MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000208 -- new
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220618\20220618002634800212^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\111222_HL22.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220618\20220618002634800212^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\111222_HL22.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Acetyl (Protein N-term),Label:13C(6) (K),Label:13C(6)15N(4) (R),Oxidation (M)
MTD	software[1]-setting	maxMissedCleavages=1
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=40
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Label:13C(6) (K),Label:13C(6)15N(4) (R),Acetyl (Protein N-term)
MTD	software[2]-setting	TOL(-)=20
MTD	software[2]-setting	TOL(+)=20
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=1000
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=1
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Acetyl (Protein N-term),Label:13C(6) (K),Label:13C(6)15N(4) (R),Oxidation (M)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=1
MTD	software[3]-setting	peptide_mass_tolerance=20
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:1, Acetyl,]
MTD	variable_mod[1]-site	N-term
MTD	variable_mod[1]-position	Protein N-term
MTD	variable_mod[2]	[UNIMOD, UNIMOD:188, Label:13C(6),]
MTD	variable_mod[2]-site	K
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:267, Label:13C(6)15N(4),]
MTD	variable_mod[3]-site	R
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[4]-site	M
MTD	variable_mod[4]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|Q15102|PA1B3_HUMAN	Platelet-activating factor acetylhydrolase IB subunit gamma OS=Homo sapiens OX=9606 GN=PAFAH1B3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	43.0	null	198-UNIMOD:267	0.13	43.0	5	1	0
PRT	sp|P00441|SODC_HUMAN	Superoxide dismutase [Cu-Zn] OS=Homo sapiens OX=9606 GN=SOD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	58-UNIMOD:4,70-UNIMOD:267	0.22	43.0	5	1	0
PRT	sp|Q7KZF4|SND1_HUMAN	Staphylococcal nuclease domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SND1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	193-UNIMOD:188,203-UNIMOD:267	0.02	41.0	5	1	0
PRT	sp|P23246|SFPQ_HUMAN	Splicing factor, proline- and glutamine-rich OS=Homo sapiens OX=9606 GN=SFPQ PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	null	246-UNIMOD:28,267-UNIMOD:267,271-UNIMOD:188	0.04	37.0	6	2	0
PRT	sp|Q9HBH1|DEFM_HUMAN	Peptide deformylase, mitochondrial OS=Homo sapiens OX=9606 GN=PDF PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	68-UNIMOD:4	0.10	35.0	1	1	1
PRT	sp|P31942-6|HNRH3_HUMAN	Isoform 6 of Heterogeneous nuclear ribonucleoprotein H3 OS=Homo sapiens OX=9606 GN=HNRNPH3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	63-UNIMOD:267	0.19	34.0	4	1	0
PRT	sp|Q9BZE1|RM37_HUMAN	39S ribosomal protein L37, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL37 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	104-UNIMOD:4	0.05	34.0	1	1	1
PRT	sp|Q99613-2|EIF3C_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit C OS=Homo sapiens OX=9606 GN=EIF3C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	557-UNIMOD:4,561-UNIMOD:4,571-UNIMOD:267	0.02	33.0	4	1	0
PRT	sp|P68104-2|EF1A1_HUMAN	Isoform 2 of Elongation factor 1-alpha 1 OS=Homo sapiens OX=9606 GN=EEF1A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	20-UNIMOD:188	0.06	33.0	4	2	1
PRT	sp|P55795|HNRH2_HUMAN	Heterogeneous nuclear ribonucleoprotein H2 OS=Homo sapiens OX=9606 GN=HNRNPH2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	167-UNIMOD:188	0.04	32.0	2	1	0
PRT	sp|Q14204|DYHC1_HUMAN	Cytoplasmic dynein 1 heavy chain 1 OS=Homo sapiens OX=9606 GN=DYNC1H1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	2589-UNIMOD:188,2594-UNIMOD:4,2601-UNIMOD:188	0.01	31.0	3	2	1
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	217-UNIMOD:4,238-UNIMOD:188,215-UNIMOD:188	0.07	31.0	3	2	1
PRT	sp|Q9HCC0-2|MCCB_HUMAN	Isoform 2 of Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial OS=Homo sapiens OX=9606 GN=MCCC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.04	30.0	1	1	1
PRT	sp|Q68EM7-7|RHG17_HUMAN	Isoform 7 of Rho GTPase-activating protein 17 OS=Homo sapiens OX=9606 GN=ARHGAP17	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.08	30.0	1	1	1
PRT	sp|Q99613|EIF3C_HUMAN	Eukaryotic translation initiation factor 3 subunit C OS=Homo sapiens OX=9606 GN=EIF3C PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	567-UNIMOD:4,571-UNIMOD:4,565-UNIMOD:267,581-UNIMOD:267	0.02	30.0	3	1	0
PRT	sp|P52272|HNRPM_HUMAN	Heterogeneous nuclear ribonucleoprotein M OS=Homo sapiens OX=9606 GN=HNRNPM PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	306-UNIMOD:35,293-UNIMOD:267,322-UNIMOD:188	0.05	29.0	2	1	0
PRT	sp|Q00839|HNRPU_HUMAN	Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU PE=1 SV=6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	450-UNIMOD:4,453-UNIMOD:4	0.03	29.0	1	1	1
PRT	sp|Q8WVV9|HNRLL_HUMAN	Heterogeneous nuclear ribonucleoprotein L-like OS=Homo sapiens OX=9606 GN=HNRNPLL PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	null	276-UNIMOD:28,287-UNIMOD:267,303-UNIMOD:267	0.05	29.0	2	1	0
PRT	sp|P61313|RL15_HUMAN	60S ribosomal protein L15 OS=Homo sapiens OX=9606 GN=RPL15 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.06	28.0	1	1	1
PRT	sp|P33240-2|CSTF2_HUMAN	Isoform 2 of Cleavage stimulation factor subunit 2 OS=Homo sapiens OX=9606 GN=CSTF2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	348-UNIMOD:267	0.04	28.0	3	1	0
PRT	sp|Q9UII2|ATIF1_HUMAN	ATPase inhibitor, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5IF1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	82-UNIMOD:188,83-UNIMOD:188	0.11	28.0	4	1	0
PRT	sp|P52272-2|HNRPM_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein M OS=Homo sapiens OX=9606 GN=HNRNPM	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.05	27.0	2	1	0
PRT	sp|P07355-2|ANXA2_HUMAN	Isoform 2 of Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	81-UNIMOD:267	0.04	27.0	3	1	0
PRT	sp|Q96QK1|VPS35_HUMAN	Vacuolar protein sorting-associated protein 35 OS=Homo sapiens OX=9606 GN=VPS35 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null		0.02	27.0	2	1	0
PRT	sp|P23246-2|SFPQ_HUMAN	Isoform Short of Splicing factor, proline- and glutamine-rich OS=Homo sapiens OX=9606 GN=SFPQ	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	0
PRT	sp|Q9NZB2-4|F120A_HUMAN	Isoform D of Constitutive coactivator of PPAR-gamma-like protein 1 OS=Homo sapiens OX=9606 GN=FAM120A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	873-UNIMOD:267	0.02	27.0	1	1	1
PRT	sp|P32322|P5CR1_HUMAN	Pyrroline-5-carboxylate reductase 1, mitochondrial OS=Homo sapiens OX=9606 GN=PYCR1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	216-UNIMOD:35	0.12	27.0	2	1	0
PRT	sp|Q13435|SF3B2_HUMAN	Splicing factor 3B subunit 2 OS=Homo sapiens OX=9606 GN=SF3B2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1,10-UNIMOD:188,35-UNIMOD:188	0.04	26.0	2	1	0
PRT	sp|P62841|RS15_HUMAN	40S ribosomal protein S15 OS=Homo sapiens OX=9606 GN=RPS15 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.10	26.0	1	1	1
PRT	sp|P08621-3|RU17_HUMAN	Isoform 3 of U1 small nuclear ribonucleoprotein 70 kDa OS=Homo sapiens OX=9606 GN=SNRNP70	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	39-UNIMOD:4	0.12	26.0	1	1	1
PRT	sp|P12074|CX6A1_HUMAN	Cytochrome c oxidase subunit 6A1, mitochondrial OS=Homo sapiens OX=9606 GN=COX6A1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.17	26.0	1	1	1
PRT	sp|Q92733|PRCC_HUMAN	Proline-rich protein PRCC OS=Homo sapiens OX=9606 GN=PRCC PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	137-UNIMOD:188,139-UNIMOD:188	0.05	26.0	2	1	0
PRT	sp|Q16576|RBBP7_HUMAN	Histone-binding protein RBBP7 OS=Homo sapiens OX=9606 GN=RBBP7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.08	25.0	1	1	1
PRT	sp|P60709|ACTB_HUMAN	Actin, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=ACTB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	217-UNIMOD:4,238-UNIMOD:188	0.06	25.0	1	1	0
PRT	sp|P30566-2|PUR8_HUMAN	Isoform 2 of Adenylosuccinate lyase OS=Homo sapiens OX=9606 GN=ADSL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	98-UNIMOD:4,99-UNIMOD:4	0.04	24.0	1	1	1
PRT	sp|Q9Y316-2|MEMO1_HUMAN	Isoform 2 of Protein MEMO1 OS=Homo sapiens OX=9606 GN=MEMO1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	50-UNIMOD:267,64-UNIMOD:267	0.06	24.0	1	1	1
PRT	sp|P14866-2|HNRPL_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein L OS=Homo sapiens OX=9606 GN=HNRNPL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.08	24.0	1	1	1
PRT	sp|P48506|GSH1_HUMAN	Glutamate--cysteine ligase catalytic subunit OS=Homo sapiens OX=9606 GN=GCLC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	2	1	0
PRT	sp|O75880|SCO1_HUMAN	Protein SCO1 homolog, mitochondrial OS=Homo sapiens OX=9606 GN=SCO1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.07	23.0	1	1	1
PRT	sp|Q969G9|NKD1_HUMAN	Protein naked cuticle homolog 1 OS=Homo sapiens OX=9606 GN=NKD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.07	23.0	1	1	1
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q9NNW7-4|TRXR2_HUMAN	Isoform 4 of Thioredoxin reductase 2, mitochondrial OS=Homo sapiens OX=9606 GN=TXNRD2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.09	22.0	1	1	1
PRT	sp|Q8WV99-2|ZFN2B_HUMAN	Isoform 2 of AN1-type zinc finger protein 2B OS=Homo sapiens OX=9606 GN=ZFAND2B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null	134-UNIMOD:4	0.11	22.0	1	1	1
PRT	sp|Q14671-4|PUM1_HUMAN	Isoform 4 of Pumilio homolog 1 OS=Homo sapiens OX=9606 GN=PUM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	2	1	0
PRT	sp|Q8IUW5|RELL1_HUMAN	RELT-like protein 1 OS=Homo sapiens OX=9606 GN=RELL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null	176-UNIMOD:4,189-UNIMOD:267	0.06	22.0	1	1	1
PRT	sp|P12270|TPR_HUMAN	Nucleoprotein TPR OS=Homo sapiens OX=9606 GN=TPR PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null	2076-UNIMOD:267,2084-UNIMOD:267	0.00	22.0	1	1	1
PRT	sp|P63104|1433Z_HUMAN	14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null	41-UNIMOD:267	0.06	22.0	1	1	1
PRT	sp|Q9BW19|KIFC1_HUMAN	Kinesin-like protein KIFC1 OS=Homo sapiens OX=9606 GN=KIFC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.05	22.0	1	1	1
PRT	sp|O00391|QSOX1_HUMAN	Sulfhydryl oxidase 1 OS=Homo sapiens OX=9606 GN=QSOX1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	129-UNIMOD:188,147-UNIMOD:267	0.03	22.0	1	1	1
PRT	sp|P27708|PYR1_HUMAN	CAD protein OS=Homo sapiens OX=9606 GN=CAD PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null	1636-UNIMOD:4	0.01	21.0	1	1	1
PRT	sp|O00159-2|MYO1C_HUMAN	Isoform 2 of Unconventional myosin-Ic OS=Homo sapiens OX=9606 GN=MYO1C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null	492-UNIMOD:188	0.01	21.0	1	1	1
PRT	sp|O75400-2|PR40A_HUMAN	Isoform 2 of Pre-mRNA-processing factor 40 homolog A OS=Homo sapiens OX=9606 GN=PRPF40A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null	777-UNIMOD:4	0.02	21.0	1	1	1
PRT	sp|Q02809|PLOD1_HUMAN	Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 OS=Homo sapiens OX=9606 GN=PLOD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null	330-UNIMOD:188	0.02	21.0	1	1	1
PRT	sp|P32322-2|P5CR1_HUMAN	Isoform 2 of Pyrroline-5-carboxylate reductase 1, mitochondrial OS=Homo sapiens OX=9606 GN=PYCR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.12	21.0	1	1	0
PRT	sp|Q9BX66-7|SRBS1_HUMAN	Isoform 7 of Sorbin and SH3 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SORBS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null	589-UNIMOD:267,605-UNIMOD:267	0.03	21.0	1	1	1
PRT	sp|P07437|TBB5_HUMAN	Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.06	21.0	1	1	1
PRT	sp|Q8TF74-2|WIPF2_HUMAN	Isoform 2 of WAS/WASL-interacting protein family member 2 OS=Homo sapiens OX=9606 GN=WIPF2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null	229-UNIMOD:267	0.05	21.0	1	1	1
PRT	sp|P11274|BCR_HUMAN	Breakpoint cluster region protein OS=Homo sapiens OX=9606 GN=BCR PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	1213-UNIMOD:267	0.02	21.0	1	1	1
PRT	sp|Q9HBX9|RXFP1_HUMAN	Relaxin receptor 1 OS=Homo sapiens OX=9606 GN=RXFP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	420-UNIMOD:4,428-UNIMOD:4,429-UNIMOD:35,434-UNIMOD:267	0.03	21.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	AHFLDADPGFVHSDGTISHHDMYDYLHLSR	1	sp|Q15102|PA1B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	30-UNIMOD:267	ms_run[2]:scan=7448	58.431	3	3462.5715	3462.5715	R	L	169	199
PSM	GLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSR	2	sp|P00441|SODC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	21-UNIMOD:4	ms_run[2]:scan=6850	53.172	3	3518.6174	3518.6174	K	K	38	71
PSM	GLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSR	3	sp|P00441|SODC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	21-UNIMOD:4	ms_run[2]:scan=6849	53.166	4	3518.6174	3518.6174	K	K	38	71
PSM	HFVDSHHQKPVNAIIEHVR	4	sp|Q7KZF4|SND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=3714	29.194	2	2262.177	2262.1770	R	D	185	204
PSM	QHHPPYHQQHHQGPPPGGPGGR	5	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:28,22-UNIMOD:267	ms_run[1]:scan=724	7.245551666666667	3	2395.1088	2395.1090	R	S	246	268
PSM	GLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSR	6	sp|P00441|SODC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	21-UNIMOD:4,33-UNIMOD:267	ms_run[2]:scan=6848	53.161	4	3528.6257	3528.6257	K	K	38	71
PSM	QHHPPYHQQHHQGPPPGGPGGR	7	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:28	ms_run[1]:scan=709	7.145208333333333	2	2385.0992	2385.1007	R	S	246	268
PSM	RLVLGPPEPPFSHVCQVGDPVLR	8	sp|Q9HBH1|DEFM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	15-UNIMOD:4	ms_run[1]:scan=7549	59.28171333333333	3	2568.376819	2568.363498	R	G	54	77
PSM	GLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSR	9	sp|P00441|SODC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	21-UNIMOD:4,33-UNIMOD:267	ms_run[2]:scan=6845	53.139	3	3528.6257	3528.6257	K	K	38	71
PSM	GMGGHGYGGAGDASSGFHGGHFVHMR	10	sp|P31942-6|HNRH3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=4125	32.07	3	2542.0767	2542.0767	R	G	38	64
PSM	SPPLHEHPLYKDQACYIFHHR	11	sp|Q9BZE1|RM37_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	15-UNIMOD:4	ms_run[2]:scan=4609	35.611	3	2644.2757	2644.2757	R	C	90	111
PSM	TCAILCHIYHHALHSR	12	sp|Q99613-2|EIF3C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:4,6-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=5061	38.906	2	1997.9704	1997.9704	R	W	556	572
PSM	THINIVVIGHVDSGK	13	sp|P68104-2|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=5223	40.072	2	1587.8733	1587.8733	K	S	6	21
PSM	HFVDSHHQKPVNAIIEHVR	14	sp|Q7KZF4|SND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=3712	29.183	3	2262.177	2262.1770	R	D	185	204
PSM	HFVDSHHQKPVNAIIEHVR	15	sp|Q7KZF4|SND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=3713	29.189	4	2262.177	2262.1770	R	D	185	204
PSM	STGEAFVQFASQEIAEK	16	sp|P55795|HNRH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=8337	66.716	2	1840.8843	1840.8843	R	A	151	168
PSM	GMGGHGYGGAGDASSGFHGGHFVHMR	17	sp|P31942-6|HNRH3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	26-UNIMOD:267	ms_run[2]:scan=4127	32.082	3	2552.085	2552.0850	R	G	38	64
PSM	HEALLYTWLAEHKPLVLCGPPGSGK	18	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:188,18-UNIMOD:4,25-UNIMOD:188	ms_run[2]:scan=8669	70.225	4	2784.4824	2784.4824	R	T	2577	2602
PSM	LCYVALDFEQEMATAASSSSLEK	19	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:4,23-UNIMOD:188	ms_run[2]:scan=9476	79.744	2	2555.1867	2555.1867	K	S	216	239
PSM	STGEAFVQFASQEIAEK	20	sp|P55795|HNRH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	17-UNIMOD:188	ms_run[2]:scan=8330	66.663	2	1846.9044	1846.9044	R	A	151	168
PSM	TCAILCHIYHHALHSR	21	sp|Q99613-2|EIF3C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:4,6-UNIMOD:4	ms_run[2]:scan=5057	38.876	2	1987.9621	1987.9621	R	W	556	572
PSM	EKLCYVALDFEQEMATAASSSSLEK	22	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:188,4-UNIMOD:4,25-UNIMOD:188	ms_run[2]:scan=9391	78.529	3	2818.3444	2818.3444	K	S	214	239
PSM	KSGVSDHWALDDHHALHLTR	23	sp|Q9HCC0-2|MCCB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=4751	36.604	3	2294.1305	2294.1305	R	K	231	251
PSM	NRPSVPPPPQPPGVHSAGDSSLTNTAPTASK	24	sp|Q68EM7-7|RHG17_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=4643	35.841	3	3063.5374	3063.5374	R	I	338	369
PSM	IRTCAILCHIYHHALHSR	25	sp|Q99613|EIF3C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	4-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=5310	40.73213	4	2257.147230	2257.147315	R	W	564	582
PSM	AHFLDADPGFVHSDGTISHHDMYDYLHLSR	26	sp|Q15102|PA1B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7444	58.402	3	3452.5633	3452.5633	R	L	169	199
PSM	GLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSR	27	sp|P00441|SODC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	21-UNIMOD:4	ms_run[2]:scan=6860	53.269	2	3518.6174	3518.6174	K	K	38	71
PSM	HFVDSHHQKPVNAIIEHVR	28	sp|Q7KZF4|SND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=3716	29.207	5	2262.177	2262.1770	R	D	185	204
PSM	THINIVVIGHVDSGK	29	sp|P68104-2|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	15-UNIMOD:188	ms_run[2]:scan=5226	40.095	3	1593.8934	1593.8934	K	S	6	21
PSM	GDFFPPERPQQLPHGLGGIGMGLGPGGQPIDANHLNK	30	sp|P52272|HNRPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	21-UNIMOD:35	ms_run[1]:scan=7390	57.912215	4	3833.923169	3833.906012	K	G	286	323
PSM	EVLAGRPLFPHVLCHNCAVEFNFGQK	31	sp|Q00839|HNRPU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	14-UNIMOD:4,17-UNIMOD:4	ms_run[1]:scan=7741	61.11270833333334	3	3038.500629	3038.500737	K	E	437	463
PSM	QAILGEHPSSFRHDGYGSHGPLLPLPSR	32	sp|Q8WVV9|HNRLL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:28,12-UNIMOD:267,28-UNIMOD:267	ms_run[1]:scan=7054	54.87477833333333	3	3027.5332	3027.5212	R	Y	276	304
PSM	GHKFHHTIGGSR	33	sp|P61313|RL15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=600	6.4432	2	1332.68	1332.6800	K	R	177	189
PSM	GYLGPPHQGPPMHHVPGHESR	34	sp|P33240-2|CSTF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=2910	23.272	2	2286.0865	2286.0865	R	G	328	349
PSM	HFVDSHHQKPVNAIIEHVR	35	sp|Q7KZF4|SND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	9-UNIMOD:188,19-UNIMOD:267	ms_run[2]:scan=3721	29.243	2	2278.2054	2274.2173	R	D	185	204
PSM	HHEEEIVHHKK	36	sp|Q9UII2|ATIF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=436	5.406	2	1421.7164	1421.7164	K	E	73	84
PSM	IRTCAILCHIYHHALHSR	37	sp|Q99613|EIF3C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	2-UNIMOD:267,4-UNIMOD:4,8-UNIMOD:4,18-UNIMOD:267	ms_run[1]:scan=5309	40.725955	4	2277.163314	2277.163853	R	W	564	582
PSM	GDFFPPERPQQLPHGLGGIGMGLGPGGQPIDANHLNK	38	sp|P52272|HNRPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	8-UNIMOD:267,21-UNIMOD:35,37-UNIMOD:188	ms_run[1]:scan=7385	57.87831833333333	4	3850.950746	3849.934410	K	G	286	323
PSM	AHFLDADPGFVHSDGTISHHDMYDYLHLSR	39	sp|Q15102|PA1B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	30-UNIMOD:267	ms_run[1]:scan=7441	58.37944	4	3462.588621	3462.571542	R	L	169	199
PSM	GDFFPPERPQQLPHGLGGIGMGLGPGGQPIDANHLNK	40	sp|P52272-2|HNRPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7824	61.902	3	3817.9111	3817.9111	K	G	247	284
PSM	GVDEVTIVNILTNR	41	sp|P07355-2|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	14-UNIMOD:267	ms_run[2]:scan=9080	74.672	2	1551.8496	1551.8496	K	S	68	82
PSM	HFHPLFEYFDYESRK	42	sp|Q96QK1|VPS35_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7249	56.643	2	2013.9373	2013.9373	K	S	420	435
PSM	HHEEEIVHHKK	43	sp|Q9UII2|ATIF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=437	5.4106	2	1433.7567	1433.7567	K	E	73	84
PSM	QHHPPYHQQHHQGPPPGGPGGR	44	sp|P23246-2|SFPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=562	6.2052	3	2402.1278	2402.1278	R	S	246	268
PSM	QSHTLPFPPPPALPFYPASAYPR	45	sp|Q9NZB2-4|F120A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	23-UNIMOD:267	ms_run[2]:scan=8998	73.692	3	2560.3142	2560.3142	R	H	851	874
PSM	MLLHSEQHPGQLKDNVSSPGGATIHALHVLESGGFR	46	sp|P32322|P5CR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:35	ms_run[1]:scan=7338	57.45914166666666	3	3834.938467	3834.922390	K	S	216	252
PSM	ATEHPEPPKAELQLPPPPPPGHYGAWAAQELQAK	47	sp|Q13435|SF3B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:1,9-UNIMOD:188,34-UNIMOD:188	ms_run[2]:scan=7780	61.533	3	3705.8982	3705.8982	M	L	2	36
PSM	GMGGHGYGGAGDASSGFHGGHFVHMR	48	sp|P31942-6|HNRH3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4138	32.158	2	2542.0767	2542.0767	R	G	38	64
PSM	HGRPGIGATHSSR	49	sp|P62841|RS15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=553	6.1482	2	1331.6807	1331.6807	K	F	128	141
PSM	LPHEKHHNQPYCGIAPYIR	50	sp|P08621-3|RU17_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:4	ms_run[2]:scan=4312	33.408	2	2329.1538	2329.1538	K	E	28	47
PSM	SHHGEHERPEFIAYPHLR	51	sp|P12074|CX6A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4265	33.086	2	2211.0722	2211.0722	K	I	61	79
PSM	GPGLNLPPPIGGAGPPLGLPKPK	52	sp|Q92733|PRCC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=8134	64.83654333333334	3	2143.251465	2143.251746	R	K	117	140
PSM	HEALLYTWLAEHKPLVLCGPPGSGK	53	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	18-UNIMOD:4	ms_run[2]:scan=8672	70.26	4	2772.4421	2772.4421	R	T	2577	2602
PSM	LHTFESHKDEIFQVHWSPHNETILASSGTDR	54	sp|Q16576|RBBP7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6557	50.571	3	3617.7288	3617.7288	K	R	309	340
PSM	THINIVVIGHVDSGK	55	sp|P68104-2|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5232	40.135	3	1587.8733	1587.8733	K	S	6	21
PSM	LCYVALDFEQEMATAASSSSLEK	56	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	2-UNIMOD:4,23-UNIMOD:188	ms_run[1]:scan=9471	79.69141833333333	3	2555.185221	2555.186686	K	S	216	239
PSM	QHHPPYHQQHHQGPPPGGPGGR	57	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28	ms_run[1]:scan=673	6.913010000000001	3	2385.1005	2385.1007	R	S	246	268
PSM	AHFLDADPGFVHSDGTISHHDMYDYLHLSR	58	sp|Q15102|PA1B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=7440	58.37330166666667	4	3452.580222	3452.563273	R	L	169	199
PSM	QAILGEHPSSFRHDGYGSHGPLLPLPSR	59	sp|Q8WVV9|HNRLL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28	ms_run[1]:scan=7042	54.763169999999995	3	3007.5182	3007.5052	R	Y	276	304
PSM	HFHPLFEYFDYESRK	60	sp|Q96QK1|VPS35_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=7230	56.45186333333333	3	2013.948253	2013.937347	K	S	420	435
PSM	GYLGPPHQGPPMHHVPGHESR	61	sp|P33240-2|CSTF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	21-UNIMOD:267	ms_run[2]:scan=2895	23.17	3	2296.0948	2296.0948	R	G	328	349
PSM	LRHDVMAHVHTFGHCCPK	62	sp|P30566-2|PUR8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	15-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=3047	24.293	3	2201.0193	2201.0193	R	A	84	102
PSM	RIFILGPSHHVPLSR	63	sp|Q9Y316-2|MEMO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:267,15-UNIMOD:267	ms_run[2]:scan=5113	39.276	3	1748.0113	1748.0113	R	C	50	65
PSM	YGPQYGHPPPPPPPPEYGPHADSPVLMVYGLDQSK	64	sp|P14866-2|HNRPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7766	61.375	4	3783.8032	3783.8032	R	M	226	261
PSM	IRTCAILCHIYHHALHSR	65	sp|Q99613|EIF3C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	2-UNIMOD:267,4-UNIMOD:4,8-UNIMOD:4,18-UNIMOD:267	ms_run[1]:scan=5312	40.74439666666667	3	2277.163750	2277.163853	R	W	564	582
PSM	AHFLDADPGFVHSDGTISHHDMYDYLHLSR	66	sp|Q15102|PA1B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=7442	58.38559333333333	5	3452.581602	3452.563273	R	L	169	199
PSM	GDFFPPERPQQLPHGLGGIGMGLGPGGQPIDANHLNK	67	sp|P52272-2|HNRPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=7816	61.845	4	3817.9111	3817.9111	K	G	247	284
PSM	GMGGHGYGGAGDASSGFHGGHFVHMR	68	sp|P31942-6|HNRH3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	26-UNIMOD:267	ms_run[2]:scan=4131	32.112	4	2552.085	2552.0850	R	G	38	64
PSM	GYLGPPHQGPPMHHVPGHESR	69	sp|P33240-2|CSTF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	21-UNIMOD:267	ms_run[2]:scan=2911	23.278	2	2296.0948	2296.0948	R	G	328	349
PSM	HGILQFLHIYHAVKDR	70	sp|P48506|GSH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6632	51.223	4	1946.0639	1946.0639	R	H	25	41
PSM	HHEEEIVHHKK	71	sp|Q9UII2|ATIF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=438	5.4153	3	1421.7164	1421.7164	K	E	73	84
PSM	HIGKPLLGGPFSLTTHTGER	72	sp|O75880|SCO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=5877	45.182	3	2117.1382	2117.1382	R	K	130	150
PSM	LCYVALDFEQEMATAASSSSLEK	73	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	2-UNIMOD:4	ms_run[2]:scan=9474	79.726	2	2549.1666	2549.1666	K	S	216	239
PSM	NKPPLGPAIPAVSPSAHLAASPALLPSLAPLGHK	74	sp|Q969G9|NKD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8251	66.03	3	3288.8711	3288.8711	R	K	367	401
PSM	TCAILCHIYHHALHSR	75	sp|Q99613-2|EIF3C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	2-UNIMOD:4,6-UNIMOD:4	ms_run[2]:scan=5055	38.864	3	1987.9621	1987.9621	R	W	556	572
PSM	QHHPPYHQQHHQGPPPGGPGGRSEEK	76	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28,22-UNIMOD:267,26-UNIMOD:188	ms_run[1]:scan=670	6.895033333333333	4	2874.3395	2874.3413	R	I	246	272
PSM	GGNVGINSFGFGGSNVHIILRPNTQPPPAPAPHATLPR	77	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=7516	58.98289166666666	4	3857.043259	3857.023759	R	L	385	423
PSM	GPGLNLPPPIGGAGPPLGLPKPK	78	sp|Q92733|PRCC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	21-UNIMOD:188,23-UNIMOD:188	ms_run[1]:scan=8146	64.94599833333332	3	2155.291703	2155.292004	R	K	117	140
PSM	ATEHPEPPKAELQLPPPPPPGHYGAWAAQELQAK	79	sp|Q13435|SF3B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:1	ms_run[2]:scan=7756	61.265	4	3693.858	3693.8580	M	L	2	36
PSM	GVDEVTIVNILTNR	80	sp|P07355-2|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	14-UNIMOD:267	ms_run[2]:scan=9088	74.731	3	1551.8496	1551.8496	K	S	68	82
PSM	HGILQFLHIYHAVKDR	81	sp|P48506|GSH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=6622	51.129	3	1946.0639	1946.0639	R	H	25	41
PSM	HGQEHVEVYHAHYKPLEFTVAGR	82	sp|Q9NNW7-4|TRXR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=4932	37.944	3	2703.3306	2703.3306	R	D	172	195
PSM	HHEEEIVHHKK	83	sp|Q9UII2|ATIF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	10-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=439	5.4198	3	1433.7567	1433.7567	K	E	73	84
PSM	HRHPLDHDCSGEGHPTSR	84	sp|Q8WV99-2|ZFN2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	9-UNIMOD:4	ms_run[2]:scan=539	6.0569	3	2093.9198	2093.9198	K	A	126	144
PSM	HRWPTGDNIHAEHQVR	85	sp|Q14671-4|PUM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=2420	19.8	3	1951.9514	1951.9514	K	S	144	160
PSM	HVCGHHLHTVGGVVER	86	sp|Q8IUW5|RELL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	3-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=1395	11.994	3	1802.8986	1802.8986	K	D	174	190
PSM	IGGIGTVPVGR	87	sp|P68104-2|EF1A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=4815	37.049	2	1024.6029	1024.6029	K	V	235	246
PSM	RPPHPLPPR	88	sp|P12270|TPR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:267,9-UNIMOD:267	ms_run[2]:scan=1012	9.132	2	1085.6361	1085.6361	R	L	2076	2085
PSM	SVTEQGAELSNEER	89	sp|P63104|1433Z_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	14-UNIMOD:267	ms_run[2]:scan=3118	24.845	2	1557.7146	1557.7146	K	N	28	42
PSM	TCAILCHIYHHALHSR	90	sp|Q99613-2|EIF3C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	2-UNIMOD:4,6-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=5054	38.858	3	1997.9704	1997.9704	R	W	556	572
PSM	QHHPPYHQQHHQGPPPGGPGGR	91	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:28,22-UNIMOD:267	ms_run[1]:scan=711	7.157183333333333	2	2395.1079	2395.1090	R	S	246	268
PSM	QHHPPYHQQHHQGPPPGGPGGRSEEK	92	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:28	ms_run[1]:scan=667	6.871194999999999	4	2858.3115	2858.3129	R	I	246	272
PSM	MLLHSEQHPGQLKDNVSSPGGATIHALHVLESGGFR	93	sp|P32322|P5CR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:35	ms_run[1]:scan=7316	57.26938166666667	5	3834.941189	3834.922390	K	S	216	252
PSM	VRPVLPGEPTPPPGLLLFPSGPGGPSDPPTR	94	sp|Q9BW19|KIFC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=8717	70.76494333333333	3	3100.669836	3100.670956	R	L	317	348
PSM	AFTKNGSGAVFPVAGADVQTLR	95	sp|O00391|QSOX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:188,22-UNIMOD:267	ms_run[1]:scan=6726	52.0195	3	2221.215936	2221.182614	K	E	126	148
PSM	ARGLPVTCEVAPHHLFLSHDDLER	96	sp|P27708|PYR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	8-UNIMOD:4	ms_run[2]:scan=5895	45.322	4	2768.3817	2768.3817	K	L	1629	1653
PSM	GVDEVTIVNILTNR	97	sp|P07355-2|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=9086	74.714	2	1541.8413	1541.8413	K	S	68	82
PSM	HHPHFLTHK	98	sp|O00159-2|MYO1C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	9-UNIMOD:188	ms_run[2]:scan=769	7.5333	2	1158.6142	1158.6142	K	L	484	493
PSM	HRWPTGDNIHAEHQVR	99	sp|Q14671-4|PUM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=2429	19.859	4	1951.9514	1951.9514	K	S	144	160
PSM	HYLDFINHYANLFHEKR	100	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=8077	64.263	4	2216.0916	2216.0916	R	S	3175	3192
PSM	IFKDFMHVLEHECQHHHSK	101	sp|O75400-2|PR40A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	13-UNIMOD:4	ms_run[2]:scan=5609	43.027	3	2458.1423	2458.1423	R	N	765	784
PSM	LFIHNHEQHHK	102	sp|Q02809|PLOD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	11-UNIMOD:188	ms_run[2]:scan=833	7.9451	2	1444.7419	1444.7419	R	A	320	331
PSM	MLLHSEQHPGQLKDNVSSPGGATIHALHVLESGGFR	103	sp|P32322-2|P5CR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=7510	58.929	5	3818.9275	3818.9275	K	S	216	252
PSM	RHTGVIPTHHQFITNER	104	sp|Q9BX66-7|SRBS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:267,17-UNIMOD:267	ms_run[2]:scan=2723	21.974	3	2062.0724	2062.0724	R	F	589	606
PSM	SGPFGQIFRPDNFVFGQSGAGNNWAK	105	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=9134	75.212	3	2797.3361	2797.3361	R	G	78	104
PSM	TPAGPPPPPPPPLR	106	sp|Q8TF74-2|WIPF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	14-UNIMOD:267	ms_run[2]:scan=4484	34.693	2	1399.7851	1399.7851	R	N	216	230
PSM	MSLHNLATVFGPTLLRPSEK	107	sp|P11274|BCR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	16-UNIMOD:267	ms_run[1]:scan=6928	53.795880000000004	2	2223.227036	2220.196428	K	E	1198	1218
PSM	VFVWVVSAVTCFGNIFVICMRPYIR	108	sp|Q9HBX9|RXFP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	11-UNIMOD:4,19-UNIMOD:4,20-UNIMOD:35,25-UNIMOD:267	ms_run[1]:scan=6768	52.371545000000005	4	3060.540402	3058.562287	R	S	410	435