MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000208 -- new
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220618\20220618002634800212^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\111222_HL21.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220618\20220618002634800212^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\111222_HL21.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Acetyl (Protein N-term),Label:13C(6) (K),Label:13C(6)15N(4) (R),Oxidation (M)
MTD	software[1]-setting	maxMissedCleavages=1
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=40
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Label:13C(6) (K),Label:13C(6)15N(4) (R),Acetyl (Protein N-term)
MTD	software[2]-setting	TOL(-)=20
MTD	software[2]-setting	TOL(+)=20
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=1000
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=1
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Acetyl (Protein N-term),Label:13C(6) (K),Label:13C(6)15N(4) (R),Oxidation (M)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=1
MTD	software[3]-setting	peptide_mass_tolerance=20
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:1, Acetyl,]
MTD	variable_mod[1]-site	N-term
MTD	variable_mod[1]-position	Protein N-term
MTD	variable_mod[2]	[UNIMOD, UNIMOD:188, Label:13C(6),]
MTD	variable_mod[2]-site	K
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:267, Label:13C(6)15N(4),]
MTD	variable_mod[3]-site	R
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[4]-site	M
MTD	variable_mod[4]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|Q9UDT6-2|CLIP2_HUMAN	Isoform 2 of CAP-Gly domain-containing linker protein 2 OS=Homo sapiens OX=9606 GN=CLIP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	490-UNIMOD:4	0.03	43.0	2	1	0
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	39.0	null	1240-UNIMOD:35,2242-UNIMOD:267,2263-UNIMOD:267	0.02	39.0	5	2	0
PRT	sp|P06744|G6PI_HUMAN	Glucose-6-phosphate isomerase OS=Homo sapiens OX=9606 GN=GPI PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	39.0	null	370-UNIMOD:267,400-UNIMOD:188	0.06	39.0	6	1	0
PRT	sp|O15067|PUR4_HUMAN	Phosphoribosylformylglycinamidine synthase OS=Homo sapiens OX=9606 GN=PFAS PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	975-UNIMOD:4,149-UNIMOD:35	0.04	39.0	3	2	1
PRT	sp|Q13501-2|SQSTM_HUMAN	Isoform 2 of Sequestosome-1 OS=Homo sapiens OX=9606 GN=SQSTM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	99-UNIMOD:267	0.05	38.0	2	1	0
PRT	sp|P14618-2|KPYM_HUMAN	Isoform M1 of Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	89-UNIMOD:188	0.04	38.0	4	2	0
PRT	sp|P30566-2|PUR8_HUMAN	Isoform 2 of Adenylosuccinate lyase OS=Homo sapiens OX=9606 GN=ADSL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	98-UNIMOD:4,99-UNIMOD:4,101-UNIMOD:188	0.04	37.0	3	1	0
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.02	37.0	1	1	1
PRT	sp|P19784|CSK22_HUMAN	Casein kinase II subunit alpha' OS=Homo sapiens OX=9606 GN=CSNK2A2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.06	37.0	1	1	1
PRT	sp|P49773|HINT1_HUMAN	Histidine triad nucleotide-binding protein 1 OS=Homo sapiens OX=9606 GN=HINT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	96-UNIMOD:35,119-UNIMOD:267,38-UNIMOD:4	0.42	37.0	7	2	1
PRT	sp|P68104-2|EF1A1_HUMAN	Isoform 2 of Elongation factor 1-alpha 1 OS=Homo sapiens OX=9606 GN=EEF1A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	20-UNIMOD:188,245-UNIMOD:267	0.06	37.0	5	2	0
PRT	sp|O43488|ARK72_HUMAN	Aflatoxin B1 aldehyde reductase member 2 OS=Homo sapiens OX=9606 GN=AKR7A2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	132-UNIMOD:4,156-UNIMOD:4,129-UNIMOD:267,158-UNIMOD:267	0.09	36.0	3	1	0
PRT	sp|Q8TEQ6|GEMI5_HUMAN	Gem-associated protein 5 OS=Homo sapiens OX=9606 GN=GEMIN5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	120-UNIMOD:267	0.01	36.0	2	1	0
PRT	sp|P09622-3|DLDH_HUMAN	Isoform 3 of Dihydrolipoyl dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=DLD	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.05	35.0	1	1	1
PRT	sp|Q9C075-2|K1C23_HUMAN	Isoform 2 of Keratin, type I cytoskeletal 23 OS=Homo sapiens OX=9606 GN=KRT23	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	79-UNIMOD:188,91-UNIMOD:188	0.07	35.0	1	1	1
PRT	sp|P27708|PYR1_HUMAN	CAD protein OS=Homo sapiens OX=9606 GN=CAD PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	35.0	null	122-UNIMOD:267,1636-UNIMOD:4	0.02	35.0	3	2	1
PRT	sp|P30153|2AAA_HUMAN	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Homo sapiens OX=9606 GN=PPP2R1A PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.04	34.0	1	1	1
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	240-UNIMOD:4,230-UNIMOD:188,243-UNIMOD:188	0.08	34.0	3	1	0
PRT	sp|Q9NUJ1-2|ABHDA_HUMAN	Isoform 2 of Mycophenolic acid acyl-glucuronide esterase, mitochondrial OS=Homo sapiens OX=9606 GN=ABHD10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	72-UNIMOD:4,82-UNIMOD:4,85-UNIMOD:267	0.13	33.0	2	1	0
PRT	sp|Q9Y5B9|SP16H_HUMAN	FACT complex subunit SPT16 OS=Homo sapiens OX=9606 GN=SUPT16H PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	760-UNIMOD:267,770-UNIMOD:267	0.02	33.0	2	1	0
PRT	sp|Q9BTX1-4|NDC1_HUMAN	Isoform 4 of Nucleoporin NDC1 OS=Homo sapiens OX=9606 GN=NDC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	346-UNIMOD:267,367-UNIMOD:267	0.04	33.0	2	1	0
PRT	sp|O43852-12|CALU_HUMAN	Isoform 12 of Calumenin OS=Homo sapiens OX=9606 GN=CALU	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	37-UNIMOD:188,59-UNIMOD:188	0.45	33.0	4	1	0
PRT	sp|Q96G03-2|PGM2_HUMAN	Isoform 2 of Phosphoglucomutase-2 OS=Homo sapiens OX=9606 GN=PGM2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.08	33.0	1	1	1
PRT	sp|P04439|HLAA_HUMAN	HLA class I histocompatibility antigen, A alpha chain OS=Homo sapiens OX=9606 GN=HLA-A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	283-UNIMOD:4	0.05	33.0	1	1	1
PRT	sp|P50914|RL14_HUMAN	60S ribosomal protein L14 OS=Homo sapiens OX=9606 GN=RPL14 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	33.0	null	54-UNIMOD:4,63-UNIMOD:188,71-UNIMOD:188,54-UNIMOD:385	0.09	33.0	4	1	0
PRT	sp|O76061|STC2_HUMAN	Stanniocalcin-2 OS=Homo sapiens OX=9606 GN=STC2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	252-UNIMOD:267	0.06	32.0	1	1	1
PRT	sp|Q9GZN8|CT027_HUMAN	UPF0687 protein C20orf27 OS=Homo sapiens OX=9606 GN=C20orf27 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	35-UNIMOD:188	0.11	32.0	2	1	0
PRT	sp|Q8TCJ2|STT3B_HUMAN	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Homo sapiens OX=9606 GN=STT3B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	2	1	0
PRT	sp|O75027-3|ABCB7_HUMAN	Isoform 3 of ATP-binding cassette sub-family B member 7, mitochondrial OS=Homo sapiens OX=9606 GN=ABCB7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	1	1	1
PRT	sp|P61962|DCAF7_HUMAN	DDB1- and CUL4-associated factor 7 OS=Homo sapiens OX=9606 GN=DCAF7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	226-UNIMOD:267	0.06	32.0	3	1	0
PRT	sp|Q13057|COASY_HUMAN	Bifunctional coenzyme A synthase OS=Homo sapiens OX=9606 GN=COASY PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|P49736|MCM2_HUMAN	DNA replication licensing factor MCM2 OS=Homo sapiens OX=9606 GN=MCM2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	216-UNIMOD:188,218-UNIMOD:267	0.02	32.0	3	1	0
PRT	sp|Q9Y6M5|ZNT1_HUMAN	Zinc transporter 1 OS=Homo sapiens OX=9606 GN=SLC30A1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.05	32.0	2	1	0
PRT	sp|P30086|PEBP1_HUMAN	Phosphatidylethanolamine-binding protein 1 OS=Homo sapiens OX=9606 GN=PEBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.07	32.0	1	1	1
PRT	sp|Q92747|ARC1A_HUMAN	Actin-related protein 2/3 complex subunit 1A OS=Homo sapiens OX=9606 GN=ARPC1A PE=2 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.05	31.0	1	1	1
PRT	sp|O94925-3|GLSK_HUMAN	Isoform 3 of Glutaminase kidney isoform, mitochondrial OS=Homo sapiens OX=9606 GN=GLS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	518-UNIMOD:4,525-UNIMOD:4	0.04	31.0	1	1	1
PRT	sp|P43243|MATR3_HUMAN	Matrin-3 OS=Homo sapiens OX=9606 GN=MATR3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	293-UNIMOD:4,296-UNIMOD:4	0.04	31.0	2	1	0
PRT	sp|Q5SRE5-2|NU188_HUMAN	Isoform 2 of Nucleoporin NUP188 homolog OS=Homo sapiens OX=9606 GN=NUP188	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.01	31.0	1	1	1
PRT	sp|Q9NWT1|PK1IP_HUMAN	p21-activated protein kinase-interacting protein 1 OS=Homo sapiens OX=9606 GN=PAK1IP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	87-UNIMOD:4	0.05	31.0	1	1	1
PRT	sp|P43034-2|LIS1_HUMAN	Isoform 2 of Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens OX=9606 GN=PAFAH1B1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	122-UNIMOD:267	0.18	31.0	2	1	0
PRT	sp|Q13347|EIF3I_HUMAN	Eukaryotic translation initiation factor 3 subunit I OS=Homo sapiens OX=9606 GN=EIF3I PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	282-UNIMOD:188,298-UNIMOD:188	0.06	31.0	4	1	0
PRT	sp|Q5VTR2|BRE1A_HUMAN	E3 ubiquitin-protein ligase BRE1A OS=Homo sapiens OX=9606 GN=RNF20 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|P05388-2|RLA0_HUMAN	Isoform 2 of 60S acidic ribosomal protein P0 OS=Homo sapiens OX=9606 GN=RPLP0	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.07	30.0	1	1	1
PRT	sp|Q9UBQ7|GRHPR_HUMAN	Glyoxylate reductase/hydroxypyruvate reductase OS=Homo sapiens OX=9606 GN=GRHPR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	57-UNIMOD:4	0.06	30.0	2	1	0
PRT	sp|Q96C23|GALM_HUMAN	Aldose 1-epimerase OS=Homo sapiens OX=9606 GN=GALM PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	247-UNIMOD:4,249-UNIMOD:188	0.05	30.0	1	1	1
PRT	sp|Q13813-3|SPTN1_HUMAN	Isoform 3 of Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	2	1	0
PRT	sp|Q14203-5|DCTN1_HUMAN	Isoform 5 of Dynactin subunit 1 OS=Homo sapiens OX=9606 GN=DCTN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	2	1	0
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.05	30.0	2	2	2
PRT	sp|Q9HDC9|APMAP_HUMAN	Adipocyte plasma membrane-associated protein OS=Homo sapiens OX=9606 GN=APMAP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	404-UNIMOD:267	0.07	30.0	4	1	0
PRT	sp|P50238|CRIP1_HUMAN	Cysteine-rich protein 1 OS=Homo sapiens OX=9606 GN=CRIP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	49-UNIMOD:188,52-UNIMOD:4,56-UNIMOD:4,64-UNIMOD:188	0.38	30.0	2	1	0
PRT	sp|P26641|EF1G_HUMAN	Elongation factor 1-gamma OS=Homo sapiens OX=9606 GN=EEF1G PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	45-UNIMOD:267	0.04	30.0	3	1	0
PRT	sp|P99999|CYC_HUMAN	Cytochrome c OS=Homo sapiens OX=9606 GN=CYCS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null		0.13	30.0	1	1	1
PRT	sp|O00116|ADAS_HUMAN	Alkyldihydroxyacetonephosphate synthase, peroxisomal OS=Homo sapiens OX=9606 GN=AGPS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	190-UNIMOD:4,198-UNIMOD:267	0.02	29.0	3	1	0
PRT	sp|O94979-7|SC31A_HUMAN	Isoform 7 of Protein transport protein Sec31A OS=Homo sapiens OX=9606 GN=SEC31A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	546-UNIMOD:267,558-UNIMOD:267	0.02	29.0	3	1	0
PRT	sp|Q08211|DHX9_HUMAN	ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	680-UNIMOD:267,672-UNIMOD:35	0.01	29.0	4	1	0
PRT	sp|Q8TC12-2|RDH11_HUMAN	Isoform 2 of Retinol dehydrogenase 11 OS=Homo sapiens OX=9606 GN=RDH11	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	190-UNIMOD:4,181-UNIMOD:188,193-UNIMOD:188	0.08	29.0	2	1	0
PRT	sp|Q14684-2|RRP1B_HUMAN	Isoform 2 of Ribosomal RNA processing protein 1 homolog B OS=Homo sapiens OX=9606 GN=RRP1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	1	1	1
PRT	sp|P22087|FBRL_HUMAN	rRNA 2'-O-methyltransferase fibrillarin OS=Homo sapiens OX=9606 GN=FBL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	99-UNIMOD:4,92-UNIMOD:267,100-UNIMOD:267	0.05	29.0	3	1	0
PRT	sp|Q9NQZ2|SAS10_HUMAN	Something about silencing protein 10 OS=Homo sapiens OX=9606 GN=UTP3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	289-UNIMOD:267,300-UNIMOD:267	0.03	29.0	1	1	1
PRT	sp|Q13151|ROA0_HUMAN	Heterogeneous nuclear ribonucleoprotein A0 OS=Homo sapiens OX=9606 GN=HNRNPA0 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.04	28.0	1	1	1
PRT	sp|P30084|ECHM_HUMAN	Enoyl-CoA hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=ECHS1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.04	28.0	1	1	1
PRT	sp|Q5T0N5-3|FBP1L_HUMAN	Isoform 3 of Formin-binding protein 1-like OS=Homo sapiens OX=9606 GN=FNBP1L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	485-UNIMOD:4	0.05	28.0	1	1	1
PRT	sp|P61586|RHOA_HUMAN	Transforming protein RhoA OS=Homo sapiens OX=9606 GN=RHOA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null	107-UNIMOD:4,118-UNIMOD:188,119-UNIMOD:188	0.08	28.0	2	1	0
PRT	sp|Q9UII2|ATIF1_HUMAN	ATPase inhibitor, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5IF1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null	82-UNIMOD:188,83-UNIMOD:188	0.11	28.0	4	1	0
PRT	sp|Q15185-3|TEBP_HUMAN	Isoform 3 of Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	58-UNIMOD:4	0.15	28.0	1	1	1
PRT	sp|P51648|AL3A2_HUMAN	Aldehyde dehydrogenase family 3 member A2 OS=Homo sapiens OX=9606 GN=ALDH3A2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	425-UNIMOD:4	0.03	28.0	1	1	1
PRT	sp|P15559-3|NQO1_HUMAN	Isoform 3 of NAD(P)H dehydrogenase [quinone] 1 OS=Homo sapiens OX=9606 GN=NQO1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.06	28.0	1	1	1
PRT	sp|Q9ULC4-2|MCTS1_HUMAN	Isoform 2 of Malignant T-cell-amplified sequence 1 OS=Homo sapiens OX=9606 GN=MCTS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	75-UNIMOD:188,87-UNIMOD:188	0.10	28.0	4	1	0
PRT	sp|P48634-4|PRC2A_HUMAN	Isoform 4 of Protein PRRC2A OS=Homo sapiens OX=9606 GN=PRRC2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	738-UNIMOD:267,756-UNIMOD:267	0.02	28.0	1	1	0
PRT	sp|Q14258|TRI25_HUMAN	E3 ubiquitin/ISG15 ligase TRIM25 OS=Homo sapiens OX=9606 GN=TRIM25 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	168-UNIMOD:4,174-UNIMOD:4,176-UNIMOD:4,179-UNIMOD:4,119-UNIMOD:4,122-UNIMOD:4,127-UNIMOD:4,150-UNIMOD:267	0.09	28.0	2	2	2
PRT	sp|P09525-2|ANXA4_HUMAN	Isoform 2 of Annexin A4 OS=Homo sapiens OX=9606 GN=ANXA4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.05	28.0	2	1	0
PRT	sp|P46020-2|KPB1_HUMAN	Isoform 2 of Phosphorylase b kinase regulatory subunit alpha, skeletal muscle isoform OS=Homo sapiens OX=9606 GN=PHKA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|Q969X6-2|UTP4_HUMAN	Isoform 2 of U3 small nucleolar RNA-associated protein 4 homolog OS=Homo sapiens OX=9606 GN=UTP4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|Q2TAY7-2|SMU1_HUMAN	Isoform 2 of WD40 repeat-containing protein SMU1 OS=Homo sapiens OX=9606 GN=SMU1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	324-UNIMOD:188,348-UNIMOD:188	0.09	28.0	3	1	0
PRT	sp|Q7Z5L9-2|I2BP2_HUMAN	Isoform 2 of Interferon regulatory factor 2-binding protein 2 OS=Homo sapiens OX=9606 GN=IRF2BP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.04	28.0	1	1	1
PRT	sp|Q9BVI4|NOC4L_HUMAN	Nucleolar complex protein 4 homolog OS=Homo sapiens OX=9606 GN=NOC4L PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.05	28.0	1	1	1
PRT	sp|P02545-2|LMNA_HUMAN	Isoform C of Prelamin-A/C OS=Homo sapiens OX=9606 GN=LMNA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null		0.05	28.0	1	1	1
PRT	sp|Q13885|TBB2A_HUMAN	Tubulin beta-2A chain OS=Homo sapiens OX=9606 GN=TUBB2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	1-UNIMOD:35,2-UNIMOD:267,12-UNIMOD:4,19-UNIMOD:188	0.04	28.0	1	1	1
PRT	sp|Q15424-2|SAFB1_HUMAN	Isoform 2 of Scaffold attachment factor B1 OS=Homo sapiens OX=9606 GN=SAFB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	394-UNIMOD:4,400-UNIMOD:188,406-UNIMOD:188	0.02	27.0	3	1	0
PRT	sp|Q00839-2|HNRPU_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	423-UNIMOD:267,431-UNIMOD:4,434-UNIMOD:4,443-UNIMOD:188	0.03	27.0	2	1	0
PRT	sp|P07355-2|ANXA2_HUMAN	Isoform 2 of Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	151-UNIMOD:4,153-UNIMOD:267,81-UNIMOD:267	0.09	27.0	3	2	1
PRT	sp|O75150-3|BRE1B_HUMAN	Isoform 3 of E3 ubiquitin-protein ligase BRE1B OS=Homo sapiens OX=9606 GN=RNF40	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|O95249-2|GOSR1_HUMAN	Isoform 2 of Golgi SNAP receptor complex member 1 OS=Homo sapiens OX=9606 GN=GOSR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.08	27.0	1	1	1
PRT	sp|Q9H773|DCTP1_HUMAN	dCTP pyrophosphatase 1 OS=Homo sapiens OX=9606 GN=DCTPP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.11	27.0	1	1	1
PRT	sp|Q96F86|EDC3_HUMAN	Enhancer of mRNA-decapping protein 3 OS=Homo sapiens OX=9606 GN=EDC3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	341-UNIMOD:4	0.04	27.0	1	1	1
PRT	sp|Q96EE3|SEH1_HUMAN	Nucleoporin SEH1 OS=Homo sapiens OX=9606 GN=SEH1L PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.06	27.0	2	1	0
PRT	sp|O75369-7|FLNB_HUMAN	Isoform 7 of Filamin-B OS=Homo sapiens OX=9606 GN=FLNB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	1992-UNIMOD:267,2015-UNIMOD:188	0.01	27.0	2	1	0
PRT	sp|Q13813|SPTN1_HUMAN	Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	1591-UNIMOD:188,1605-UNIMOD:267	0.01	27.0	1	1	0
PRT	sp|Q09028|RBBP4_HUMAN	Histone-binding protein RBBP4 OS=Homo sapiens OX=9606 GN=RBBP4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.08	27.0	1	1	1
PRT	sp|P68400-2|CSK21_HUMAN	Isoform 2 of Casein kinase II subunit alpha OS=Homo sapiens OX=9606 GN=CSNK2A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.06	26.0	1	1	1
PRT	sp|Q96AE4|FUBP1_HUMAN	Far upstream element-binding protein 1 OS=Homo sapiens OX=9606 GN=FUBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	191-UNIMOD:35,172-UNIMOD:267,196-UNIMOD:188	0.04	26.0	4	1	0
PRT	sp|Q96QK1|VPS35_HUMAN	Vacuolar protein sorting-associated protein 35 OS=Homo sapiens OX=9606 GN=VPS35 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	433-UNIMOD:267	0.02	26.0	3	1	0
PRT	sp|P62805|H4_HUMAN	Histone H4 OS=Homo sapiens OX=9606 GN=H4C1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.11	26.0	1	1	1
PRT	sp|O75083-3|WDR1_HUMAN	Isoform 2 of WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=WDR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	460-UNIMOD:188	0.06	26.0	3	1	0
PRT	sp|Q15428|SF3A2_HUMAN	Splicing factor 3A subunit 2 OS=Homo sapiens OX=9606 GN=SF3A2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	214-UNIMOD:35	0.04	26.0	1	1	1
PRT	sp|P10599|THIO_HUMAN	Thioredoxin OS=Homo sapiens OX=9606 GN=TXN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	37-UNIMOD:35,39-UNIMOD:188,48-UNIMOD:188	0.12	26.0	1	1	1
PRT	sp|Q9HCN8|SDF2L_HUMAN	Stromal cell-derived factor 2-like protein 1 OS=Homo sapiens OX=9606 GN=SDF2L1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.16	26.0	1	1	1
PRT	sp|P02545|LMNA_HUMAN	Prelamin-A/C OS=Homo sapiens OX=9606 GN=LMNA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	570-UNIMOD:4,582-UNIMOD:267	0.06	26.0	1	1	0
PRT	sp|P12074|CX6A1_HUMAN	Cytochrome c oxidase subunit 6A1, mitochondrial OS=Homo sapiens OX=9606 GN=COX6A1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.28	26.0	1	1	1
PRT	sp|P78318|IGBP1_HUMAN	Immunoglobulin-binding protein 1 OS=Homo sapiens OX=9606 GN=IGBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	116-UNIMOD:4,118-UNIMOD:4	0.07	25.0	2	1	0
PRT	sp|Q6P1X6-2|CH082_HUMAN	Isoform 2 of UPF0598 protein C8orf82 OS=Homo sapiens OX=9606 GN=C8orf82	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	99-UNIMOD:4	0.10	25.0	1	1	1
PRT	sp|Q16644|MAPK3_HUMAN	MAP kinase-activated protein kinase 3 OS=Homo sapiens OX=9606 GN=MAPKAPK3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	165-UNIMOD:267	0.05	25.0	1	1	1
PRT	sp|P49411|EFTU_HUMAN	Elongation factor Tu, mitochondrial OS=Homo sapiens OX=9606 GN=TUFM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	55-UNIMOD:188,70-UNIMOD:188	0.04	25.0	1	1	1
PRT	sp|Q9NTK5-3|OLA1_HUMAN	Isoform 3 of Obg-like ATPase 1 OS=Homo sapiens OX=9606 GN=OLA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	117-UNIMOD:4,125-UNIMOD:267	0.10	25.0	3	1	0
PRT	sp|O15533-4|TPSN_HUMAN	Isoform 4 of Tapasin OS=Homo sapiens OX=9606 GN=TAPBP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.07	25.0	1	1	1
PRT	sp|Q13838|DX39B_HUMAN	Spliceosome RNA helicase DDX39B OS=Homo sapiens OX=9606 GN=DDX39B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	198-UNIMOD:4	0.03	25.0	1	1	1
PRT	sp|P53597|SUCA_HUMAN	Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=SUCLG1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	192-UNIMOD:188,193-UNIMOD:188	0.03	25.0	1	1	1
PRT	sp|P78371-2|TCPB_HUMAN	Isoform 2 of T-complex protein 1 subunit beta OS=Homo sapiens OX=9606 GN=CCT2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	129-UNIMOD:188,134-UNIMOD:188	0.02	25.0	2	1	0
PRT	sp|P46087-3|NOP2_HUMAN	Isoform 3 of Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase OS=Homo sapiens OX=9606 GN=NOP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q96AY3-2|FKB10_HUMAN	Isoform 2 of Peptidyl-prolyl cis-trans isomerase FKBP10 OS=Homo sapiens OX=9606 GN=FKBP10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.05	25.0	1	1	1
PRT	sp|P02545-5|LMNA_HUMAN	Isoform 5 of Prelamin-A/C OS=Homo sapiens OX=9606 GN=LMNA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	471-UNIMOD:4,483-UNIMOD:267	0.07	25.0	1	1	0
PRT	sp|O14672-2|ADA10_HUMAN	Isoform 2 of Disintegrin and metalloproteinase domain-containing protein 10 OS=Homo sapiens OX=9606 GN=ADAM10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	98-UNIMOD:4	0.07	25.0	1	1	1
PRT	sp|P02794|FRIH_HUMAN	Ferritin heavy chain OS=Homo sapiens OX=9606 GN=FTH1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.09	25.0	1	1	1
PRT	sp|P15311|EZRI_HUMAN	Ezrin OS=Homo sapiens OX=9606 GN=EZR PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	171-UNIMOD:267,180-UNIMOD:267	0.03	24.0	2	1	0
PRT	sp|O95817|BAG3_HUMAN	BAG family molecular chaperone regulator 3 OS=Homo sapiens OX=9606 GN=BAG3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.05	24.0	1	1	1
PRT	sp|O75439|MPPB_HUMAN	Mitochondrial-processing peptidase subunit beta OS=Homo sapiens OX=9606 GN=PMPCB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	265-UNIMOD:4,277-UNIMOD:4	0.04	24.0	1	1	1
PRT	sp|O00625|PIR_HUMAN	Pirin OS=Homo sapiens OX=9606 GN=PIR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	49-UNIMOD:267,59-UNIMOD:267	0.05	24.0	1	1	1
PRT	sp|Q8NAF0|ZN579_HUMAN	Zinc finger protein 579 OS=Homo sapiens OX=9606 GN=ZNF579 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	443-UNIMOD:4	0.03	24.0	1	1	1
PRT	sp|Q9Y2L1|RRP44_HUMAN	Exosome complex exonuclease RRP44 OS=Homo sapiens OX=9606 GN=DIS3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	129-UNIMOD:267	0.01	24.0	3	1	0
PRT	sp|Q92673|SORL_HUMAN	Sortilin-related receptor OS=Homo sapiens OX=9606 GN=SORL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.00	24.0	1	1	1
PRT	sp|Q92945|FUBP2_HUMAN	Far upstream element-binding protein 2 OS=Homo sapiens OX=9606 GN=KHSRP PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	379-UNIMOD:4,378-UNIMOD:267,384-UNIMOD:267	0.02	24.0	2	1	0
PRT	sp|P00338-5|LDHA_HUMAN	Isoform 5 of L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	185-UNIMOD:4	0.15	24.0	1	1	1
PRT	sp|P61978-3|HNRPK_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	292-UNIMOD:267	0.03	24.0	1	1	1
PRT	sp|Q92696|PGTA_HUMAN	Geranylgeranyl transferase type-2 subunit alpha OS=Homo sapiens OX=9606 GN=RABGGTA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	302-UNIMOD:4	0.05	24.0	1	1	1
PRT	sp|P31689|DNJA1_HUMAN	DnaJ homolog subfamily A member 1 OS=Homo sapiens OX=9606 GN=DNAJA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|P62937-2|PPIA_HUMAN	Isoform 2 of Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	22-UNIMOD:188,31-UNIMOD:188	0.15	24.0	1	1	1
PRT	sp|Q8IYS1|P20D2_HUMAN	Peptidase M20 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=PM20D2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	68-UNIMOD:267,88-UNIMOD:267	0.07	24.0	1	1	1
PRT	sp|Q6IAA8|LTOR1_HUMAN	Ragulator complex protein LAMTOR1 OS=Homo sapiens OX=9606 GN=LAMTOR1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.20	24.0	1	1	1
PRT	sp|P47897|SYQ_HUMAN	Glutamine--tRNA ligase OS=Homo sapiens OX=9606 GN=QARS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	267-UNIMOD:267,282-UNIMOD:188	0.02	24.0	1	1	1
PRT	sp|P62917|RL8_HUMAN	60S ribosomal protein L8 OS=Homo sapiens OX=9606 GN=RPL8 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	221-UNIMOD:188,226-UNIMOD:267	0.11	24.0	1	1	1
PRT	sp|P00505-2|AATM_HUMAN	Isoform 2 of Aspartate aminotransferase, mitochondrial OS=Homo sapiens OX=9606 GN=GOT2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.05	23.0	1	1	0
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	215-UNIMOD:188,217-UNIMOD:4,238-UNIMOD:188	0.07	23.0	1	1	1
PRT	sp|P13010|XRCC5_HUMAN	X-ray repair cross-complementing protein 5 OS=Homo sapiens OX=9606 GN=XRCC5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	489-UNIMOD:267,493-UNIMOD:4,497-UNIMOD:267	0.02	23.0	2	1	0
PRT	sp|Q08945|SSRP1_HUMAN	FACT complex subunit SSRP1 OS=Homo sapiens OX=9606 GN=SSRP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|P42345|MTOR_HUMAN	Serine/threonine-protein kinase mTOR OS=Homo sapiens OX=9606 GN=MTOR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	606-UNIMOD:4	0.01	23.0	1	1	1
PRT	sp|O60885|BRD4_HUMAN	Bromodomain-containing protein 4 OS=Homo sapiens OX=9606 GN=BRD4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|P11216|PYGB_HUMAN	Glycogen phosphorylase, brain form OS=Homo sapiens OX=9606 GN=PYGB PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	425-UNIMOD:267,427-UNIMOD:267	0.02	23.0	1	1	1
PRT	sp|Q9Y2R5|RT17_HUMAN	28S ribosomal protein S17, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS17 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	78-UNIMOD:188,87-UNIMOD:188	0.10	23.0	1	1	1
PRT	sp|P84098|RL19_HUMAN	60S ribosomal protein L19 OS=Homo sapiens OX=9606 GN=RPL19 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	144-UNIMOD:188,146-UNIMOD:188	0.06	23.0	1	1	1
PRT	sp|P16403|H12_HUMAN	Histone H1.2 OS=Homo sapiens OX=9606 GN=H1-2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.07	23.0	1	1	1
PRT	sp|Q8WWQ0|PHIP_HUMAN	PH-interacting protein OS=Homo sapiens OX=9606 GN=PHIP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q96ER9|MITOK_HUMAN	Mitochondrial potassium channel OS=Homo sapiens OX=9606 GN=CCDC51 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	48-UNIMOD:267,59-UNIMOD:267	0.03	23.0	1	1	1
PRT	sp|Q8TE67-2|ES8L3_HUMAN	Isoform 2 of Epidermal growth factor receptor kinase substrate 8-like protein 3 OS=Homo sapiens OX=9606 GN=EPS8L3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|P31939-2|PUR9_HUMAN	Isoform 2 of Bifunctional purine biosynthesis protein PURH OS=Homo sapiens OX=9606 GN=ATIC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|P48634|PRC2A_HUMAN	Protein PRRC2A OS=Homo sapiens OX=9606 GN=PRRC2A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.01	23.0	1	1	0
PRT	sp|Q6PJ69|TRI65_HUMAN	Tripartite motif-containing protein 65 OS=Homo sapiens OX=9606 GN=TRIM65 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	284-UNIMOD:4,299-UNIMOD:188,320-UNIMOD:4,323-UNIMOD:267	0.08	23.0	1	1	1
PRT	sp|Q07020|RL18_HUMAN	60S ribosomal protein L18 OS=Homo sapiens OX=9606 GN=RPL18 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	164-UNIMOD:188,168-UNIMOD:267	0.08	23.0	1	1	1
PRT	sp|Q9H6S3|ES8L2_HUMAN	Epidermal growth factor receptor kinase substrate 8-like protein 2 OS=Homo sapiens OX=9606 GN=EPS8L2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	null	194-UNIMOD:28	0.03	23.0	1	1	1
PRT	sp|P00505|AATM_HUMAN	Aspartate aminotransferase, mitochondrial OS=Homo sapiens OX=9606 GN=GOT2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.04	23.0	1	1	0
PRT	sp|Q9Y5E4|PCDB5_HUMAN	Protocadherin beta-5 OS=Homo sapiens OX=9606 GN=PCDHB5 PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	382-UNIMOD:4	0.02	23.0	1	1	1
PRT	sp|Q02224|CENPE_HUMAN	Centromere-associated protein E OS=Homo sapiens OX=9606 GN=CENPE PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	740-UNIMOD:267,750-UNIMOD:188	0.01	23.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	RGEIEELQQCLLHSGPPPPDHPDAAEILR	1	sp|Q9UDT6-2|CLIP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	10-UNIMOD:4	ms_run[2]:scan=8741	62.784	4	3273.6201	3273.6201	R	L	481	510
PSM	MKVVEVLAGHGHLYSR	2	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:35	ms_run[2]:scan=4481	32.114	2	1810.9512	1810.9512	K	I	1240	1256
PSM	SGTRVDHQTGPIVWGEPGTNGQHAFYQLIHQGTK	3	sp|P06744|G6PI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=8109	57.674	4	3715.8244	3715.8244	K	M	367	401
PSM	YRDAGLHCLELGHTGEAGPHAMVR	4	sp|O15067|PUR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	8-UNIMOD:4	ms_run[2]:scan=5266	37.376	3	2646.2544	2646.2544	R	V	968	992
PSM	LAFPSPFGHLSEGFSHSR	5	sp|Q13501-2|SQSTM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	18-UNIMOD:267	ms_run[2]:scan=8783	63.097	2	1981.9674	1981.9674	K	W	82	100
PSM	LNFSHGTHEYHAETIKNVR	6	sp|P14618-2|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=3640	26.358	2	2252.1087	2252.1087	R	T	74	93
PSM	HDVMAHVHTFGHCCPK	7	sp|P30566-2|PUR8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	13-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=2830	20.942	2	1931.8342	1931.8342	R	A	86	102
PSM	KHLEINPDHSIIETLR	8	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=6100	43.054	2	1914.0323	1914.0323	K	Q	632	648
PSM	KYHIDLDPHFNDILGQHSR	9	sp|P19784|CSK22_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=7331	51.877	2	2304.14	2304.1400	K	K	261	280
PSM	MVVNEGSDGGQSVYHVHLHVLGGR	10	sp|P49773|HINT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:35,24-UNIMOD:267	ms_run[2]:scan=5786	40.889	2	2572.248	2572.2480	R	Q	96	120
PSM	THINIVVIGHVDSGK	11	sp|P68104-2|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	15-UNIMOD:188	ms_run[2]:scan=5566	39.392	2	1593.8934	1593.8934	K	S	6	21
PSM	MVVNEGSDGGQSVYHVHLHVLGGR	12	sp|P49773|HINT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:35	ms_run[2]:scan=5791	40.921	3	2562.2398	2562.2398	R	Q	96	120
PSM	RLQCPQVDLFYLHAPDHGTPVEETLHACQR	13	sp|O43488|ARK72_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	4-UNIMOD:4,28-UNIMOD:4	ms_run[2]:scan=7860	55.801	4	3586.7198	3586.7198	K	L	129	159
PSM	TVVTEHALHQHTISTLHWSPR	14	sp|Q8TEQ6|GEMI5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	21-UNIMOD:267	ms_run[2]:scan=5360	38.023	3	2459.2697	2459.2697	K	V	100	121
PSM	ALLNNSHYYHMAHGKDFASR	15	sp|P09622-3|DLDH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=4429	31.744	2	2331.0967	2331.0967	K	G	90	110
PSM	HHEQEMEKHHVPSDFNVNVK	16	sp|Q9C075-2|K1C23_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	8-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=3569	25.9	2	2452.1745	2452.1745	K	V	72	92
PSM	RLQCPQVDLFYLHAPDHGTPVEETLHACQR	17	sp|O43488|ARK72_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:267,4-UNIMOD:4,28-UNIMOD:4,30-UNIMOD:267	ms_run[2]:scan=7862	55.813	4	3606.7363	3606.7363	K	L	129	159
PSM	TLHEWLQQHGIPGLQGVDTR	18	sp|P27708|PYR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=8652	62.05581333333333	2	2284.167699	2284.171263	R	E	103	123
PSM	AISHEHSPSDLEAHFVPLVKR	19	sp|P30153|2AAA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=6084	42.948	2	2368.2288	2368.2288	R	L	114	135
PSM	ALSDHHIYLEGTLLKPNMVTPGHACTQK	20	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	25-UNIMOD:4	ms_run[2]:scan=6807	48.016	3	3130.5692	3130.5692	K	F	216	244
PSM	LNFSHGTHEYHAETIKNVR	21	sp|P14618-2|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=3635	26.329	3	2252.1087	2252.1087	R	T	74	93
PSM	THINIVVIGHVDSGK	22	sp|P68104-2|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=5574	39.445	2	1587.8733	1587.8733	K	S	6	21
PSM	EAEHHCLLHSPIPVNCPIR	23	sp|Q9NUJ1-2|ABHDA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:4,16-UNIMOD:4,19-UNIMOD:267	ms_run[2]:scan=5765	40.751	2	2288.1182	2288.1182	K	L	67	86
PSM	HQHMHDRDDLYAEQMER	24	sp|Q9Y5B9|SP16H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	7-UNIMOD:267,17-UNIMOD:267	ms_run[2]:scan=2933	21.637	2	2229.9547	2229.9547	K	E	754	771
PSM	LAFPSPFGHLSEGFSHSR	25	sp|Q13501-2|SQSTM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=8760	62.923	2	1971.9591	1971.9591	K	W	82	100
PSM	MVVNEGSDGGQSVYHVHLHVLGGR	26	sp|P49773|HINT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:35,24-UNIMOD:267	ms_run[2]:scan=5790	40.916	3	2572.248	2572.2480	R	Q	96	120
PSM	RQEVFSLSQPGGHPHNWTAISR	27	sp|Q9BTX1-4|NDC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:267,22-UNIMOD:267	ms_run[2]:scan=5961	42.088	3	2523.2634	2523.2634	R	E	346	368
PSM	VHHEPQLSDKVHNDAQSFDYDHDAFLGAEEAK	28	sp|O43852-12|CALU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	10-UNIMOD:188,32-UNIMOD:188	ms_run[2]:scan=6231	43.974	3	3660.6908	3660.6908	R	T	28	60
PSM	VKFVHTSVHGVGHSFVQSAFK	29	sp|Q96G03-2|PGM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=5362	38.036	3	2297.2069	2297.2069	K	A	109	130
PSM	YTCHVQHEGLPKPLTLR	30	sp|P04439|HLAA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:4	ms_run[2]:scan=4908	34.994	2	2048.0626	2048.0626	R	W	281	298
PSM	CMQLTDFILKFPHSAHQK	31	sp|P50914|RL14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	1-UNIMOD:4,10-UNIMOD:188,18-UNIMOD:188	ms_run[1]:scan=8889	63.98953	3	2214.144127	2212.132408	K	Y	54	72
PSM	AHHGEAGHHLPEPSSR	32	sp|O76061|STC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	16-UNIMOD:267	ms_run[2]:scan=884	8.2473	2	1727.8116	1727.8116	R	E	237	253
PSM	FAAGHDAEGSHSHVHFDEK	33	sp|Q9GZN8|CT027_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=2316	17.551	2	2076.9038	2076.9038	R	L	17	36
PSM	FKHLEEAFTSEHWLVR	34	sp|Q8TCJ2|STT3B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7462	52.824	2	2028.0217	2028.0217	K	I	753	769
PSM	GTHHGLLANPHSIYSEMWHTQSSR	35	sp|O75027-3|ABCB7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=6549	46.197	3	2745.283	2745.2830	R	V	648	672
PSM	HDVMAHVHTFGHCCPK	36	sp|P30566-2|PUR8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:4,14-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=2823	20.895	2	1937.8543	1937.8543	R	A	86	102
PSM	HLEHSTIIYEDPQHHPLLR	37	sp|P61962|DCAF7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=4907	34.988	2	2334.1869	2334.1869	R	L	208	227
PSM	LKGLGAFVIDSDHLGHR	38	sp|Q13057|COASY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=6917	48.781	2	1833.985	1833.9850	R	A	378	395
PSM	RQEVFSLSQPGGHPHNWTAISR	39	sp|Q9BTX1-4|NDC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=5963	42.101	3	2503.2469	2503.2469	R	E	346	368
PSM	THVDSHGHNVFKER	40	sp|P49736|MCM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=1099	9.5962	2	1661.8023	1661.8023	R	I	205	219
PSM	TIKDVFHNHGIHATTIQPEFASVGSK	41	sp|Q9Y6M5|ZNT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=6518	45.958	2	2833.4511	2833.4511	K	S	402	428
PSM	YREWHHFLVVNMK	42	sp|P30086|PEBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=6268	44.231	2	1757.8824	1757.8824	K	G	81	94
PSM	TLHEWLQQHGIPGLQGVDTR	43	sp|P27708|PYR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	20-UNIMOD:267	ms_run[1]:scan=8650	62.039253333333335	2	2294.180629	2294.179532	R	E	103	123
PSM	AHELKEHNGHITGIDWAPK	44	sp|Q92747|ARC1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=4587	32.814	3	2152.0814	2152.0814	K	S	45	64
PSM	GIHFCHDLVSLCNFHNYDNLR	45	sp|O94925-3|GLSK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	5-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=8148	57.978	3	2630.1907	2630.1907	K	H	514	535
PSM	GYPHLCSICDLPVHSNKEWSQHINGASHSR	46	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	6-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=6264	44.203	3	3485.6106	3485.6106	K	R	288	318
PSM	HKPHDVISHEDGTLWR	47	sp|Q5SRE5-2|NU188_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=3814	27.531	2	1925.9496	1925.9496	K	R	369	385
PSM	KIEHGALVHHSGTITCLK	48	sp|Q9NWT1|PK1IP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	16-UNIMOD:4	ms_run[2]:scan=2862	21.148	2	2000.0626	2000.0626	K	F	72	90
PSM	LNSVQSSERPLFLVHPIEGSTTVFHSLASR	49	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8968	64.652	3	3307.7313	3307.7313	R	L	2234	2264
PSM	MVVNEGSDGGQSVYHVHLHVLGGR	50	sp|P49773|HINT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:35	ms_run[2]:scan=5792	40.928	2	2562.2398	2562.2398	R	Q	96	120
PSM	RLQCPQVDLFYLHAPDHGTPVEETLHACQR	51	sp|O43488|ARK72_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:267,4-UNIMOD:4,28-UNIMOD:4,30-UNIMOD:267	ms_run[2]:scan=7870	55.866	3	3606.7363	3606.7363	K	L	129	159
PSM	TIKDVFHNHGIHATTIQPEFASVGSK	52	sp|Q9Y6M5|ZNT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6517	45.952	3	2833.4511	2833.4511	K	S	402	428
PSM	TMHGHDHNVSSVAIMPNGDHIVSASR	53	sp|P43034-2|LIS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	26-UNIMOD:267	ms_run[2]:scan=4686	33.473	3	2778.2954	2778.2954	R	D	97	123
PSM	VHHEPQLSDKVHNDAQSFDYDHDAFLGAEEAK	54	sp|O43852-12|CALU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6222	43.897	3	3648.6506	3648.6506	R	T	28	60
PSM	VKGHFGPINSVAFHPDGK	55	sp|Q13347|EIF3I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=5191	36.87	2	1918.0252	1918.0252	R	S	281	299
PSM	HLISSLQNHNHQLKGEVLR	56	sp|Q5VTR2|BRE1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=4075	29.327740000000002	2	2222.208313	2222.203232	R	Y	478	497
PSM	CMQLTDFILKFPHSAHQK	57	sp|P50914|RL14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	1-UNIMOD:4	ms_run[1]:scan=8892	64.008075	2	2200.075017	2200.092150	K	Y	54	72
PSM	GHLENNPALEKLLPHIR	58	sp|P05388-2|RLA0_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7431	52.596	2	1950.0799	1950.0799	R	G	67	84
PSM	GVAGAHGLLCLLSDHVDKR	59	sp|Q9UBQ7|GRHPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	10-UNIMOD:4	ms_run[2]:scan=7822	55.478	2	2017.0527	2017.0527	R	I	48	67
PSM	HLEHSTIIYEDPQHHPLLR	60	sp|P61962|DCAF7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	19-UNIMOD:267	ms_run[2]:scan=4897	34.919	3	2344.1952	2344.1952	R	L	208	227
PSM	HLQDFHLNGFDHNFCLK	61	sp|Q96C23|GALM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	15-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=7703	54.621	2	2147.0103	2147.0103	K	G	233	250
PSM	HQKHQAFEAELHANADR	62	sp|Q13813-3|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=2555	19.153	2	2000.9565	2000.9565	K	I	1569	1586
PSM	HRLVLTQEQLHQLHSR	63	sp|Q14203-5|DCTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=3702	26.766	2	1994.0922	1994.0922	R	L	1121	1137
PSM	KHLEINPDHPIVETLR	64	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5354	37.982	2	1910.0374	1910.0374	K	Q	624	640
PSM	LNFSHGTHEYHAETIK	65	sp|P14618-2|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	16-UNIMOD:188	ms_run[2]:scan=3562	25.854	2	1888.9163	1888.9163	R	N	74	90
PSM	MKVVEVLAGHGHLYSR	66	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:35	ms_run[2]:scan=4479	32.102	3	1810.9512	1810.9512	K	I	1240	1256
PSM	SGTRVDHQTGPIVWGEPGTNGQHAFYQLIHQGTK	67	sp|P06744|G6PI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=8103	57.63	3	3715.8244	3715.8244	K	M	367	401
PSM	SLHDPDGLVATYISEVHEHDGHLYLGSFR	68	sp|Q9HDC9|APMAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	29-UNIMOD:267	ms_run[2]:scan=9766	71.35	4	3273.5719	3273.5719	R	S	376	405
PSM	SLHDPDGLVATYISEVHEHDGHLYLGSFR	69	sp|Q9HDC9|APMAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9771	71.385	4	3263.5636	3263.5636	R	S	376	405
PSM	TLTSGGHAEHEGKPYCNHPCYAAMFGPK	70	sp|P50238|CRIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:188,16-UNIMOD:4,20-UNIMOD:4,28-UNIMOD:188	ms_run[2]:scan=4844	34.56	3	3128.4094	3128.4094	K	G	37	65
PSM	VHHEPQLSDKVHNDAQSFDYDHDAFLGAEEAK	71	sp|O43852-12|CALU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6221	43.891	4	3648.6506	3648.6506	R	T	28	60
PSM	VLSAPPHFHFGQTNR	72	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	15-UNIMOD:267	ms_run[2]:scan=5498	38.931	2	1716.8724	1716.8724	R	T	31	46
PSM	CMQLTDFILKFPHSAHQK	73	sp|P50914|RL14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	1-UNIMOD:4,10-UNIMOD:188,18-UNIMOD:188	ms_run[1]:scan=8902	64.08229666666666	2	2212.114574	2212.132408	K	Y	54	72
PSM	HKTGPNLHGLFGR	74	sp|P99999|CYC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=4629	33.10229666666667	2	1432.773314	1432.768766	K	K	27	40
PSM	AHGHCLHEIFLLR	75	sp|O00116|ADAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	5-UNIMOD:4	ms_run[2]:scan=5937	41.925	2	1601.8249	1601.8249	R	E	186	199
PSM	GRPGPVAGHHQMPR	76	sp|O94979-7|SC31A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=988	8.9037	2	1495.7579	1495.7579	K	V	545	559
PSM	HDVMAHVHTFGHCCPK	77	sp|P30566-2|PUR8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:4,14-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=2829	20.936	3	1937.8543	1937.8543	R	A	86	102
PSM	HLEMNPHFGSHR	78	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=3057	22.467	2	1460.6732	1460.6732	K	Y	669	681
PSM	IHFHNLQGEKFYNAGLAYCHSK	79	sp|Q8TC12-2|RDH11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	19-UNIMOD:4	ms_run[2]:scan=5907	41.727	3	2633.2598	2633.2598	R	L	172	194
PSM	KHHLQPENPGPGGAAPSLEQNR	80	sp|Q14684-2|RRP1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=3027	22.272	2	2333.1625	2333.1625	K	G	388	410
PSM	NVMVEPHRHEGVFICR	81	sp|P22087|FBRL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	15-UNIMOD:4	ms_run[2]:scan=4309	30.934	2	1978.9618	1978.9618	K	G	85	101
PSM	NVMVEPHRHEGVFICR	82	sp|P22087|FBRL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	8-UNIMOD:267,15-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=4308	30.928	2	1998.9783	1998.9783	K	G	85	101
PSM	RVPAHGHPVIER	83	sp|Q9NQZ2|SAS10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:267,12-UNIMOD:267	ms_run[2]:scan=1043	9.2507	2	1386.7747	1386.7747	R	L	289	301
PSM	VLSAPPHFHFGQTNR	84	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5501	38.954	2	1706.8641	1706.8641	R	T	31	46
PSM	YRDAGLHCLELGHTGEAGPHAMVR	85	sp|O15067|PUR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	8-UNIMOD:4	ms_run[2]:scan=5267	37.382	4	2646.2544	2646.2544	R	V	968	992
PSM	SGTRVDHQTGPIVWGEPGTNGQHAFYQLIHQGTK	86	sp|P06744|G6PI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	4-UNIMOD:267,34-UNIMOD:188	ms_run[1]:scan=8700	62.457316666666664	3	3732.826760	3731.852788	K	M	367	401
PSM	SGTRVDHQTGPIVWGEPGTNGQHAFYQLIHQGTK	87	sp|P06744|G6PI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=8706	62.50307166666667	3	3716.798267	3715.824390	K	M	367	401
PSM	EAEHHCLLHSPIPVNCPIR	88	sp|Q9NUJ1-2|ABHDA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	6-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=5776	40.822	2	2278.1099	2278.1099	K	L	67	86
PSM	FAAGHDAEGSHSHVHFDEK	89	sp|Q9GZN8|CT027_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	19-UNIMOD:188	ms_run[2]:scan=2323	17.604	2	2082.9239	2082.9239	R	L	17	36
PSM	FHPIQGHRVEVK	90	sp|Q13151|ROA0_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=2397	18.112	2	1445.7892	1445.7892	K	K	160	172
PSM	FKHLEEAFTSEHWLVR	91	sp|Q8TCJ2|STT3B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7461	52.817	3	2028.0217	2028.0217	K	I	753	769
PSM	FLKHWDHLTQVK	92	sp|P30084|ECHM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=4684	33.461	2	1550.8358	1550.8358	K	K	116	128
PSM	GPPQQHGHHNEFDDEFEDDDPLPAIGHCK	93	sp|Q5T0N5-3|FBP1L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	28-UNIMOD:4	ms_run[2]:scan=6725	47.446	3	3337.4119	3337.4119	R	A	458	487
PSM	HFCPNVPIILVGNKK	94	sp|P61586|RHOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:4	ms_run[2]:scan=6879	48.527	3	1734.9603	1734.9603	K	D	105	120
PSM	HHEEEIVHHKK	95	sp|Q9UII2|ATIF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=465	5.5892	2	1421.7164	1421.7164	K	E	73	84
PSM	HLEMNPHFGSHR	96	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:267	ms_run[2]:scan=3067	22.528	2	1470.6814	1470.6814	K	Y	669	681
PSM	HLNEIDLFHCIDPNDSKHK	97	sp|Q15185-3|TEBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	10-UNIMOD:4	ms_run[2]:scan=6746	47.589	2	2331.1066	2331.1066	K	R	49	68
PSM	HQKHQAFEAELHANADR	98	sp|Q13813-3|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=2546	19.094	3	2000.9565	2000.9565	K	I	1569	1586
PSM	HSFDTFSHQRPCLLK	99	sp|P51648|AL3A2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:4	ms_run[2]:scan=5155	36.638	2	1871.9101	1871.9101	K	S	414	429
PSM	KFGLSVGHHLGK	100	sp|P15559-3|NQO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=3604	26.124	2	1278.7197	1278.7197	K	S	213	225
PSM	LLHKYPFILPHQQVDK	101	sp|Q9ULC4-2|MCTS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5768	40.77	2	1975.1044	1975.1044	R	G	72	88
PSM	LLQGRPPLDFYPPGVHPSGLVPR	102	sp|P48634-4|PRC2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	5-UNIMOD:267,23-UNIMOD:267	ms_run[2]:scan=8530	61.035	3	2531.3916	2531.3916	R	E	734	757
PSM	LNSVQSSERPLFLVHPIEGSTTVFHSLASR	103	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	9-UNIMOD:267,30-UNIMOD:267	ms_run[2]:scan=8959	64.578	4	3327.7479	3327.7479	R	L	2234	2264
PSM	LREFFCPEHSECICHICLVEHK	104	sp|Q14258|TRI25_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	6-UNIMOD:4,12-UNIMOD:4,14-UNIMOD:4,17-UNIMOD:4	ms_run[2]:scan=6749	47.611	3	2899.3026	2899.3026	R	T	163	185
PSM	MTEQHFPHPIQSFSPESMPEPLNGPINILGEGR	105	sp|O15067|PUR4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:35	ms_run[2]:scan=9789	71.549	3	3701.7607	3701.7607	R	L	149	182
PSM	NHLLHVFDEYKR	106	sp|P09525-2|ANXA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5452	38.636	2	1569.8052	1569.8052	R	I	121	133
PSM	NLLHHILSGKEFGVER	107	sp|P46020-2|KPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7125	50.344	3	1848.0006	1848.0006	K	S	956	972
PSM	RGEIEELQQCLLHSGPPPPDHPDAAEILR	108	sp|Q9UDT6-2|CLIP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	10-UNIMOD:4	ms_run[2]:scan=8749	62.841	3	3273.6201	3273.6201	R	L	481	510
PSM	TKPFQHHTHDVR	109	sp|Q969X6-2|UTP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=622	6.633	2	1501.7538	1501.7538	R	T	280	292
PSM	TLTVHEKDVIGIAHHPHQNLIATYSEDGLLK	110	sp|Q2TAY7-2|SMU1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	7-UNIMOD:188,31-UNIMOD:188	ms_run[2]:scan=7176	50.71	4	3460.8506	3460.8506	R	L	318	349
PSM	TVRDTLLALHQHGHSGPFESK	111	sp|Q7Z5L9-2|I2BP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5567	39.398	3	2329.1927	2329.1927	K	F	304	325
PSM	VLVHRPHGPELDADPYDPGEEDPAQSR	112	sp|Q9BVI4|NOC4L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5181	36.805	3	2995.406	2995.4060	R	A	403	430
PSM	SVTVVEDDEDEDGDDLLHHHHVSGSRR	113	sp|P02545-2|LMNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=4344	31.161648333333332	3	3054.360995	3054.366347	R	-	546	573
PSM	MREIVHIQAGQCGNQIGAK	114	sp|Q13885|TBB2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	1-UNIMOD:35,2-UNIMOD:267,12-UNIMOD:4,19-UNIMOD:188	ms_run[1]:scan=3900	28.11723333333333	3	2141.087074	2141.080475	-	F	1	20
PSM	ALSDHHIYLEGTLLKPNMVTPGHACTQK	115	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	15-UNIMOD:188,25-UNIMOD:4,28-UNIMOD:188	ms_run[2]:scan=6816	48.078	4	3142.6095	3142.6095	K	F	216	244
PSM	CINHLHKTELHGK	116	sp|Q15424-2|SAFB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:4,7-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=826	7.8856	2	1597.855	1597.8550	K	M	394	407
PSM	CINHLHKTELHGK	117	sp|Q15424-2|SAFB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:4	ms_run[2]:scan=829	7.9024	3	1585.8147	1585.8147	K	M	394	407
PSM	EVLAGRPLFPHVLCHNCAVEFNFGQK	118	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	6-UNIMOD:267,14-UNIMOD:4,17-UNIMOD:4,26-UNIMOD:188	ms_run[2]:scan=8508	60.866	3	3054.5291	3050.5410	K	E	418	444
PSM	GLGTDEDSLIEIICSR	119	sp|P07355-2|ANXA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	14-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=10207	75.439	2	1786.8646	1786.8646	K	T	138	154
PSM	GLPVTCEVAPHHLFLSHDDLER	120	sp|P27708|PYR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	6-UNIMOD:4	ms_run[2]:scan=6853	48.356	3	2541.2434	2541.2434	R	L	1631	1653
PSM	GRPGPVAGHHQMPR	121	sp|O94979-7|SC31A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=989	8.9093	3	1495.7579	1495.7579	K	V	545	559
PSM	HHEEEIVHHKK	122	sp|Q9UII2|ATIF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=466	5.5936	2	1433.7567	1433.7567	K	E	73	84
PSM	HLISSLQNHNHQLKGDAQR	123	sp|O75150-3|BRE1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=2495	18.756	2	2195.1308	2195.1308	R	Y	485	504
PSM	HRDILQDYTHEFHK	124	sp|O95249-2|GOSR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5263	37.353	2	1837.886	1837.8860	R	T	46	60
PSM	LHAEFAAERDWEQFHQPR	125	sp|Q9H773|DCTP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6375	44.964	3	2266.0668	2266.0668	R	N	37	55
PSM	LLHKYPFILPHQQVDK	126	sp|Q9ULC4-2|MCTS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5761	40.722	3	1975.1044	1975.1044	R	G	72	88
PSM	NVHQRPTVALLCGPHVK	127	sp|Q96F86|EDC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:4	ms_run[2]:scan=4417	31.662	2	1925.0418	1925.0418	K	G	330	347
PSM	SIAADHKDLIHDVSFDFHGR	128	sp|Q96EE3|SEH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6782	47.852	2	2279.1083	2279.1083	R	R	6	26
PSM	THVDSHGHNVFKER	129	sp|P49736|MCM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=1106	9.64	3	1661.8023	1661.8023	R	I	205	219
PSM	TLTSGGHAEHEGKPYCNHPCYAAMFGPK	130	sp|P50238|CRIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:188,16-UNIMOD:4,20-UNIMOD:4,28-UNIMOD:188	ms_run[2]:scan=4840	34.532	4	3128.4094	3128.4094	K	G	37	65
PSM	TLTVHEKDVIGIAHHPHQNLIATYSEDGLLK	131	sp|Q2TAY7-2|SMU1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	7-UNIMOD:188,31-UNIMOD:188	ms_run[2]:scan=7190	50.8	3	3460.8506	3460.8506	R	L	318	349
PSM	VKGHFGPINSVAFHPDGK	132	sp|Q13347|EIF3I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=5182	36.811	3	1918.0252	1918.0252	R	S	281	299
PSM	VKGHFGPINSVAFHPDGK	133	sp|Q13347|EIF3I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5189	36.858	3	1905.985	1905.9850	R	S	281	299
PSM	VKGHFGPINSVAFHPDGK	134	sp|Q13347|EIF3I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5203	36.952	2	1905.985	1905.9850	R	S	281	299
PSM	YRGQHVTGSPFQFTVGPLGEGGAHK	135	sp|O75369-7|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7029	49.591	3	2626.3041	2626.3041	K	V	1991	2016
PSM	HQKHQAFEAELHANADR	136	sp|Q13813|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:188,17-UNIMOD:267	ms_run[1]:scan=2541	19.058523333333333	2	2016.983584	2016.984917	K	I	1589	1606
PSM	LHSFESHKDEIFQVQWSPHNETILASSGTDR	137	sp|Q09028|RBBP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=7545	53.43765	3	3594.718001	3594.712774	K	R	310	341
PSM	AHGHCLHEIFLLR	138	sp|O00116|ADAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	5-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=5934	41.907	2	1611.8332	1611.8332	R	E	186	199
PSM	AHGHCLHEIFLLR	139	sp|O00116|ADAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	5-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=5935	41.913	3	1611.8332	1611.8332	R	E	186	199
PSM	DVKPHNVMIDHEHR	140	sp|P68400-2|CSK21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=1890	14.734	2	1725.8369	1725.8369	R	K	20	34
PSM	GRPAPGFHHGDGPGNAVQEIMIPASK	141	sp|Q96AE4|FUBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	21-UNIMOD:35	ms_run[2]:scan=5327	37.798	3	2655.2976	2655.2976	K	A	171	197
PSM	GRPAPGFHHGDGPGNAVQEIMIPASK	142	sp|Q96AE4|FUBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5993	42.303	3	2639.3027	2639.3027	K	A	171	197
PSM	GRPGPVAGHHQMPR	143	sp|O94979-7|SC31A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:267,14-UNIMOD:267	ms_run[2]:scan=991	8.9205	3	1515.7744	1515.7744	K	V	545	559
PSM	GVDEVTIVNILTNR	144	sp|P07355-2|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	14-UNIMOD:267	ms_run[2]:scan=10134	74.723	2	1551.8496	1551.8496	K	S	68	82
PSM	GYPHLCSICDLPVHSNKEWSQHINGASHSR	145	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	6-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=6256	44.146	4	3485.6106	3485.6106	K	R	288	318
PSM	HFHPLFEYFDYESR	146	sp|Q96QK1|VPS35_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8771	63.009	3	1885.8424	1885.8424	K	K	420	434
PSM	HFHPLFEYFDYESR	147	sp|Q96QK1|VPS35_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	14-UNIMOD:267	ms_run[2]:scan=8773	63.025	3	1895.8507	1895.8507	K	K	420	434
PSM	ISGLIYEETR	148	sp|P62805|H4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5800	40.981	2	1179.6136	1179.6136	R	G	47	57
PSM	LHHVSSLAWLDEHTLVTTSHDASVK	149	sp|O75083-3|WDR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	25-UNIMOD:188	ms_run[2]:scan=6976	49.222	4	2788.424	2788.4240	R	E	436	461
PSM	LLHKYPFILPHQQVDK	150	sp|Q9ULC4-2|MCTS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	4-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=5766	40.757	2	1987.1446	1987.1446	R	G	72	88
PSM	LNFSHGTHEYHAETIK	151	sp|P14618-2|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=3568	25.894	2	1882.8962	1882.8962	R	N	74	90
PSM	MEKPPAPPSLPAGPPGVK	152	sp|Q15428|SF3A2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:35	ms_run[2]:scan=5497	38.925	2	1784.9495	1784.9495	K	R	214	232
PSM	MIKPFFHSLSEK	153	sp|P10599|THIO_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:35,3-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=5467	38.731	2	1490.7994	1490.7994	K	Y	37	49
PSM	NLHTHHFPSPLSNNQEVSAFGEDGEGDDLDLWTVR	154	sp|Q9HCN8|SDF2L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9124	65.931	3	3932.799	3932.7990	K	C	114	149
PSM	THINIVVIGHVDSGK	155	sp|P68104-2|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	15-UNIMOD:188	ms_run[2]:scan=5563	39.374	3	1593.8934	1593.8934	K	S	6	21
PSM	TMHGHDHNVSSVAIMPNGDHIVSASR	156	sp|P43034-2|LIS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4678	33.422	3	2768.2871	2768.2871	R	D	97	123
PSM	VHHEPQLSDKVHNDAQSFDYDHDAFLGAEEAK	157	sp|O43852-12|CALU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6211	43.821	5	3648.6506	3648.6506	R	T	28	60
PSM	VLSAPPHFHFGQTNR	158	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	15-UNIMOD:267	ms_run[2]:scan=5647	39.946	2	1716.8724	1716.8724	R	T	31	46
PSM	SVTVVEDDEDEDGDDLLHHHHGSHCSSSGDPAEYNLR	159	sp|P02545|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	25-UNIMOD:4,37-UNIMOD:267	ms_run[1]:scan=5450	38.62430833333333	4	4139.734118	4139.729906	R	S	546	583
PSM	TKPFPWGDGNHTLFHNPHVNPLPTGYEDE	160	sp|P12074|CX6A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=8110	57.679611666666666	3	3315.532041	3315.537376	R	-	81	110
PSM	AREHFINYLTQCHCYHVAEFELPK	161	sp|P78318|IGBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=7936	56.347	4	3061.4327	3061.4327	R	T	105	129
PSM	CEDRPVVFTHLLTADHGPPR	162	sp|Q6P1X6-2|CH082_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:4	ms_run[2]:scan=6612	46.637	4	2316.1433	2316.1433	R	L	99	119
PSM	CINHLHKTELHGK	163	sp|Q15424-2|SAFB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:4	ms_run[2]:scan=827	7.8913	2	1585.8147	1585.8147	K	M	394	407
PSM	DIGTAIQFLHSHNIAHR	164	sp|Q16644|MAPK3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	17-UNIMOD:267	ms_run[2]:scan=7761	55.055	3	1939.0052	1939.0052	R	D	149	166
PSM	DKPHVNVGTIGHVDHGK	165	sp|P49411|EFTU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=2761	20.495	3	1820.9684	1820.9684	R	T	54	71
PSM	GAHNGQGLGNAFLSHISACDGIFHLTR	166	sp|Q9NTK5-3|OLA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	19-UNIMOD:4,27-UNIMOD:267	ms_run[2]:scan=9404	68.342	3	2859.3862	2859.3862	K	A	99	126
PSM	GRPAPGFHHGDGPGNAVQEIMIPASK	167	sp|Q96AE4|FUBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:267,26-UNIMOD:188	ms_run[2]:scan=6028	42.553	3	2655.3311	2651.3429	K	A	171	197
PSM	GVDEVTIVNILTNR	168	sp|P07355-2|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10142	74.783	2	1541.8413	1541.8413	K	S	68	82
PSM	HHSDGSVSLSGHLQPPPVTTEQHGAR	169	sp|O15533-4|TPSN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=4391	31.481	3	2730.3222	2730.3222	R	Y	267	293
PSM	HIKHFILDECDK	170	sp|Q13838|DX39B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:4	ms_run[2]:scan=3828	27.63	2	1553.766	1553.7660	K	M	189	201
PSM	HLEMNPHFGSHR	171	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=3055	22.456	3	1460.6732	1460.6732	K	Y	669	681
PSM	HQHMHDRDDLYAEQMER	172	sp|Q9Y5B9|SP16H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2924	21.573	2	2209.9382	2209.9382	K	E	754	771
PSM	HRLVLTQEQLHQLHSR	173	sp|Q14203-5|DCTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=3697	26.736	3	1994.0922	1994.0922	R	L	1121	1137
PSM	IGGIGTVPVGR	174	sp|P68104-2|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5141	36.548	2	1024.6029	1024.6029	K	V	235	246
PSM	IGIMPGHIHKK	175	sp|P53597|SUCA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=2271	17.258	2	1241.7469	1241.7469	K	G	183	194
PSM	IIFEDDRCLAFHDISPQAPTHFLVIPK	176	sp|P49773|HINT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	8-UNIMOD:4	ms_run[2]:scan=9455	68.75	3	3178.6274	3178.6274	K	K	31	58
PSM	LHHVSSLAWLDEHTLVTTSHDASVK	177	sp|O75083-3|WDR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	25-UNIMOD:188	ms_run[2]:scan=6975	49.216	3	2788.424	2788.4240	R	E	436	461
PSM	LLTHHKDHFTK	178	sp|P78371-2|TCPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=820	7.849	2	1375.7361	1375.7361	K	L	124	135
PSM	RFYPHTHNMDGFFIAK	179	sp|P46087-3|NOP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6068	42.842	2	1979.9465	1979.9465	R	F	564	580
PSM	RQLIVPPHLAHGESGAR	180	sp|Q96AY3-2|FKB10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=3815	27.538	2	1837.0071	1837.0071	R	G	225	242
PSM	SVTVVEDDEDEDGDDLLHHHHGSHCSSSGDPAEYNLR	181	sp|P02545-5|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	25-UNIMOD:4,37-UNIMOD:267	ms_run[2]:scan=5464	38.713	3	4139.7299	4139.7299	R	S	447	484
PSM	TCLVCMASFCQEHLQPHFDSPAFQDHPLQPPVR	182	sp|Q14258|TRI25_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:4,5-UNIMOD:4,10-UNIMOD:4,33-UNIMOD:267	ms_run[2]:scan=8890	63.996	4	3958.8039	3958.8039	K	D	118	151
PSM	VSHITFAHEVGHNFGSPHDSGTECTPGESK	183	sp|O14672-2|ADA10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	24-UNIMOD:4	ms_run[2]:scan=4547	32.551	3	3220.4268	3220.4268	K	N	75	105
PSM	YFLHQSHEEREHAEK	184	sp|P02794|FRIH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=1364	11.322	2	1938.8973	1938.8973	K	L	55	70
PSM	YRGQHVTGSPFQFTVGPLGEGGAHK	185	sp|O75369-7|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:267,25-UNIMOD:188	ms_run[2]:scan=7036	49.641	3	2642.3325	2638.3443	K	V	1991	2016
PSM	SGTRVDHQTGPIVWGEPGTNGQHAFYQLIHQGTK	186	sp|P06744|G6PI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=8709	62.52620166666667	4	3716.802175	3715.824390	K	M	367	401
PSM	HHEEEIVHHKK	187	sp|Q9UII2|ATIF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=467	5.5981716666666665	3	1421.717230	1421.716396	K	E	73	84
PSM	CMQLTDFILKFPHSAHQK	188	sp|P50914|RL14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:385,1-UNIMOD:4,10-UNIMOD:188,18-UNIMOD:188	ms_run[1]:scan=10517	78.62547166666667	3	2195.0872	2195.1052	K	Y	54	72
PSM	LNSVQSSERPLFLVHPIEGSTTVFHSLASR	189	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=8961	64.59499833333332	4	3307.716423	3307.731325	R	L	2234	2264
PSM	DQWEDRIQVWHAEHR	190	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	6-UNIMOD:267,15-UNIMOD:267	ms_run[2]:scan=6323	44.611	2	2023.9516	2023.9516	R	G	166	181
PSM	DQWEDRIQVWHAEHR	191	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6321	44.594	2	2003.9351	2003.9351	R	G	166	181
PSM	EGHPVYPQLRPGYIPIPVLHEGAENR	192	sp|O95817|BAG3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=8337	59.534	4	2937.525	2937.5250	R	Q	81	107
PSM	EVLAGRPLFPHVLCHNCAVEFNFGQK	193	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	14-UNIMOD:4,17-UNIMOD:4	ms_run[2]:scan=8507	60.86	3	3038.5007	3038.5007	K	E	418	444
PSM	FHFGDSLCTHKGEIPALPPCK	194	sp|O75439|MPPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	8-UNIMOD:4,20-UNIMOD:4	ms_run[2]:scan=6721	47.417	3	2410.1562	2410.1562	K	F	258	279
PSM	GAHNGQGLGNAFLSHISACDGIFHLTR	195	sp|Q9NTK5-3|OLA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	19-UNIMOD:4,27-UNIMOD:267	ms_run[2]:scan=9399	68.305	4	2859.3862	2859.3862	K	A	99	126
PSM	GAHNGQGLGNAFLSHISACDGIFHLTR	196	sp|Q9NTK5-3|OLA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	19-UNIMOD:4	ms_run[2]:scan=9409	68.377	4	2849.378	2849.3780	K	A	99	126
PSM	GGRPGGFPDHPHR	197	sp|O00625|PIR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:267,13-UNIMOD:267	ms_run[2]:scan=1377	11.411	2	1405.6867	1405.6867	K	G	47	60
PSM	GRPAPGFHHGDGPGNAVQEIMIPASK	198	sp|Q96AE4|FUBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6034	42.604	2	2639.3027	2639.3027	K	A	171	197
PSM	HAQVHAGGPAPHPCPR	199	sp|Q8NAF0|ZN579_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	14-UNIMOD:4	ms_run[2]:scan=895	8.3148	3	1687.8114	1687.8114	R	C	430	446
PSM	HFHPLFEYFDYESR	200	sp|Q96QK1|VPS35_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	14-UNIMOD:267	ms_run[2]:scan=8777	63.054	2	1895.8507	1895.8507	K	K	420	434
PSM	HFYTFTNEHHR	201	sp|Q9Y2L1|RRP44_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2803	20.766	3	1487.6694	1487.6694	K	E	119	130
PSM	HHEEEIVHHKK	202	sp|Q9UII2|ATIF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=468	5.6025	3	1433.7567	1433.7567	K	E	73	84
PSM	HLEHSTIIYEDPQHHPLLR	203	sp|P61962|DCAF7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4887	34.854	3	2334.1869	2334.1869	R	L	208	227
PSM	HLEMNPHFGSHR	204	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	4-UNIMOD:35	ms_run[2]:scan=1389	11.488	2	1476.6681	1476.6681	K	Y	669	681
PSM	HLHVVHTGK	205	sp|Q92673|SORL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=691	7.0475	2	1026.5723	1026.5723	R	T	1937	1946
PSM	IAHIMGPPDRCEHAAR	206	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:4	ms_run[2]:scan=2641	19.71	2	1829.8777	1829.8777	K	I	369	385
PSM	IAHIMGPPDRCEHAAR	207	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:267,11-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=2643	19.722	2	1849.8943	1849.8943	K	I	369	385
PSM	IHFHNLQGEKFYNAGLAYCHSK	208	sp|Q8TC12-2|RDH11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:188,19-UNIMOD:4,22-UNIMOD:188	ms_run[2]:scan=5902	41.697	3	2645.3	2645.3000	R	L	172	194
PSM	LGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLK	209	sp|P00338-5|LDHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	8-UNIMOD:4	ms_run[2]:scan=9491	69.039	4	3667.8028	3667.8028	R	T	178	213
PSM	LLHKYPFILPHQQVDK	210	sp|Q9ULC4-2|MCTS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	4-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=5775	40.816	3	1987.1446	1987.1446	R	G	72	88
PSM	LLTHHKDHFTK	211	sp|P78371-2|TCPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	6-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=818	7.8381	2	1387.7763	1387.7763	K	L	124	135
PSM	NHLLHVFDEYKR	212	sp|P09525-2|ANXA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5451	38.63	3	1569.8052	1569.8052	R	I	121	133
PSM	NLPLPPPPPPR	213	sp|P61978-3|HNRPK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:267	ms_run[2]:scan=5730	40.511	2	1203.7003	1203.7003	R	G	282	293
PSM	NRPSHVWLCDLPAASLNDQLPQHTFR	214	sp|Q92696|PGTA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:4	ms_run[2]:scan=8316	59.366	4	3071.5148	3071.5148	R	V	294	320
PSM	NVMVEPHRHEGVFICR	215	sp|P22087|FBRL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	8-UNIMOD:267,15-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=4307	30.922	3	1998.9783	1998.9783	K	G	85	101
PSM	RHYNGEAYEDDEHHPR	216	sp|P31689|DNJA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=929	8.5223	3	2023.8521	2023.8521	R	G	374	390
PSM	SIAADHKDLIHDVSFDFHGR	217	sp|Q96EE3|SEH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6779	47.829	3	2279.1083	2279.1083	R	R	6	26
PSM	SIYGEKFEDENFILK	218	sp|P62937-2|PPIA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	6-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=7995	56.824	2	1842.9442	1842.9442	K	H	17	32
PSM	SLHDPDGLVATYISEVHEHDGHLYLGSFR	219	sp|Q9HDC9|APMAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9774	71.409	3	3263.5636	3263.5636	R	S	376	405
PSM	THVDSHGHNVFKER	220	sp|P49736|MCM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:188,14-UNIMOD:267	ms_run[2]:scan=1098	9.5904	2	1677.8306	1673.8425	R	I	205	219
PSM	TLTVHEKDVIGIAHHPHQNLIATYSEDGLLK	221	sp|Q2TAY7-2|SMU1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7179	50.728	3	3448.8103	3448.8103	R	L	318	349
PSM	TVVTEHALHQHTISTLHWSPR	222	sp|Q8TEQ6|GEMI5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	21-UNIMOD:267	ms_run[2]:scan=5367	38.071	4	2459.2697	2459.2697	K	V	100	121
PSM	VLTHFFEREPPAASWAVQPHYQLPTAFR	223	sp|Q8IYS1|P20D2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	8-UNIMOD:267,28-UNIMOD:267	ms_run[1]:scan=9037	65.26825833333334	4	3314.678938	3314.689225	R	A	61	89
PSM	KLPPLPSLTSQPHQVLASEPIPFSDLQQVSR	224	sp|Q6IAA8|LTOR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=9614	70.00328333333334	3	3408.811444	3408.840541	K	I	104	135
PSM	TRFPPEPNGILHIGHAK	225	sp|P47897|SYQ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	2-UNIMOD:267,17-UNIMOD:188	ms_run[1]:scan=6823	48.12483666666667	3	1900.028491	1899.044999	R	A	266	283
PSM	GVAMNPVEHPFGGGNHQHIGKPSTIR	226	sp|P62917|RL8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	21-UNIMOD:188,26-UNIMOD:267	ms_run[1]:scan=4506	32.28046333333334	2	2752.358343	2752.395084	R	R	201	227
PSM	ALSDHHIYLEGTLLKPNMVTPGHACTQK	227	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	15-UNIMOD:188,25-UNIMOD:4,28-UNIMOD:188	ms_run[2]:scan=6815	48.072	3	3142.6095	3142.6095	K	F	216	244
PSM	AREHFINYLTQCHCYHVAEFELPK	228	sp|P78318|IGBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	12-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=7933	56.325	3	3061.4327	3061.4327	R	T	105	129
PSM	DVFLPKPTWGNHTPIFR	229	sp|P00505-2|AATM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8447	60.352	2	2024.0632	2024.0632	R	D	111	128
PSM	EKLCYVALDFEQEMATAASSSSLEK	230	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	2-UNIMOD:188,4-UNIMOD:4,25-UNIMOD:188	ms_run[2]:scan=10541	78.911	3	2818.3444	2818.3444	K	S	214	239
PSM	FQRLFQCLLHR	231	sp|P13010|XRCC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	3-UNIMOD:267,7-UNIMOD:4,11-UNIMOD:267	ms_run[2]:scan=7268	51.378	3	1536.8251	1536.8251	R	A	487	498
PSM	FQRLFQCLLHR	232	sp|P13010|XRCC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	7-UNIMOD:4	ms_run[2]:scan=7274	51.418	3	1516.8085	1516.8085	R	A	487	498
PSM	GFIYVHKPPVHIR	233	sp|Q08945|SSRP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=4738	33.812	2	1561.8882	1561.8882	R	F	358	371
PSM	GVAGAHGLLCLLSDHVDKR	234	sp|Q9UBQ7|GRHPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:4	ms_run[2]:scan=7811	55.398	3	2017.0527	2017.0527	R	I	48	67
PSM	HCADHFLNSEHKEIR	235	sp|P42345|MTOR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	2-UNIMOD:4	ms_run[2]:scan=2462	18.539	2	1891.8748	1891.8748	R	M	605	620
PSM	HFYTFTNEHHR	236	sp|Q9Y2L1|RRP44_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:267	ms_run[2]:scan=2813	20.83	2	1497.6777	1497.6777	K	E	119	130
PSM	HFYTFTNEHHR	237	sp|Q9Y2L1|RRP44_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=2806	20.783	2	1487.6694	1487.6694	K	E	119	130
PSM	HHKSDPYSTGHLR	238	sp|O60885|BRD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=911	8.4115	2	1533.7437	1533.7437	R	E	1048	1061
PSM	HLDHVAALFPGDVDRLR	239	sp|P11216|PYGB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	15-UNIMOD:267,17-UNIMOD:267	ms_run[2]:scan=6877	48.515	3	1950.0339	1950.0339	R	R	411	428
PSM	HVKHELAEIVFK	240	sp|Q9Y2R5|RT17_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	3-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=5018	35.734	2	1460.8542	1460.8542	K	V	76	88
PSM	IGGIGTVPVGR	241	sp|P68104-2|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:267	ms_run[2]:scan=5166	36.709	2	1034.6112	1034.6112	K	V	235	246
PSM	ILMEHIHKLK	242	sp|P84098|RL19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	8-UNIMOD:188,10-UNIMOD:188	ms_run[2]:scan=3419	24.911	2	1272.7779	1272.7779	R	A	137	147
PSM	KASGPPVSELITK	243	sp|P16403|H12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=4942	35.222	3	1325.7555	1325.7555	R	A	34	47
PSM	LHHVSSLAWLDEHTLVTTSHDASVK	244	sp|O75083-3|WDR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6979	49.244	4	2782.4038	2782.4038	R	E	436	461
PSM	MVVNEGSDGGQSVYHVHLHVLGGR	245	sp|P49773|HINT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:35	ms_run[2]:scan=5783	40.87	4	2562.2398	2562.2398	R	Q	96	120
PSM	MVVNEGSDGGQSVYHVHLHVLGGR	246	sp|P49773|HINT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:35,24-UNIMOD:267	ms_run[2]:scan=5789	40.911	4	2572.248	2572.2480	R	Q	96	120
PSM	NHAHEHFLDLGESKK	247	sp|Q8WWQ0|PHIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=3076	22.587	2	1760.8594	1760.8594	K	Q	774	789
PSM	RPEEVALGLHHR	248	sp|Q96ER9|MITOK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:267,12-UNIMOD:267	ms_run[2]:scan=2659	19.829	3	1432.7802	1432.7802	K	L	48	60
PSM	SLHDPDGLVATYISEVHEHDGHLYLGSFR	249	sp|Q9HDC9|APMAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9775	71.416	5	3263.5636	3263.5636	R	S	376	405
PSM	TLEHSLPPSPRPLPR	250	sp|Q8TE67-2|ES8L3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=4456	31.933	2	1695.942	1695.9420	R	H	197	212
PSM	VILHLKEDQTEYLEER	251	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=5978	42.206	3	2014.0371	2014.0371	K	R	181	197
PSM	VKTLHPAVHAGILAR	252	sp|P31939-2|PUR9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=3740	27.007	2	1581.9467	1581.9467	R	N	64	79
PSM	SGTRVDHQTGPIVWGEPGTNGQHAFYQLIHQGTK	253	sp|P06744|G6PI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=8512	60.894981666666666	3	3716.798274	3715.824390	K	M	367	401
PSM	LLQGRPPLDFYPPGVHPSGLVPR	254	sp|P48634|PRC2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=8516	60.924078333333334	3	2511.373145	2511.375049	R	E	734	757
PSM	LCGLLLEEGSHPGAPAKPVDLAPVEAPGPLAPVPSTVCPLR	255	sp|Q6PJ69|TRI65_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	2-UNIMOD:4,17-UNIMOD:188,38-UNIMOD:4,41-UNIMOD:267	ms_run[1]:scan=9499	69.09875333333333	4	4197.197062	4197.230106	R	R	283	324
PSM	HFCPNVPIILVGNKK	256	sp|P61586|RHOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:4,14-UNIMOD:188,15-UNIMOD:188	ms_run[1]:scan=6871	48.47505666666667	3	1748.005037	1747.000589	K	D	105	120
PSM	APGTPHSHTKPYVR	257	sp|Q07020|RL18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	10-UNIMOD:188,14-UNIMOD:267	ms_run[1]:scan=799	7.720103333333334	2	1562.826742	1562.828858	K	S	155	169
PSM	QRQSILPPPQGPAPIPFQHR	258	sp|Q9H6S3|ES8L2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28	ms_run[1]:scan=7359	52.075498333333336	3	2246.2085	2246.2067	R	G	194	214
PSM	DVFLPKPTWGNHTPIFR	259	sp|P00505|AATM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=8444	60.32952333333333	3	2024.062975	2024.063216	R	D	154	171
PSM	MICSIQNDLPFLLKPTLK	260	sp|Q9Y5E4|PCDB5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:4	ms_run[1]:scan=7809	55.385755	2	2131.183355	2130.158105	R	N	380	398
PSM	EVEENEALREEVILLSELK	261	sp|Q02224|CENPE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	9-UNIMOD:267,19-UNIMOD:188	ms_run[1]:scan=9752	71.18936	2	2257.241167	2257.202406	K	S	732	751