPDIVNFVHTNLR	245	sp|P36578|RL4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=8040	54.656	2	1881.0488	1881.0488	K	K	30	46
PSM	ASEELQKDLEEVK	246	sp|Q9HB71-2|CYBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:1	ms_run[2]:scan=8370	56.901	2	1558.7726	1558.7726	M	V	2	15
PSM	AVTEQGAELSNEER	247	sp|P27348|1433T_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:267	ms_run[2]:scan=3075	21.825	2	1541.7197	1541.7197	K	N	28	42
PSM	AYSEAHEISKEHMQPTHPIR	248	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=3002	21.366	4	2360.1332	2360.1332	K	L	153	173
PSM	FDCHHCNESLFGKK	249	sp|Q14192-2|FHL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:4,6-UNIMOD:4,13-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=3234	22.828	2	1789.8067	1789.8067	R	Y	5	19
PSM	FDCHHCNESLFGKK	250	sp|Q14192-2|FHL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:4,6-UNIMOD:4	ms_run[2]:scan=3247	22.913	2	1777.7665	1777.7665	R	Y	5	19
PSM	GADINAPDKHHITPLLSAVYEGHVSCVK	251	sp|P58546|MTPN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	26-UNIMOD:4	ms_run[2]:scan=6908	46.77	2	3027.5236	3027.5236	K	L	58	86
PSM	GDDTPLHLAASHGHR	252	sp|Q13418-2|ILK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=2924	20.877	3	1582.7601	1582.7601	R	D	66	81
PSM	GVDEVTIVNILTNR	253	sp|P07355-2|ANXA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:267	ms_run[2]:scan=10812	75.004	2	1551.8496	1551.8496	K	S	68	82
PSM	GVEKPPHLAALILAR	254	sp|Q8NFW8-2|NEUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7142	48.358	3	1583.9511	1583.9511	R	G	38	53
PSM	HEERQDEHGYISR	255	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:267,13-UNIMOD:267	ms_run[2]:scan=1029	8.9453	2	1674.7613	1674.7613	K	C	124	137
PSM	HFCPNVPIILVGNKK	256	sp|P61586|RHOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:4,14-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=6842	46.32	3	1747.0006	1747.0006	K	D	105	120
PSM	HFLLEEDKPEEPTAHAFVSTLTR	257	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	8-UNIMOD:188,23-UNIMOD:267	ms_run[2]:scan=7961	54.131	2	2682.3624	2678.3743	R	G	1516	1539
PSM	HISCPLLILHAEDDPVVPFQLGR	258	sp|Q8N2K0-3|ABD12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:4,23-UNIMOD:267	ms_run[2]:scan=10548	72.77	3	2635.382	2635.3820	K	K	282	305
PSM	HLQTYGEHYPLDHFDK	259	sp|P12694|ODBA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=4996	34.222	2	1998.9224	1998.9224	R	-	430	446
PSM	KGWLSLHTGNLDGEDHAAER	260	sp|Q96EL2|RT24_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5575	37.964	3	2205.0563	2205.0563	R	T	66	86
PSM	KHQALQAEIAGHEPR	261	sp|Q13813-3|SPTN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=2898	20.711	2	1683.8805	1683.8805	K	I	825	840
PSM	LAQHITYVHQHSR	262	sp|P33993-3|MCM7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=1542	12.109	2	1588.8223	1588.8223	R	Q	357	370
PSM	LAVDEEENADNNTK	263	sp|P02786|TFR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=2602	18.843	2	1560.6904	1560.6904	K	A	40	54
PSM	LNSVQSSERPLFLVHPIEGSTTVFHSLASR	264	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9431	64.451	4	3307.7313	3307.7313	R	L	2234	2264
PSM	MIKPFFHSLSEK	265	sp|P10599|THIO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:35,3-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=5199	35.517	2	1490.7994	1490.7994	K	Y	37	49
PSM	MIKPFFHSLSEK	266	sp|P10599|THIO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:35	ms_run[2]:scan=5201	35.528	2	1478.7592	1478.7592	K	Y	37	49
PSM	MKVVEVLAGHGHLYSR	267	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:35	ms_run[2]:scan=4372	30.19	3	1810.9512	1810.9512	K	I	1240	1256
PSM	MVVNEGSDGGQSVYHVHLHVLGGR	268	sp|P49773|HINT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6254	42.388	2	2546.2448	2546.2448	R	Q	96	120
PSM	NITLNFGPQHPAAHGVLR	269	sp|O75306-2|NDUS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	18-UNIMOD:267	ms_run[2]:scan=6413	43.4	2	1951.0416	1951.0416	K	L	79	97
PSM	NSLKELWLVIHGR	270	sp|O43169|CYB5B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9309	63.571	2	1563.8885	1563.8885	R	V	36	49
PSM	RPHDYQPLPGMSENPSVYVPGVVSTVVPDSAHK	271	sp|P26368-2|U2AF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:267,33-UNIMOD:188	ms_run[2]:scan=9135	62.352	3	3574.7849	3570.7968	R	L	228	261
PSM	SETAPAETATPAPVEKSPAK	272	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:1,16-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=3684	25.779	2	2035.0512	2035.0512	M	K	2	22
PSM	SGDTLLLLHHGDFSAEEVFHR	273	sp|Q9BTV4|TMM43_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=8572	58.367	3	2379.1608	2379.1608	K	E	279	300
PSM	SIFGEDALANVSIEKPIHQGPDAAVTGHIR	274	sp|P53618|COPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=8298	56.433	3	3141.6207	3141.6207	R	I	899	929
PSM	SIVIRPLEPQPAPHLAR	275	sp|Q15029-2|U5S1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5955	40.402	3	1893.0949	1893.0949	K	E	880	897
PSM	SLCEQVSHHPPAAAHHAESK	276	sp|P22059|OSBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:4,20-UNIMOD:188	ms_run[2]:scan=1522	11.986	2	2198.0383	2198.0383	R	N	515	535
PSM	SQAEFEKAAEEVR	277	sp|P07108|ACBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:1	ms_run[2]:scan=7119	48.214	2	1534.7264	1534.7264	M	H	2	15
PSM	SVTVVEDDEDEDGDDLLHHHHVSGSR	278	sp|P02545-2|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	26-UNIMOD:267	ms_run[2]:scan=4679	32.141	2	2908.2735	2908.2735	R	R	546	572
PSM	TDWLDGKHVVFGHVK	279	sp|P30405|PPIF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	7-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=6383	43.214	2	1748.9401	1748.9401	K	E	161	176
PSM	THVDSHGHNVFK	280	sp|P49736|MCM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:188	ms_run[2]:scan=1211	10.066	2	1382.6787	1382.6787	R	E	205	217
PSM	TQNDVDIADVAYYFEK	281	sp|P16422|EPCAM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=10761	74.578	2	1889.8683	1889.8683	K	D	203	219
PSM	TWHPEHFVCTHCQEEIGSR	282	sp|P49023-4|PAXI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	9-UNIMOD:4,12-UNIMOD:4,19-UNIMOD:267	ms_run[2]:scan=4781	32.808	2	2419.0462	2419.0462	K	N	209	228
PSM	VLSAPPHFHFGQTNR	283	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	15-UNIMOD:267	ms_run[2]:scan=5513	37.568	2	1716.8724	1716.8724	R	T	31	46
PSM	VLSAPPHFHFGQTNR	284	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5358	36.554	2	1706.8641	1706.8641	R	T	31	46
PSM	VVQHFVHCIETHGR	285	sp|Q14643-4|ITPR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	8-UNIMOD:4	ms_run[2]:scan=3550	24.918	3	1717.8471	1717.8471	R	N	1277	1291
PSM	VVVHPLVLLSVVDHFNR	286	sp|P51665|PSMD7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	17-UNIMOD:267	ms_run[2]:scan=10892	75.596	3	1952.1235	1952.1235	K	I	9	26
PSM	VVVHPLVLLSVVDHFNR	287	sp|P51665|PSMD7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=10897	75.626	2	1942.1153	1942.1153	K	I	9	26
PSM	YHTINGHNAEVRK	288	sp|P22626-2|ROA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=988	8.7116	2	1537.775	1537.7750	K	A	162	175
PSM	VDHQTGPIVWGEPGTNGQHAFYQLIHQGTK	289	sp|P06744|G6PI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	30-UNIMOD:188	ms_run[1]:scan=9672	66.30127833333333	3	3321.630934	3320.642237	R	M	371	401
PSM	TFHHVYSGKDLIAQAR	290	sp|Q9NR30|DDX21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	9-UNIMOD:188,16-UNIMOD:267	ms_run[1]:scan=4209	29.113151666666667	3	1858.014959	1857.982064	K	T	216	232
PSM	GNRPVILTYHDIGLNHK	291	sp|Q9UGV2|NDRG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:267,17-UNIMOD:188	ms_run[1]:scan=5574	37.958481666666664	3	1963.083391	1962.077027	K	S	52	69
PSM	EKHAHSILQFQFAEVK	292	sp|Q32MZ4|LRRF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=6865	46.474579999999996	2	1912.005784	1911.000282	R	E	223	239
PSM	ASFNHFDKDHGGALGPEEFK	293	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5293	36.144	3	2202.013	2202.0130	R	A	772	792
PSM	DLHDANTDLIGRHPK	294	sp|P53985-2|MOT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=3373	23.697	2	1700.8594	1700.8594	K	Q	225	240
PSM	DVGAQILLHSHKK	295	sp|Q96KP4-2|CNDP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=3594	25.202	2	1456.8553	1456.8553	K	D	206	219
PSM	FGAHLGQPHSTTIIIRDPDELDR	296	sp|P16144-4|ITB4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6289	42.609	3	2587.3143	2587.3143	K	S	1088	1111
PSM	FHKEIIHELEK	297	sp|Q9UHR4|BI2L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=3349	23.543	2	1421.7667	1421.7667	K	K	96	107
PSM	GHALLILRPEELGFLR	298	sp|Q9NVP1|DDX18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	8-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=10020	68.771	2	1853.079	1853.0790	R	Y	524	540
PSM	GHDEREHPFLVK	299	sp|P78527-2|PRKDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=2670	19.267	2	1462.7317	1462.7317	R	G	3742	3754
PSM	HCVTFVLHEEDHTLGNSLR	300	sp|P0DPB6|RPAC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	2-UNIMOD:4,19-UNIMOD:267	ms_run[2]:scan=5992	40.643	3	2273.0887	2273.0887	R	Y	38	57
PSM	HFCPNVPIILVANKK	301	sp|P62745|RHOB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	3-UNIMOD:4	ms_run[2]:scan=6962	47.113	2	1748.976	1748.9760	K	D	105	120
PSM	HLDHVAALFPGDVDR	302	sp|P11216|PYGB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	15-UNIMOD:267	ms_run[2]:scan=6378	43.181	3	1670.8404	1670.8404	R	L	411	426
PSM	HLMELNALDKQEELTPLGVHLAR	303	sp|Q9H2U1-3|DHX36_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8570	58.35	4	2626.3901	2626.3901	R	L	673	696
PSM	HLMELNALDKQEELTPLGVHLAR	304	sp|Q9H2U1-3|DHX36_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8574	58.379	2	2626.3901	2626.3901	R	L	673	696
PSM	HLQLNETSTANHIHSR	305	sp|Q96HV5|TM41A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=2615	18.928	3	1856.9242	1856.9242	K	K	246	262
PSM	HRHPECYVCTDCGTNLK	306	sp|O00151|PDLI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	6-UNIMOD:4,9-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=2833	20.293	2	2145.9143	2145.9143	R	Q	278	295
PSM	HVKHELAEIVFK	307	sp|Q9Y2R5|RT17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=4765	32.7	2	1448.814	1448.8140	K	V	76	88
PSM	IHQEGDALPGHSKPSR	308	sp|Q1ED39|KNOP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=1209	10.049	2	1727.8703	1727.8703	K	S	218	234
PSM	IMEHAGKNQVLVFVHSR	309	sp|O75643|U520_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5035	34.465	3	1964.0414	1964.0414	K	K	712	729
PSM	IWHHTFYNELR	310	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5076	34.722	2	1514.7419	1514.7419	K	V	85	96
PSM	KHFTILDAPGHK	311	sp|P15170-2|ERF3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=3220	22.743	2	1362.7408	1362.7408	K	S	289	301
PSM	LHALVVGPGLGRDDALLR	312	sp|Q8IW45-4|NNRD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7489	50.664	2	1871.0741	1871.0741	R	N	35	53
PSM	LRQHHDEYEDEIR	313	sp|O75976-2|CBPD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	2-UNIMOD:267,13-UNIMOD:267	ms_run[2]:scan=2126	15.806	2	1758.8188	1758.8188	R	M	1090	1103
PSM	MIKPFFHSLSEK	314	sp|P10599|THIO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5871	39.863	2	1462.7643	1462.7643	K	Y	37	49
PSM	MVVNEGSDGGQSVYHVHLHVLGGR	315	sp|P49773|HINT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:35	ms_run[2]:scan=5757	39.137	3	2562.2398	2562.2398	R	Q	96	120
PSM	MVVNEGSDGGQSVYHVHLHVLGGR	316	sp|P49773|HINT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	24-UNIMOD:267	ms_run[2]:scan=6265	42.459	4	2556.2531	2556.2531	R	Q	96	120
PSM	NQLNPIGSLQELAIHHGWR	317	sp|O75569-3|PRKRA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	19-UNIMOD:267	ms_run[2]:scan=10324	71.048	2	2192.1478	2192.1478	K	L	98	117
PSM	RLPNNHIGISFIPR	318	sp|O75369-5|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6533	44.183	2	1632.9212	1632.9212	K	E	1956	1970
PSM	RPHDYQPLPGMSENPSVYVPGVVSTVVPDSAHK	319	sp|P26368-2|U2AF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9106	62.135	4	3558.7566	3558.7566	R	L	228	261
PSM	RPHDYQPLPGMSENPSVYVPGVVSTVVPDSAHK	320	sp|P26368-2|U2AF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9121	62.244	3	3558.7566	3558.7566	R	L	228	261
PSM	TLSYLLPAIVHINHQPFLER	321	sp|P17844|DDX5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	20-UNIMOD:267	ms_run[2]:scan=10508	72.461	2	2370.3088	2370.3088	K	G	145	165
PSM	VDAVHLLKDHVGR	322	sp|Q9NTZ6|RBM12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=4982	34.133	2	1457.8103	1457.8103	R	N	329	342
PSM	VDHQTGPIVWGEPGTNGQHAFYQLIHQGTK	323	sp|P06744|G6PI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	30-UNIMOD:188	ms_run[2]:scan=8916	60.838	3	3320.6422	3320.6422	R	M	371	401
PSM	VGLPPLEKFNNWGGSLSLGHPFGATGCR	324	sp|P55084-2|ECHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	27-UNIMOD:4	ms_run[2]:scan=10521	72.549	3	2967.4814	2967.4814	K	L	387	415
PSM	YALYDATYETK	325	sp|Q9Y281-3|COF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:188	ms_run[2]:scan=5719	38.892	2	1342.6388	1342.6388	R	E	65	76
PSM	YRQVASHVGLHSASIPGILALDLCPSDTNK	326	sp|Q9UMS4|PRP19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	24-UNIMOD:4	ms_run[2]:scan=9036	61.646	3	3218.6506	3218.6506	K	I	207	237
PSM	APGTPHSHTKPYVR	327	sp|Q07020|RL18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=865	7.963946666666666	2	1546.803834	1546.800460	K	S	155	169
PSM	FLQEHGSDSFLAEHKLLGNIK	328	sp|Q00688|FKBP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	15-UNIMOD:188,21-UNIMOD:188	ms_run[1]:scan=7366	49.840673333333335	3	2395.280281	2394.273453	K	N	28	49
PSM	STNGDTFLGGEDFDQALLR	329	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=10340	71.16300333333334	2	2055.929182	2054.954513	K	H	266	285
PSM	MREIVHIQAGQCGNQIGAK	330	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	1-UNIMOD:35,12-UNIMOD:4	ms_run[1]:scan=3811	26.579829999999998	3	2125.052989	2125.052077	-	F	1	20
PSM	AASADSTTEGTPADGFTVLSTK	331	sp|O75367|H2AY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	22-UNIMOD:188	ms_run[2]:scan=6963	47.119	2	2132.0217	2132.0217	K	S	168	190
PSM	AEEYEFLTPVEEAPK	332	sp|P52565|GDIR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8330	56.648	2	1750.8301	1750.8301	R	G	153	168
PSM	AISHEHSPSDLEAHFVPLVK	333	sp|P30153|2AAA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6679	45.198	3	2212.1277	2212.1277	R	R	114	134
PSM	DKPHVNVGTIGHVDHGK	334	sp|P49411|EFTU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=2660	19.211	3	1820.9684	1820.9684	R	T	54	71
PSM	DLKPANILLDEHGHVR	335	sp|P25098|ARBK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5974	40.517	2	1825.9799	1825.9799	R	I	317	333
PSM	DSYVGDEAQSK	336	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:188	ms_run[2]:scan=1812	13.807	2	1203.5351	1203.5351	K	R	51	62
PSM	EMVELPLRHPALFK	337	sp|P55072|TERA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7580	51.249	2	1678.9229	1678.9229	K	A	218	232
PSM	FGLSVGHHLGK	338	sp|P15559-3|NQO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:188	ms_run[2]:scan=4128	28.609	2	1156.6449	1156.6449	K	S	214	225
PSM	FRQHMENEMAHYACDCWDAESK	339	sp|P41250|GARS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	14-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=6332	42.887	4	2814.1043	2814.1043	R	T	429	451
PSM	FYWGHKEILIPVFK	340	sp|P53396|ACLY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	6-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=9775	67.029	2	1788.0166	1788.0166	K	N	541	555
PSM	GHSALHIAIEKR	341	sp|Q9Y5S1|TRPV2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=2655	19.18	2	1330.747	1330.7470	R	S	163	175
PSM	HCVTFVLHEEDHTLGNSLR	342	sp|P0DPB6|RPAC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:4	ms_run[2]:scan=5990	40.631	3	2263.0804	2263.0804	R	Y	38	57
PSM	HDPHKLLEGCLVGGR	343	sp|P49821-2|NDUV1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	10-UNIMOD:4	ms_run[2]:scan=4586	31.548	2	1686.8624	1686.8624	R	A	124	139
PSM	HHGIPFYVAAPSSSCDLR	344	sp|Q9BV20|MTNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	15-UNIMOD:4,18-UNIMOD:267	ms_run[2]:scan=6313	42.766	2	2022.9609	2022.9609	K	L	271	289
PSM	HIADLAGNSEVILPVPAFNVINGGSHAGNK	345	sp|P06733-2|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	30-UNIMOD:188	ms_run[2]:scan=10122	69.508	3	3016.5826	3016.5826	R	L	40	70
PSM	HLEINPDHPIVETLR	346	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6267	42.47	2	1781.9424	1781.9424	K	Q	625	640
PSM	HPELADKNVPNLHVMK	347	sp|P46783|RS10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	7-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=4617	31.741	4	1853.002	1853.0020	K	A	32	48
PSM	HSHPSDEKDFSFPR	348	sp|P04920-2|B3A2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=3606	25.279	2	1684.7594	1684.7594	K	N	413	427
PSM	HVKHELAEIVFK	349	sp|Q9Y2R5|RT17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=4777	32.78	2	1460.8542	1460.8542	K	V	76	88
PSM	HWPFMVVNDAGRPK	350	sp|P11142-2|HSP7C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6823	46.175	3	1652.8246	1652.8246	K	V	89	103
PSM	IDQLEGDHQLIQEALIFDNKHTNYTMEHIR	351	sp|P12814-2|ACTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9441	64.516	5	3620.7682	3620.7682	K	V	685	715
PSM	IGKVTSEELHYFVQNHFTSAR	352	sp|P22695|QCR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7440	50.348	3	2462.2343	2462.2343	R	M	197	218
PSM	KHFTILDAPGHK	353	sp|P15170-2|ERF3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=3206	22.66	2	1362.7408	1362.7408	K	S	289	301
PSM	KIDQNWYEGEHHGR	354	sp|O94875-9|SRBS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=2929	20.906	2	1767.8077	1767.8077	R	V	439	453
PSM	KMEGHYVHAGNIIATQR	355	sp|Q9P0M9|RM27_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=3305	23.27	3	1923.9737	1923.9737	K	H	55	72
PSM	KYFDFLSSYSAVNQGHCHPK	356	sp|P04181|OAT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	17-UNIMOD:4	ms_run[2]:scan=7193	48.689	2	2384.1008	2384.1008	R	I	77	97
PSM	LAQALHEMREQHDAQVR	357	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	9-UNIMOD:267,17-UNIMOD:267	ms_run[2]:scan=3040	21.606	2	2051.0234	2051.0234	K	L	242	259
PSM	LCHIAFHVPAGQPLAR	358	sp|Q96IR7|HPDL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:4	ms_run[2]:scan=6373	43.151	3	1785.9461	1785.9461	R	N	8	24
PSM	LLEDGEDFNLGDALDSSNSMQTIQK	359	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	20-UNIMOD:35	ms_run[2]:scan=9153	62.484	2	2755.2494	2755.2494	R	T	383	408
PSM	MVVNEGSDGGQSVYHVHLHVLGGR	360	sp|P49773|HINT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:35	ms_run[2]:scan=5758	39.143	2	2562.2398	2562.2398	R	Q	96	120
PSM	MVVNEGSDGGQSVYHVHLHVLGGR	361	sp|P49773|HINT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6250	42.363	3	2546.2448	2546.2448	R	Q	96	120
PSM	NPDDITNEEYGEFYK	362	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	15-UNIMOD:188	ms_run[2]:scan=6855	46.408	2	1838.7942	1838.7942	R	S	300	315
PSM	NVTELNEPLSNEER	363	sp|P61981|1433G_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	14-UNIMOD:267	ms_run[2]:scan=5140	35.133	2	1652.7881	1652.7881	K	N	29	43
PSM	PHAFKPGDLVFAK	364	sp|Q7Z4V5-2|HDGR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	5-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=6031	40.909	2	1437.8171	1437.8171	M	M	2	15
PSM	RFPVAPLIPYPLITK	365	sp|P49756-2|RBM25_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10575	72.953	2	1724.0389	1724.0389	R	E	247	262
PSM	RLDLFQEHMFEVLER	366	sp|Q86U86-6|PB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10178	69.943	3	1960.9829	1960.9829	R	A	836	851
PSM	RLHDLVLPLVMGVQQGEVLGSSPYTSSR	367	sp|Q8IZL8|PELP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10568	72.904	3	3037.6019	3037.6019	R	C	547	575
PSM	RTDLCDHALHISHDEL	368	sp|Q9Y2B0|CNPY2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	5-UNIMOD:4	ms_run[2]:scan=5296	36.16	2	1930.8956	1930.8956	K	-	167	183
PSM	RYNIPHGPVVGSTR	369	sp|P50402|EMD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:267,14-UNIMOD:267	ms_run[2]:scan=3897	27.13	2	1571.8435	1571.8435	R	R	18	32
PSM	SEHKLSTDHIPILYR	370	sp|Q06210-2|GFPT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5387	36.734	2	1807.9581	1807.9581	R	T	213	228
PSM	SETAPAETATPAPVEKSPAK	371	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:1	ms_run[2]:scan=3682	25.767	2	2023.011	2023.0110	M	K	2	22
PSM	SVFGHICSHLTPR	372	sp|Q9BQG0|MBB1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	7-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=5332	36.389	2	1519.7593	1519.7593	R	A	672	685
PSM	TLTSGGHAEHEGKPYCNHPCYAAMFGPK	373	sp|P50238|CRIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:188,16-UNIMOD:4,20-UNIMOD:4,28-UNIMOD:188	ms_run[2]:scan=4603	31.654	4	3128.4094	3128.4094	K	G	37	65
PSM	TVIIHDRPDITHPR	374	sp|Q9NWH9-3|SLTM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=3295	23.209	2	1668.906	1668.9060	R	H	424	438
PSM	VGHSIRHPDVEVDGFSELR	375	sp|P09874|PARP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5824	39.566	3	2148.0712	2148.0712	K	W	60	79
PSM	VPWVCPRPLVLPSPLVTPGSNSQER	376	sp|Q96QC0|PP1RA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	5-UNIMOD:4	ms_run[2]:scan=10135	69.607	3	2784.4745	2784.4745	K	Y	459	484
PSM	YALYDATYETK	377	sp|Q9Y281-3|COF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5720	38.898	2	1336.6187	1336.6187	R	E	65	76
PSM	QIDQNWYEGEHHGR	378	sp|Q9BX66|SRBS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0		ms_run[1]:scan=2929	20.90636	2	1767.8002	1767.7712	K	V	825	839
PSM	SPSSSQPLPQVPAPAQSQTQFHVQPQPQPKPQVQLHVQSQTQPVSLANTQPR	379	sp|Q15942|ZYX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0		ms_run[1]:scan=7088	48.01571	5	5657.9140	5657.9086	K	G	202	254
PSM	GAHNGQGLGNAFLSHISACDGIFHLTR	380	sp|Q9NTK5|OLA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	19-UNIMOD:4,27-UNIMOD:267	ms_run[1]:scan=10501	72.41197	3	2860.357412	2859.386248	K	A	99	126
PSM	LHTKPSQAPAVEVAPAGASYNPSFEDHQTLLSAAHEVELQR	381	sp|Q9NZM5|NOP53_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	4-UNIMOD:188,41-UNIMOD:267	ms_run[1]:scan=7930	53.90407	3	4411.219003	4411.216775	R	Q	228	269
PSM	HNHRNEDEENTLSVDCTR	382	sp|O75419|CDC45_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	16-UNIMOD:4	ms_run[1]:scan=2199	16.275663333333334	2	2224.956102	2224.951570	R	I	252	270
PSM	CGPLIDLCRGPHVR	383	sp|P26639|SYTC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:385,1-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=7571	51.190621666666665	2	1631.8041	1631.8019	R	H	254	268
PSM	AGVNTVTTLVENK	384	sp|P62424|RL7A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6158	41.77	2	1344.7249	1344.7249	R	K	138	151
PSM	ASFNHFDKDHGGALGPEEFK	385	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	8-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=5311	36.259	3	2214.0533	2214.0533	R	A	772	792
PSM	AYSEAHEISKEHMQPTHPIR	386	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:188,20-UNIMOD:267	ms_run[2]:scan=3005	21.383	2	2376.1616	2372.1734	K	L	153	173
PSM	CLAFHDISPQAPTHFLVIPK	387	sp|P49773|HINT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:4,20-UNIMOD:188	ms_run[2]:scan=9083	61.976	2	2296.2134	2296.2134	R	K	38	58
PSM	CSVCPDYDLCSVCEGK	388	sp|Q13501-2|SQSTM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:4,4-UNIMOD:4,10-UNIMOD:4,13-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=6171	41.856	2	1953.7672	1953.7672	K	G	58	74
PSM	DFAVLEDHTLAHSLQEQEIEHHLASNVQR	389	sp|Q8IVM0|CCD50_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8562	58.298	4	3365.6389	3365.6389	R	N	20	49
PSM	DGSAFEDGLRHPFIVNHPK	390	sp|P55265-5|DSRAD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6516	44.062	2	2135.0548	2135.0548	R	V	792	811
PSM	DLRNPHPSSAFLNLIGFVSR	391	sp|P53004|BIEA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	3-UNIMOD:267,20-UNIMOD:267	ms_run[2]:scan=11330	79.63	3	2259.2027	2259.2027	R	R	26	46
PSM	DVHMPKHPELADK	392	sp|P46783|RS10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3279	23.113	2	1515.7504	1515.7504	K	N	26	39
PSM	ERHPGSFDVVHVK	393	sp|P62701|RS4X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3209	22.681	3	1505.7739	1505.7739	R	D	199	212
PSM	FDCHHCNESLFGKK	394	sp|Q14192-2|FHL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	3-UNIMOD:4,6-UNIMOD:4,13-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=3233	22.821	3	1789.8067	1789.8067	R	Y	5	19
PSM	FHEFHSPALEDADFDNKPMVLLVGQYSTGK	395	sp|Q9NZN3-2|EHD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9705	66.531	3	3391.6183	3391.6183	R	T	42	72
PSM	FHEKVIAALLQTMEDQGNQR	396	sp|O00410-2|IPO5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10146	69.684	3	2327.1692	2327.1692	K	V	378	398
PSM	GAGVHSGERPPHSLSSNAR	397	sp|Q147X3-2|NAA30_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=1424	11.375	2	1914.9409	1914.9409	K	T	92	111
PSM	HEERQDEHGYISR	398	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=1028	8.9395	2	1654.7448	1654.7448	K	C	124	137
PSM	HEQIFDSPQGPNFNGPHGPGNQSFSNPLNR	399	sp|O94913|PCF11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7330	49.607	3	3288.5085	3288.5085	R	A	1155	1185
PSM	HLEINPDHSIIETLR	400	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7022	47.526	3	1785.9373	1785.9373	K	Q	633	648
PSM	HRVQELGHGCAALVTK	401	sp|Q9Y490|TLN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:4	ms_run[2]:scan=2851	20.406	2	1774.9261	1774.9261	K	A	1918	1934
PSM	IGKVTSEELHYFVQNHFTSAR	402	sp|P22695|QCR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7447	50.392	4	2462.2343	2462.2343	R	M	197	218
PSM	IHFVPGWDCHGLPIEIK	403	sp|Q9NSE4|SYIM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	9-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=9212	62.898	2	2023.0445	2023.0445	K	V	147	164
PSM	IKADIIYPGHGPVIHNAEAK	404	sp|Q53H82|LACB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=4875	33.428	3	2154.1988	2154.1988	K	I	190	210
PSM	KHEAFESDLAAHQDR	405	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:188,15-UNIMOD:267	ms_run[2]:scan=2650	19.151	2	1768.8464	1764.8582	R	V	455	470
PSM	LAQHITYVHQHSR	406	sp|P33993-3|MCM7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:267	ms_run[2]:scan=1538	12.087	3	1598.8305	1598.8305	R	Q	357	370
PSM	LHAEFAAERDWEQFHQPR	407	sp|Q9H773|DCTP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	9-UNIMOD:267,18-UNIMOD:267	ms_run[2]:scan=6418	43.435	4	2286.0833	2286.0833	R	N	37	55
PSM	LKYQHTGAVLDCAFYDPTHAWSGGLDHQLK	408	sp|O43684-2|BUB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:188,12-UNIMOD:4,30-UNIMOD:188	ms_run[2]:scan=8391	57.043	3	3439.6811	3439.6811	R	M	51	81
PSM	LLQTDDEEEAGLLELLK	409	sp|P55060-3|XPO2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=11362	79.942	2	1927.999	1927.9990	K	S	252	269
PSM	LRQHAYEHSLGK	410	sp|O60664-2|PLIN3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=1195	9.966	2	1437.7477	1437.7477	R	L	63	75
PSM	MDDREDLVYQAK	411	sp|P62258|1433E_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:1	ms_run[2]:scan=5878	39.904	2	1523.6926	1523.6926	-	L	1	13
PSM	PERDSEPFSNPLAPDGHDVDDPHSFHQSK	412	sp|Q13123|RED_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5653	38.47	3	3256.4446	3256.4446	M	L	2	31
PSM	PPSAFFLFCSEHRPK	413	sp|P26583|HMGB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	9-UNIMOD:4	ms_run[2]:scan=7650	51.699	3	1818.8876	1818.8876	R	I	98	113
PSM	QAQEYEALLNIK	414	sp|P05783|K1C18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:188	ms_run[2]:scan=8158	55.477	2	1424.7607	1424.7607	R	V	359	371
PSM	QGTHITVVSHSRPVGHCLEAAAVLSK	415	sp|P11177-3|ODPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	17-UNIMOD:4	ms_run[2]:scan=4804	32.957	3	2753.4395	2753.4395	R	E	215	241
PSM	QLQAAAAHWQQHQQHR	416	sp|P49750-3|YLPM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=2405	17.582	2	1936.9517	1936.9517	K	V	382	398
PSM	QVDRIDWPVGSPATIHYPALDGHLSR	417	sp|O15498-2|YKT6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8700	59.257	3	2899.4729	2899.4729	K	Y	104	130
PSM	SFFHQHYLGGQEPTPSNIR	418	sp|P46379-4|BAG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	19-UNIMOD:267	ms_run[2]:scan=5799	39.408	3	2224.0689	2224.0689	R	M	655	674
PSM	SFPRAPTVHGGAGGAR	419	sp|Q9C075|K1C23_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	4-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=2936	20.95	2	1556.8075	1556.8075	R	I	27	43
PSM	SGAFGHLFRPDNFIFGQSGAGNNWAK	420	sp|Q13509-2|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10174	69.913	4	2794.3364	2794.3364	R	G	6	32
PSM	SVTVVEDDEDEDGDDLLHHHHVSGSR	421	sp|P02545-2|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4671	32.09	2	2898.2652	2898.2652	R	R	546	572
PSM	TAVVVGTITDDVR	422	sp|Q07020-2|RL18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6357	43.049	2	1344.7249	1344.7249	K	V	50	63
PSM	TDDYLDQPCYETINR	423	sp|P50395-2|GDIB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	9-UNIMOD:4	ms_run[2]:scan=6397	43.299	2	1901.8102	1901.8102	R	I	149	164
PSM	TDYNASVSVPDSSGPER	424	sp|P61978-3|HNRPK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4535	31.231	2	1779.7911	1779.7911	R	I	70	87
PSM	THINIVVIGHVDSGK	425	sp|P68104-2|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	15-UNIMOD:188	ms_run[2]:scan=5440	37.082	3	1593.8934	1593.8934	K	S	6	21
PSM	THINIVVIGHVDSGKSTTTGHLIYK	426	sp|P68104-2|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	15-UNIMOD:188,25-UNIMOD:188	ms_run[2]:scan=5996	40.671	4	2701.4954	2701.4954	K	C	6	31
PSM	VLDHAMIGPEGTDNCHKFVDILGLR	427	sp|Q8WYA6-3|CTBL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	15-UNIMOD:4	ms_run[2]:scan=8979	61.262	3	2806.3895	2806.3895	K	T	104	129
PSM	VTIAQGGVLPNIQAVLLPK	428	sp|Q99878|H2A1J_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=11318	79.523	2	1930.1615	1930.1615	K	K	101	120
PSM	LNSVQSSERPLFLVHPIEGSTTVFHSLASR	429	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	9-UNIMOD:267,30-UNIMOD:267	ms_run[1]:scan=9727	66.693465	3	3328.734683	3327.747863	R	L	2234	2264
PSM	IFVGGIKEDTEEHHLR	430	sp|Q32P51|RA1L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	7-UNIMOD:188,16-UNIMOD:267	ms_run[1]:scan=4376	30.216945000000003	3	1894.989028	1894.987209	K	D	107	123
PSM	NSLKELWLVIHGR	431	sp|O43169|CYB5B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	4-UNIMOD:188,13-UNIMOD:267	ms_run[1]:scan=9366	63.96127166666667	2	1579.919758	1579.916944	R	V	36	49
PSM	CTAGTLHNLSHHR	432	sp|P35222|CTNB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:4,13-UNIMOD:267	ms_run[1]:scan=1418	11.341013333333333	2	1512.717562	1512.724347	R	E	213	226
PSM	VILHGEHAVVHGK	433	sp|Q03426|KIME_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	13-UNIMOD:188	ms_run[1]:scan=1582	12.360753333333333	2	1401.795611	1400.798397	K	V	14	27
PSM	MREIVHIQAGQCGNQIGAK	434	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:35,2-UNIMOD:267,12-UNIMOD:4,19-UNIMOD:188	ms_run[1]:scan=3812	26.585213333333336	3	2141.081308	2141.080475	-	F	1	20
PSM	IGNSGVEEIKGHPFFEGVDWEHIR	435	sp|Q9Y2H1|ST38L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	10-UNIMOD:188,24-UNIMOD:267	ms_run[1]:scan=8773	59.78666333333333	4	2767.370876	2767.368912	R	E	369	393