MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000208 -- new
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220618\20220618002634800212^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\111222_LH18.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220618\20220618002634800212^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\111222_LH18.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Acetyl (Protein N-term),Label:13C(6) (K),Label:13C(6)15N(4) (R),Oxidation (M)
MTD	software[1]-setting	maxMissedCleavages=1
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=40
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Label:13C(6) (K),Label:13C(6)15N(4) (R),Acetyl (Protein N-term)
MTD	software[2]-setting	TOL(-)=20
MTD	software[2]-setting	TOL(+)=20
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=1000
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=1
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Acetyl (Protein N-term),Label:13C(6) (K),Label:13C(6)15N(4) (R),Oxidation (M)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=1
MTD	software[3]-setting	peptide_mass_tolerance=20
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:1, Acetyl,]
MTD	variable_mod[1]-site	N-term
MTD	variable_mod[1]-position	Protein N-term
MTD	variable_mod[2]	[UNIMOD, UNIMOD:188, Label:13C(6),]
MTD	variable_mod[2]-site	K
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:267, Label:13C(6)15N(4),]
MTD	variable_mod[3]-site	R
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[4]-site	M
MTD	variable_mod[4]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|Q9P2N5|RBM27_HUMAN	RNA-binding protein 27 OS=Homo sapiens OX=9606 GN=RBM27 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	776-UNIMOD:4	0.03	47.0	1	1	1
PRT	sp|Q8N573-6|OXR1_HUMAN	Isoform 6 of Oxidation resistance protein 1 OS=Homo sapiens OX=9606 GN=OXR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	22-UNIMOD:188,37-UNIMOD:188	0.06	45.0	2	1	0
PRT	sp|Q9Y230-2|RUVB2_HUMAN	Isoform 2 of RuvB-like 2 OS=Homo sapiens OX=9606 GN=RUVBL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.05	45.0	2	1	0
PRT	sp|O60271-5|JIP4_HUMAN	Isoform 5 of C-Jun-amino-terminal kinase-interacting protein 4 OS=Homo sapiens OX=9606 GN=SPAG9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.02	45.0	1	1	1
PRT	sp|P17858|PFKAL_HUMAN	ATP-dependent 6-phosphofructokinase, liver type OS=Homo sapiens OX=9606 GN=PFKL PE=1 SV=6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	444-UNIMOD:188	0.03	44.0	3	1	0
PRT	sp|P49773|HINT1_HUMAN	Histidine triad nucleotide-binding protein 1 OS=Homo sapiens OX=9606 GN=HINT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	44.0	null	78-UNIMOD:35	0.21	44.0	4	1	0
PRT	sp|P29083|T2EA_HUMAN	General transcription factor IIE subunit 1 OS=Homo sapiens OX=9606 GN=GTF2E1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.04	43.0	1	1	1
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.01	43.0	3	1	0
PRT	sp|P08138-2|TNR16_HUMAN	Isoform 2 of Tumor necrosis factor receptor superfamily member 16 OS=Homo sapiens OX=9606 GN=NGFR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	287-UNIMOD:4	0.08	43.0	3	1	0
PRT	sp|P61160|ARP2_HUMAN	Actin-related protein 2 OS=Homo sapiens OX=9606 GN=ACTR2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	316-UNIMOD:267,319-UNIMOD:267	0.10	43.0	3	2	1
PRT	sp|P22695|QCR2_HUMAN	Cytochrome b-c1 complex subunit 2, mitochondrial OS=Homo sapiens OX=9606 GN=UQCRC2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.09	43.0	3	2	1
PRT	sp|Q92945|FUBP2_HUMAN	Far upstream element-binding protein 2 OS=Homo sapiens OX=9606 GN=KHSRP PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.03	43.0	2	1	0
PRT	sp|P41250|GARS_HUMAN	Glycine--tRNA ligase OS=Homo sapiens OX=9606 GN=GARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	42.0	null	596-UNIMOD:267	0.04	42.0	4	2	0
PRT	sp|O60762|DPM1_HUMAN	Dolichol-phosphate mannosyltransferase subunit 1 OS=Homo sapiens OX=9606 GN=DPM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.08	41.0	1	1	1
PRT	sp|Q15293-2|RCN1_HUMAN	Isoform 2 of Reticulocalbin-1 OS=Homo sapiens OX=9606 GN=RCN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.06	41.0	1	1	1
PRT	sp|P31689|DNJA1_HUMAN	DnaJ homolog subfamily A member 1 OS=Homo sapiens OX=9606 GN=DNAJA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	41.0	null	389-UNIMOD:267	0.04	41.0	7	1	0
PRT	sp|P04181|OAT_HUMAN	Ornithine aminotransferase, mitochondrial OS=Homo sapiens OX=9606 GN=OAT PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	93-UNIMOD:4,64-UNIMOD:267	0.08	41.0	3	2	1
PRT	sp|Q9UBQ0|VPS29_HUMAN	Vacuolar protein sorting-associated protein 29 OS=Homo sapiens OX=9606 GN=VPS29 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	36-UNIMOD:4,41-UNIMOD:4,30-UNIMOD:188,43-UNIMOD:188	0.11	41.0	4	1	0
PRT	sp|P29401|TKT_HUMAN	Transketolase OS=Homo sapiens OX=9606 GN=TKT PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	206-UNIMOD:4,225-UNIMOD:4	0.04	41.0	2	1	0
PRT	sp|Q9NUP9|LIN7C_HUMAN	Protein lin-7 homolog C OS=Homo sapiens OX=9606 GN=LIN7C PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.11	41.0	1	1	0
PRT	sp|P62888|RL30_HUMAN	60S ribosomal protein L30 OS=Homo sapiens OX=9606 GN=RPL30 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	85-UNIMOD:4,87-UNIMOD:188,90-UNIMOD:267	0.20	41.0	3	1	0
PRT	sp|O15143|ARC1B_HUMAN	Actin-related protein 2/3 complex subunit 1B OS=Homo sapiens OX=9606 GN=ARPC1B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	41.0	null	49-UNIMOD:188,66-UNIMOD:267	0.06	41.0	6	1	0
PRT	sp|O14910|LIN7A_HUMAN	Protein lin-7 homolog A OS=Homo sapiens OX=9606 GN=LIN7A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null	151-UNIMOD:267,170-UNIMOD:188	0.09	41.0	2	1	0
PRT	sp|Q5VT52-2|RPRD2_HUMAN	Isoform 2 of Regulation of nuclear pre-mRNA domain-containing protein 2 OS=Homo sapiens OX=9606 GN=RPRD2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.02	40.0	1	1	1
PRT	sp|Q92499-3|DDX1_HUMAN	Isoform 3 of ATP-dependent RNA helicase DDX1 OS=Homo sapiens OX=9606 GN=DDX1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	11-UNIMOD:4,17-UNIMOD:4	0.07	40.0	3	2	1
PRT	sp|O76003|GLRX3_HUMAN	Glutaredoxin-3 OS=Homo sapiens OX=9606 GN=GLRX3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.07	40.0	2	1	0
PRT	sp|Q14684-2|RRP1B_HUMAN	Isoform 2 of Ribosomal RNA processing protein 1 homolog B OS=Homo sapiens OX=9606 GN=RRP1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	409-UNIMOD:267	0.03	40.0	4	1	0
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null	647-UNIMOD:267	0.08	40.0	6	4	2
PRT	sp|O94832|MYO1D_HUMAN	Unconventional myosin-Id OS=Homo sapiens OX=9606 GN=MYO1D PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	970-UNIMOD:4	0.04	40.0	3	2	1
PRT	sp|P05198|IF2A_HUMAN	Eukaryotic translation initiation factor 2 subunit 1 OS=Homo sapiens OX=9606 GN=EIF2S1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null		0.07	40.0	2	1	0
PRT	sp|O75306-2|NDUS2_HUMAN	Isoform 2 of NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFS2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	96-UNIMOD:267	0.04	40.0	1	1	1
PRT	sp|Q05048|CSTF1_HUMAN	Cleavage stimulation factor subunit 1 OS=Homo sapiens OX=9606 GN=CSTF1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	242-UNIMOD:267	0.05	40.0	5	1	0
PRT	sp|Q14677|EPN4_HUMAN	Clathrin interactor 1 OS=Homo sapiens OX=9606 GN=CLINT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.03	40.0	2	1	0
PRT	sp|Q15084-3|PDIA6_HUMAN	Isoform 3 of Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 GN=PDIA6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	82-UNIMOD:188,99-UNIMOD:188	0.06	40.0	3	1	0
PRT	sp|Q8WYA6-3|CTBL1_HUMAN	Isoform 3 of Beta-catenin-like protein 1 OS=Homo sapiens OX=9606 GN=CTNNBL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	156-UNIMOD:4	0.07	40.0	2	1	0
PRT	sp|O60547-2|GMDS_HUMAN	Isoform 2 of GDP-mannose 4,6 dehydratase OS=Homo sapiens OX=9606 GN=GMDS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	40-UNIMOD:188,51-UNIMOD:188	0.05	39.0	2	1	0
PRT	sp|Q14008-2|CKAP5_HUMAN	Isoform 2 of Cytoskeleton-associated protein 5 OS=Homo sapiens OX=9606 GN=CKAP5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	1735-UNIMOD:4	0.01	39.0	1	1	1
PRT	sp|Q15393|SF3B3_HUMAN	Splicing factor 3B subunit 3 OS=Homo sapiens OX=9606 GN=SF3B3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	981-UNIMOD:4	0.04	39.0	3	2	1
PRT	sp|O43707|ACTN4_HUMAN	Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	39.0	null	455-UNIMOD:188,469-UNIMOD:267	0.06	39.0	4	3	2
PRT	sp|Q01082-3|SPTB2_HUMAN	Isoform 2 of Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	1620-UNIMOD:188,1640-UNIMOD:188	0.02	39.0	5	2	0
PRT	sp|P19784|CSK22_HUMAN	Casein kinase II subunit alpha' OS=Homo sapiens OX=9606 GN=CSNK2A2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	230-UNIMOD:267,245-UNIMOD:267	0.05	39.0	1	1	1
PRT	sp|Q14697|GANAB_HUMAN	Neutral alpha-glucosidase AB OS=Homo sapiens OX=9606 GN=GANAB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	684-UNIMOD:267,698-UNIMOD:267	0.03	39.0	3	2	1
PRT	sp|P14618|KPYM_HUMAN	Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	2-UNIMOD:1,22-UNIMOD:35,31-UNIMOD:4,89-UNIMOD:188,30-UNIMOD:35	0.12	39.0	9	3	1
PRT	sp|Q9NUM4|T106B_HUMAN	Transmembrane protein 106B OS=Homo sapiens OX=9606 GN=TMEM106B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.09	39.0	2	1	0
PRT	sp|P42166|LAP2A_HUMAN	Lamina-associated polypeptide 2, isoform alpha OS=Homo sapiens OX=9606 GN=TMPO PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	null	479-UNIMOD:28,484-UNIMOD:188,500-UNIMOD:188	0.03	39.0	4	1	0
PRT	sp|Q13885|TBB2A_HUMAN	Tubulin beta-2A chain OS=Homo sapiens OX=9606 GN=TUBB2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	1-UNIMOD:35,12-UNIMOD:4,2-UNIMOD:267,19-UNIMOD:188	0.04	39.0	4	1	0
PRT	sp|Q14204|DYHC1_HUMAN	Cytoplasmic dynein 1 heavy chain 1 OS=Homo sapiens OX=9606 GN=DYNC1H1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	2451-UNIMOD:267	0.00	38.0	2	1	0
PRT	sp|P54886-2|P5CS_HUMAN	Isoform Short of Delta-1-pyrroline-5-carboxylate synthase OS=Homo sapiens OX=9606 GN=ALDH18A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	765-UNIMOD:188,779-UNIMOD:188	0.02	38.0	4	1	0
PRT	sp|Q8WUJ3-2|CEMIP_HUMAN	Isoform 2 of Cell migration-inducing and hyaluronan-binding protein OS=Homo sapiens OX=9606 GN=CEMIP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	292-UNIMOD:267,516-UNIMOD:4,529-UNIMOD:188	0.04	38.0	2	2	2
PRT	sp|Q8NFH3-2|NUP43_HUMAN	Isoform 2 of Nucleoporin Nup43 OS=Homo sapiens OX=9606 GN=NUP43	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	87-UNIMOD:267	0.06	38.0	3	1	0
PRT	sp|Q14152-2|EIF3A_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit A OS=Homo sapiens OX=9606 GN=EIF3A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	199-UNIMOD:267,194-UNIMOD:35	0.02	38.0	6	1	0
PRT	sp|P11216|PYGB_HUMAN	Glycogen phosphorylase, brain form OS=Homo sapiens OX=9606 GN=PYGB PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	425-UNIMOD:267	0.02	38.0	2	1	0
PRT	sp|Q8TEM1|PO210_HUMAN	Nuclear pore membrane glycoprotein 210 OS=Homo sapiens OX=9606 GN=NUP210 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	1576-UNIMOD:188	0.01	38.0	2	1	0
PRT	sp|P06493-2|CDK1_HUMAN	Isoform 2 of Cyclin-dependent kinase 1 OS=Homo sapiens OX=9606 GN=CDK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.07	38.0	1	1	1
PRT	sp|P55786|PSA_HUMAN	Puromycin-sensitive aminopeptidase OS=Homo sapiens OX=9606 GN=NPEPPS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.02	38.0	1	1	1
PRT	sp|P23284|PPIB_HUMAN	Peptidyl-prolyl cis-trans isomerase B OS=Homo sapiens OX=9606 GN=PPIB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	131-UNIMOD:188,145-UNIMOD:188	0.08	38.0	3	1	0
PRT	sp|Q9NTJ3|SMC4_HUMAN	Structural maintenance of chromosomes protein 4 OS=Homo sapiens OX=9606 GN=SMC4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	1017-UNIMOD:188,1031-UNIMOD:188	0.01	38.0	4	1	0
PRT	sp|P53041|PPP5_HUMAN	Serine/threonine-protein phosphatase 5 OS=Homo sapiens OX=9606 GN=PPP5C PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null	430-UNIMOD:188,441-UNIMOD:267	0.03	38.0	4	1	0
PRT	sp|Q9Y5K3-2|PCY1B_HUMAN	Isoform 1 of Choline-phosphate cytidylyltransferase B OS=Homo sapiens OX=9606 GN=PCYT1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	94-UNIMOD:267	0.05	38.0	2	1	0
PRT	sp|Q71U36|TBA1A_HUMAN	Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	null	85-UNIMOD:28,96-UNIMOD:188,105-UNIMOD:267	0.05	38.0	2	1	0
PRT	sp|Q07157-2|ZO1_HUMAN	Isoform Short of Tight junction protein ZO-1 OS=Homo sapiens OX=9606 GN=TJP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	1076-UNIMOD:267,1090-UNIMOD:267	0.01	37.0	2	1	0
PRT	sp|Q96G46-2|DUS3L_HUMAN	Isoform 2 of tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Homo sapiens OX=9606 GN=DUS3L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	185-UNIMOD:267,199-UNIMOD:267	0.05	37.0	2	1	0
PRT	sp|P46926|GNPI1_HUMAN	Glucosamine-6-phosphate isomerase 1 OS=Homo sapiens OX=9606 GN=GNPDA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	118-UNIMOD:4	0.10	37.0	1	1	1
PRT	sp|Q14571|ITPR2_HUMAN	Inositol 1,4,5-trisphosphate receptor type 2 OS=Homo sapiens OX=9606 GN=ITPR2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	1285-UNIMOD:4,1291-UNIMOD:267	0.01	37.0	1	1	1
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	639-UNIMOD:267	0.05	37.0	4	2	0
PRT	sp|P55145|MANF_HUMAN	Mesencephalic astrocyte-derived neurotrophic factor OS=Homo sapiens OX=9606 GN=MANF PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	94-UNIMOD:188,104-UNIMOD:188	0.10	37.0	2	1	0
PRT	sp|P09429|HMGB1_HUMAN	High mobility group protein B1 OS=Homo sapiens OX=9606 GN=HMGB1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	114-UNIMOD:188,127-UNIMOD:188,106-UNIMOD:4	0.14	37.0	5	2	1
PRT	sp|Q99497|PARK7_HUMAN	Protein/nucleic acid deglycase DJ-1 OS=Homo sapiens OX=9606 GN=PARK7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null	99-UNIMOD:188,106-UNIMOD:4,122-UNIMOD:188	0.13	37.0	2	1	0
PRT	sp|O75832-2|PSD10_HUMAN	Isoform 2 of 26S proteasome non-ATPase regulatory subunit 10 OS=Homo sapiens OX=9606 GN=PSMD10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.13	37.0	1	1	1
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	495-UNIMOD:267	0.04	37.0	3	2	1
PRT	sp|Q9HBH5|RDH14_HUMAN	Retinol dehydrogenase 14 OS=Homo sapiens OX=9606 GN=RDH14 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.06	37.0	2	1	0
PRT	sp|Q8NC51-3|PAIRB_HUMAN	Isoform 3 of Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	330-UNIMOD:267,325-UNIMOD:35	0.04	37.0	5	1	0
PRT	sp|P68104-2|EF1A1_HUMAN	Isoform 2 of Elongation factor 1-alpha 1 OS=Homo sapiens OX=9606 GN=EEF1A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	20-UNIMOD:188	0.04	37.0	4	1	0
PRT	sp|P46379|BAG6_HUMAN	Large proline-rich protein BAG6 OS=Homo sapiens OX=9606 GN=BAG6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	805-UNIMOD:267	0.02	37.0	1	1	0
PRT	sp|P17812-2|PYRG1_HUMAN	Isoform 2 of CTP synthase 1 OS=Homo sapiens OX=9606 GN=CTPS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.05	36.0	2	1	0
PRT	sp|Q9UNX3|RL26L_HUMAN	60S ribosomal protein L26-like 1 OS=Homo sapiens OX=9606 GN=RPL26L1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.14	36.0	1	1	1
PRT	sp|P13987|CD59_HUMAN	CD59 glycoprotein OS=Homo sapiens OX=9606 GN=CD59 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	36.0	null	64-UNIMOD:4,70-UNIMOD:4,64-UNIMOD:385	0.13	36.0	3	1	0
PRT	sp|Q15021|CND1_HUMAN	Condensin complex subunit 1 OS=Homo sapiens OX=9606 GN=NCAPD2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	362-UNIMOD:267,381-UNIMOD:267	0.02	36.0	6	1	0
PRT	sp|P68371|TBB4B_HUMAN	Tubulin beta-4B chain OS=Homo sapiens OX=9606 GN=TUBB4B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	267-UNIMOD:35,276-UNIMOD:267,12-UNIMOD:4	0.12	36.0	4	3	2
PRT	sp|P82675|RT05_HUMAN	28S ribosomal protein S5, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	374-UNIMOD:267,377-UNIMOD:4,388-UNIMOD:267	0.05	36.0	3	1	0
PRT	sp|Q9P2R3|ANFY1_HUMAN	Rabankyrin-5 OS=Homo sapiens OX=9606 GN=ANKFY1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	712-UNIMOD:4,716-UNIMOD:4,724-UNIMOD:4,731-UNIMOD:267	0.02	36.0	2	1	0
PRT	sp|P62937|PPIA_HUMAN	Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	115-UNIMOD:4,118-UNIMOD:188,82-UNIMOD:188,91-UNIMOD:188,125-UNIMOD:188,131-UNIMOD:188	0.34	36.0	4	3	2
PRT	sp|P63244|RACK1_HUMAN	Receptor of activated protein C kinase 1 OS=Homo sapiens OX=9606 GN=RACK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	185-UNIMOD:188,207-UNIMOD:4,212-UNIMOD:188	0.09	36.0	2	1	0
PRT	sp|P12268|IMDH2_HUMAN	Inosine-5'-monophosphate dehydrogenase 2 OS=Homo sapiens OX=9606 GN=IMPDH2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.04	36.0	2	1	0
PRT	sp|P29144|TPP2_HUMAN	Tripeptidyl-peptidase 2 OS=Homo sapiens OX=9606 GN=TPP2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.02	36.0	2	1	0
PRT	sp|Q5SSJ5-3|HP1B3_HUMAN	Isoform 3 of Heterochromatin protein 1-binding protein 3 OS=Homo sapiens OX=9606 GN=HP1BP3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	233-UNIMOD:188,234-UNIMOD:188	0.05	36.0	2	1	0
PRT	sp|Q6DD88|ATLA3_HUMAN	Atlastin-3 OS=Homo sapiens OX=9606 GN=ATL3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	239-UNIMOD:188,250-UNIMOD:267	0.03	36.0	2	1	0
PRT	sp|Q969V3-2|NCLN_HUMAN	Isoform 2 of Nicalin OS=Homo sapiens OX=9606 GN=NCLN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.04	35.0	1	1	1
PRT	sp|P61313-2|RL15_HUMAN	Isoform 2 of 60S ribosomal protein L15 OS=Homo sapiens OX=9606 GN=RPL15	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	83-UNIMOD:188,93-UNIMOD:188	0.12	35.0	2	1	0
PRT	sp|P34897-3|GLYM_HUMAN	Isoform 3 of Serine hydroxymethyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=SHMT2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.03	35.0	1	1	1
PRT	sp|O60264|SMCA5_HUMAN	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Homo sapiens OX=9606 GN=SMARCA5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	1	1	1
PRT	sp|Q96C57|CSTOS_HUMAN	Protein CUSTOS OS=Homo sapiens OX=9606 GN=CUSTOS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.08	35.0	2	1	0
PRT	sp|O43837|IDH3B_HUMAN	Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=IDH3B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.07	35.0	1	1	1
PRT	sp|P27144|KAD4_HUMAN	Adenylate kinase 4, mitochondrial OS=Homo sapiens OX=9606 GN=AK4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.08	35.0	1	1	1
PRT	sp|P23381-2|SYWC_HUMAN	Isoform 2 of Tryptophan--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=WARS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	290-UNIMOD:188,308-UNIMOD:188	0.06	35.0	3	1	0
PRT	sp|Q8TEX9|IPO4_HUMAN	Importin-4 OS=Homo sapiens OX=9606 GN=IPO4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null	370-UNIMOD:188,388-UNIMOD:267	0.02	35.0	2	1	0
PRT	sp|P13010|XRCC5_HUMAN	X-ray repair cross-complementing protein 5 OS=Homo sapiens OX=9606 GN=XRCC5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	195-UNIMOD:188,202-UNIMOD:188	0.03	35.0	1	1	1
PRT	sp|Q9UBN7|HDAC6_HUMAN	Histone deacetylase 6 OS=Homo sapiens OX=9606 GN=HDAC6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.01	35.0	1	1	1
PRT	sp|Q96TA1-2|NIBA2_HUMAN	Isoform 2 of Protein Niban 2 OS=Homo sapiens OX=9606 GN=NIBAN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.03	35.0	2	1	0
PRT	sp|Q9UHD8-4|SEPT9_HUMAN	Isoform 4 of Septin-9 OS=Homo sapiens OX=9606 GN=SEPTIN9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.06	35.0	2	1	0
PRT	sp|Q14247-3|SRC8_HUMAN	Isoform 3 of Src substrate cortactin OS=Homo sapiens OX=9606 GN=CTTN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	57-UNIMOD:188	0.03	35.0	2	1	0
PRT	sp|Q13418|ILK_HUMAN	Integrin-linked protein kinase OS=Homo sapiens OX=9606 GN=ILK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null	422-UNIMOD:4,42-UNIMOD:4,410-UNIMOD:267,423-UNIMOD:188	0.11	35.0	3	2	1
PRT	sp|P07954-2|FUMH_HUMAN	Isoform Cytoplasmic of Fumarate hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=FH	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	129-UNIMOD:188,140-UNIMOD:188	0.05	34.0	3	1	0
PRT	sp|P06733-2|ENOA_HUMAN	Isoform MBP-1 of Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.09	34.0	1	1	1
PRT	sp|Q13813-3|SPTN1_HUMAN	Isoform 3 of Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.01	34.0	2	1	0
PRT	sp|Q96HS1|PGAM5_HUMAN	Serine/threonine-protein phosphatase PGAM5, mitochondrial OS=Homo sapiens OX=9606 GN=PGAM5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.05	34.0	1	1	1
PRT	sp|P46013-2|KI67_HUMAN	Isoform Short of Proliferation marker protein Ki-67 OS=Homo sapiens OX=9606 GN=MKI67	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	355-UNIMOD:4	0.01	34.0	1	1	1
PRT	sp|O43488|ARK72_HUMAN	Aflatoxin B1 aldehyde reductase member 2 OS=Homo sapiens OX=9606 GN=AKR7A2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	132-UNIMOD:4,156-UNIMOD:4,158-UNIMOD:267	0.08	34.0	3	1	0
PRT	sp|P08579|RU2B_HUMAN	U2 small nuclear ribonucleoprotein B'' OS=Homo sapiens OX=9606 GN=SNRPB2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	186-UNIMOD:267,204-UNIMOD:267	0.11	34.0	4	1	0
PRT	sp|P46100-3|ATRX_HUMAN	Isoform 2 of Transcriptional regulator ATRX OS=Homo sapiens OX=9606 GN=ATRX	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	54-UNIMOD:4,57-UNIMOD:4	0.01	34.0	1	1	1
PRT	sp|Q9Y6C9|MTCH2_HUMAN	Mitochondrial carrier homolog 2 OS=Homo sapiens OX=9606 GN=MTCH2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	147-UNIMOD:267	0.06	34.0	3	1	0
PRT	sp|P50995-2|ANX11_HUMAN	Isoform 2 of Annexin A11 OS=Homo sapiens OX=9606 GN=ANXA11	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	355-UNIMOD:267,367-UNIMOD:267	0.03	34.0	1	1	1
PRT	sp|P27708|PYR1_HUMAN	CAD protein OS=Homo sapiens OX=9606 GN=CAD PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	274-UNIMOD:267,280-UNIMOD:4,287-UNIMOD:267	0.01	34.0	1	1	1
PRT	sp|P62826|RAN_HUMAN	GTP-binding nuclear protein Ran OS=Homo sapiens OX=9606 GN=RAN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.09	34.0	1	1	1
PRT	sp|Q15293|RCN1_HUMAN	Reticulocalbin-1 OS=Homo sapiens OX=9606 GN=RCN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	null	142-UNIMOD:28	0.08	34.0	2	1	0
PRT	sp|Q9C075|K1C23_HUMAN	Keratin, type I cytoskeletal 23 OS=Homo sapiens OX=9606 GN=KRT23 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	34.0	null	1-UNIMOD:1	0.06	34.0	2	1	0
PRT	sp|P82933|RT09_HUMAN	28S ribosomal protein S9, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS9 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.05	33.0	1	1	1
PRT	sp|P08621|RU17_HUMAN	U1 small nuclear ribonucleoprotein 70 kDa OS=Homo sapiens OX=9606 GN=SNRNP70 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null	39-UNIMOD:4,46-UNIMOD:267,155-UNIMOD:267,157-UNIMOD:35,162-UNIMOD:188	0.08	33.0	3	2	1
PRT	sp|P16435|NCPR_HUMAN	NADPH--cytochrome P450 reductase OS=Homo sapiens OX=9606 GN=POR PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	311-UNIMOD:188	0.04	33.0	2	2	2
PRT	sp|Q99878|H2A1J_HUMAN	Histone H2A type 1-J OS=Homo sapiens OX=9606 GN=H2AC14 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.12	33.0	1	1	1
PRT	sp|E9PRG8|CK098_HUMAN	Uncharacterized protein C11orf98 OS=Homo sapiens OX=9606 GN=C11orf98 PE=4 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	35-UNIMOD:267,48-UNIMOD:267	0.13	33.0	2	1	0
PRT	sp|P49411|EFTU_HUMAN	Elongation factor Tu, mitochondrial OS=Homo sapiens OX=9606 GN=TUFM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	127-UNIMOD:4,135-UNIMOD:188	0.04	33.0	2	1	0
PRT	sp|Q14690|RRP5_HUMAN	Protein RRP5 homolog OS=Homo sapiens OX=9606 GN=PDCD11 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.01	33.0	1	1	1
PRT	sp|P17987|TCPA_HUMAN	T-complex protein 1 subunit alpha OS=Homo sapiens OX=9606 GN=TCP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	468-UNIMOD:267,480-UNIMOD:267	0.03	33.0	1	1	1
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	635-UNIMOD:4	0.01	33.0	2	1	0
PRT	sp|Q8WUM0|NU133_HUMAN	Nuclear pore complex protein Nup133 OS=Homo sapiens OX=9606 GN=NUP133 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	67-UNIMOD:35,82-UNIMOD:188	0.01	33.0	2	1	0
PRT	sp|P47897-2|SYQ_HUMAN	Isoform 2 of Glutamine--tRNA ligase OS=Homo sapiens OX=9606 GN=QARS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	153-UNIMOD:35	0.02	33.0	2	1	0
PRT	sp|Q09666|AHNK_HUMAN	Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	5406-UNIMOD:35	0.01	33.0	2	2	2
PRT	sp|P68363-2|TBA1B_HUMAN	Isoform 2 of Tubulin alpha-1B chain OS=Homo sapiens OX=9606 GN=TUBA1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.07	33.0	1	1	0
PRT	sp|Q9NZ52-3|GGA3_HUMAN	Isoform 3 of ADP-ribosylation factor-binding protein GGA3 OS=Homo sapiens OX=9606 GN=GGA3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	1	1	1
PRT	sp|Q9NYB0|TE2IP_HUMAN	Telomeric repeat-binding factor 2-interacting protein 1 OS=Homo sapiens OX=9606 GN=TERF2IP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	41-UNIMOD:267,54-UNIMOD:4,55-UNIMOD:267	0.04	33.0	1	1	1
PRT	sp|P61599|NAA20_HUMAN	N-alpha-acetyltransferase 20 OS=Homo sapiens OX=9606 GN=NAA20 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.09	33.0	1	1	1
PRT	sp|O75083-3|WDR1_HUMAN	Isoform 2 of WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=WDR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.08	33.0	1	1	1
PRT	sp|Q5BKZ1-3|ZN326_HUMAN	Isoform 3 of DBIRD complex subunit ZNF326 OS=Homo sapiens OX=9606 GN=ZNF326	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.07	33.0	1	1	1
PRT	sp|P07355-2|ANXA2_HUMAN	Isoform 2 of Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	81-UNIMOD:267	0.05	33.0	2	2	2
PRT	sp|Q9H0U6|RM18_HUMAN	39S ribosomal protein L18, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL18 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	100-UNIMOD:188	0.09	33.0	3	1	0
PRT	sp|Q00610|CLH1_HUMAN	Clathrin heavy chain 1 OS=Homo sapiens OX=9606 GN=CLTC PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null		0.01	33.0	1	1	1
PRT	sp|Q8N573|OXR1_HUMAN	Oxidation resistance protein 1 OS=Homo sapiens OX=9606 GN=OXR1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null		0.02	33.0	1	1	0
PRT	sp|Q96S55|WRIP1_HUMAN	ATPase WRNIP1 OS=Homo sapiens OX=9606 GN=WRNIP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	null	39-UNIMOD:385,39-UNIMOD:4,56-UNIMOD:267	0.03	33.0	1	1	1
PRT	sp|Q96FW1|OTUB1_HUMAN	Ubiquitin thioesterase OTUB1 OS=Homo sapiens OX=9606 GN=OTUB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null	109-UNIMOD:188,113-UNIMOD:267	0.13	32.0	3	2	1
PRT	sp|Q13263-2|TIF1B_HUMAN	Isoform 2 of Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	150-UNIMOD:4,127-UNIMOD:4,139-UNIMOD:4,142-UNIMOD:4,147-UNIMOD:4	0.06	32.0	3	2	1
PRT	sp|P06748-3|NPM_HUMAN	Isoform 3 of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.07	32.0	1	1	1
PRT	sp|P11387|TOP1_HUMAN	DNA topoisomerase 1 OS=Homo sapiens OX=9606 GN=TOP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	223-UNIMOD:188,239-UNIMOD:188	0.03	32.0	1	1	1
PRT	sp|P35998-2|PRS7_HUMAN	Isoform 2 of 26S proteasome regulatory subunit 7 OS=Homo sapiens OX=9606 GN=PSMC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.08	32.0	1	1	1
PRT	sp|P40926|MDHM_HUMAN	Malate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=MDH2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.06	32.0	1	1	1
PRT	sp|O00515|LAD1_HUMAN	Ladinin-1 OS=Homo sapiens OX=9606 GN=LAD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|P07195|LDHB_HUMAN	L-lactate dehydrogenase B chain OS=Homo sapiens OX=9606 GN=LDHB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	164-UNIMOD:4,158-UNIMOD:267,170-UNIMOD:267	0.04	32.0	4	1	0
PRT	sp|Q9ULE6|PALD_HUMAN	Paladin OS=Homo sapiens OX=9606 GN=PALD1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	47-UNIMOD:188	0.02	32.0	2	1	0
PRT	sp|P18887|XRCC1_HUMAN	DNA repair protein XRCC1 OS=Homo sapiens OX=9606 GN=XRCC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	12-UNIMOD:4,20-UNIMOD:4	0.03	32.0	1	1	1
PRT	sp|Q9HC35-2|EMAL4_HUMAN	Isoform 2 of Echinoderm microtubule-associated protein-like 4 OS=Homo sapiens OX=9606 GN=EML4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	580-UNIMOD:4,598-UNIMOD:267	0.03	32.0	3	1	0
PRT	sp|Q6P587|FAHD1_HUMAN	Acylpyruvase FAHD1, mitochondrial OS=Homo sapiens OX=9606 GN=FAHD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.07	32.0	1	1	1
PRT	sp|P60174-4|TPIS_HUMAN	Isoform 4 of Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.09	32.0	2	1	0
PRT	sp|O15372|EIF3H_HUMAN	Eukaryotic translation initiation factor 3 subunit H OS=Homo sapiens OX=9606 GN=EIF3H PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.06	32.0	1	1	1
PRT	sp|Q9Y383-3|LC7L2_HUMAN	Isoform 3 of Putative RNA-binding protein Luc7-like 2 OS=Homo sapiens OX=9606 GN=LUC7L2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	40-UNIMOD:4,41-UNIMOD:4,50-UNIMOD:267	0.04	32.0	1	1	1
PRT	sp|P11586|C1TC_HUMAN	C-1-tetrahydrofolate synthase, cytoplasmic OS=Homo sapiens OX=9606 GN=MTHFD1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	175-UNIMOD:188,195-UNIMOD:4,198-UNIMOD:188	0.03	32.0	1	1	1
PRT	sp|P05023-2|AT1A1_HUMAN	Isoform 2 of Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens OX=9606 GN=ATP1A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	2	1	0
PRT	sp|Q9BY77-2|PDIP3_HUMAN	Isoform 2 of Polymerase delta-interacting protein 3 OS=Homo sapiens OX=9606 GN=POLDIP3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.05	31.0	1	1	1
PRT	sp|Q9UMX0-4|UBQL1_HUMAN	Isoform 4 of Ubiquilin-1 OS=Homo sapiens OX=9606 GN=UBQLN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	70-UNIMOD:188,83-UNIMOD:188	0.09	31.0	1	1	1
PRT	sp|Q15813|TBCE_HUMAN	Tubulin-specific chaperone E OS=Homo sapiens OX=9606 GN=TBCE PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	48-UNIMOD:188,60-UNIMOD:188	0.03	31.0	1	1	1
PRT	sp|P56537|IF6_HUMAN	Eukaryotic translation initiation factor 6 OS=Homo sapiens OX=9606 GN=EIF6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	85-UNIMOD:267	0.08	31.0	2	1	0
PRT	sp|Q15185-3|TEBP_HUMAN	Isoform 3 of Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	58-UNIMOD:4	0.14	31.0	1	1	1
PRT	sp|P08670|VIME_HUMAN	Vimentin OS=Homo sapiens OX=9606 GN=VIM PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	1	1	1
PRT	sp|Q9NR19|ACSA_HUMAN	Acetyl-coenzyme A synthetase, cytoplasmic OS=Homo sapiens OX=9606 GN=ACSS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	696-UNIMOD:267	0.04	31.0	1	1	1
PRT	sp|P46063|RECQ1_HUMAN	ATP-dependent DNA helicase Q1 OS=Homo sapiens OX=9606 GN=RECQL PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null	223-UNIMOD:4,224-UNIMOD:4,232-UNIMOD:267,236-UNIMOD:188	0.03	31.0	2	1	0
PRT	sp|O00461|GOLI4_HUMAN	Golgi integral membrane protein 4 OS=Homo sapiens OX=9606 GN=GOLIM4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	187-UNIMOD:188,200-UNIMOD:188	0.02	31.0	2	1	0
PRT	sp|P31483-2|TIA1_HUMAN	Isoform Short of Nucleolysin TIA-1 isoform p40 OS=Homo sapiens OX=9606 GN=TIA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	89-UNIMOD:188,112-UNIMOD:188	0.07	31.0	1	1	1
PRT	sp|Q69YN2-3|C19L1_HUMAN	Isoform 3 of CWF19-like protein 1 OS=Homo sapiens OX=9606 GN=CWF19L1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	191-UNIMOD:4,194-UNIMOD:4	0.05	31.0	1	1	1
PRT	sp|P25789|PSA4_HUMAN	Proteasome subunit alpha type-4 OS=Homo sapiens OX=9606 GN=PSMA4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.06	31.0	1	1	1
PRT	sp|Q13131|AAPK1_HUMAN	5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Homo sapiens OX=9606 GN=PRKAA1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	129-UNIMOD:267,141-UNIMOD:4,143-UNIMOD:267	0.03	31.0	2	1	0
PRT	sp|P18669|PGAM1_HUMAN	Phosphoglycerate mutase 1 OS=Homo sapiens OX=9606 GN=PGAM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.14	31.0	2	2	2
PRT	sp|Q9Y5K8|VATD_HUMAN	V-type proton ATPase subunit D OS=Homo sapiens OX=9606 GN=ATP6V1D PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	168-UNIMOD:267,179-UNIMOD:267	0.05	31.0	2	1	0
PRT	sp|Q8NFH5-2|NUP35_HUMAN	Isoform 2 of Nucleoporin NUP35 OS=Homo sapiens OX=9606 GN=NUP35	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	66-UNIMOD:188,68-UNIMOD:188	0.07	31.0	2	1	0
PRT	sp|Q9NZJ9-3|NUDT4_HUMAN	Isoform 3 of Diphosphoinositol polyphosphate phosphohydrolase 2 OS=Homo sapiens OX=9606 GN=NUDT4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	80-UNIMOD:4,82-UNIMOD:188,91-UNIMOD:188	0.12	31.0	2	1	0
PRT	sp|P49589-2|SYCC_HUMAN	Isoform 2 of Cysteine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=CARS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	405-UNIMOD:4,406-UNIMOD:188	0.02	31.0	2	1	0
PRT	sp|P22626-2|ROA2_HUMAN	Isoform A2 of Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.04	31.0	1	1	1
PRT	sp|P51991-2|ROA3_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens OX=9606 GN=HNRNPA3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	174-UNIMOD:4,177-UNIMOD:188,178-UNIMOD:188	0.04	31.0	2	1	0
PRT	sp|Q15084|PDIA6_HUMAN	Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 GN=PDIA6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	85-UNIMOD:188,102-UNIMOD:188	0.06	31.0	1	1	0
PRT	sp|P69905|HBA_HUMAN	Hemoglobin subunit alpha OS=Homo sapiens OX=9606 GN=HBA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.12	31.0	1	1	1
PRT	sp|P35637-2|FUS_HUMAN	Isoform Short of RNA-binding protein FUS OS=Homo sapiens OX=9606 GN=FUS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.05	30.0	1	1	1
PRT	sp|Q9GZT3-2|SLIRP_HUMAN	Isoform 2 of SRA stem-loop-interacting RNA-binding protein, mitochondrial OS=Homo sapiens OX=9606 GN=SLIRP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	48-UNIMOD:4	0.13	30.0	2	1	0
PRT	sp|P21333-2|FLNA_HUMAN	Isoform 2 of Filamin-A OS=Homo sapiens OX=9606 GN=FLNA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|P55884|EIF3B_HUMAN	Eukaryotic translation initiation factor 3 subunit B OS=Homo sapiens OX=9606 GN=EIF3B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	420-UNIMOD:4,430-UNIMOD:188	0.02	30.0	2	1	0
PRT	sp|Q9BSJ8|ESYT1_HUMAN	Extended synaptotagmin-1 OS=Homo sapiens OX=9606 GN=ESYT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	635-UNIMOD:4	0.02	30.0	1	1	1
PRT	sp|P21291|CSRP1_HUMAN	Cysteine and glycine-rich protein 1 OS=Homo sapiens OX=9606 GN=CSRP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.09	30.0	1	1	1
PRT	sp|P63000|RAC1_HUMAN	Ras-related C3 botulinum toxin substrate 1 OS=Homo sapiens OX=9606 GN=RAC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	105-UNIMOD:4,116-UNIMOD:188	0.08	30.0	2	1	0
PRT	sp|Q14CX7-2|NAA25_HUMAN	Isoform 2 of N-alpha-acetyltransferase 25, NatB auxiliary subunit OS=Homo sapiens OX=9606 GN=NAA25	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|P29350-2|PTN6_HUMAN	Isoform 3 of Tyrosine-protein phosphatase non-receptor type 6 OS=Homo sapiens OX=9606 GN=PTPN6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	521-UNIMOD:188,531-UNIMOD:188	0.02	30.0	2	1	0
PRT	sp|O96028-5|NSD2_HUMAN	Isoform 5 of Histone-lysine N-methyltransferase NSD2 OS=Homo sapiens OX=9606 GN=NSD2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	468-UNIMOD:267,488-UNIMOD:267	0.04	30.0	1	1	1
PRT	sp|Q9BVT8|TMUB1_HUMAN	Transmembrane and ubiquitin-like domain-containing protein 1 OS=Homo sapiens OX=9606 GN=TMUB1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	77-UNIMOD:267,106-UNIMOD:267	0.13	30.0	1	1	1
PRT	sp|Q96FX7|TRM61_HUMAN	tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRMT61A OS=Homo sapiens OX=9606 GN=TRMT61A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.05	30.0	1	1	1
PRT	sp|P38606-2|VATA_HUMAN	Isoform 2 of V-type proton ATPase catalytic subunit A OS=Homo sapiens OX=9606 GN=ATP6V1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	410-UNIMOD:188,423-UNIMOD:188	0.03	30.0	2	1	0
PRT	sp|P26639|SYTC_HUMAN	Threonine--tRNA ligase 1, cytoplasmic OS=Homo sapiens OX=9606 GN=TARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	442-UNIMOD:267,454-UNIMOD:267	0.03	30.0	2	1	0
PRT	sp|P49792|RBP2_HUMAN	E3 SUMO-protein ligase RanBP2 OS=Homo sapiens OX=9606 GN=RANBP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	188-UNIMOD:4	0.00	30.0	1	1	1
PRT	sp|Q9Y224|RTRAF_HUMAN	RNA transcription, translation and transport factor protein OS=Homo sapiens OX=9606 GN=RTRAF PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.06	30.0	1	1	1
PRT	sp|P61244-3|MAX_HUMAN	Isoform 3 of Protein max OS=Homo sapiens OX=9606 GN=MAX	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.14	30.0	1	1	1
PRT	sp|Q9UDY2-5|ZO2_HUMAN	Isoform A3 of Tight junction protein ZO-2 OS=Homo sapiens OX=9606 GN=TJP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|Q96MG7|NSE3_HUMAN	Non-structural maintenance of chromosomes element 3 homolog OS=Homo sapiens OX=9606 GN=NSMCE3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.06	30.0	1	1	1
PRT	sp|Q5T4S7-3|UBR4_HUMAN	Isoform 3 of E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	1698-UNIMOD:4,1700-UNIMOD:188,1708-UNIMOD:188	0.01	30.0	3	2	1
PRT	sp|Q9NYF8-4|BCLF1_HUMAN	Isoform 4 of Bcl-2-associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	420-UNIMOD:188,426-UNIMOD:188	0.02	30.0	1	1	1
PRT	sp|P98179|RBM3_HUMAN	RNA-binding protein 3 OS=Homo sapiens OX=9606 GN=RBM3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	47-UNIMOD:267,65-UNIMOD:267	0.13	30.0	1	1	1
PRT	sp|P09960-4|LKHA4_HUMAN	Isoform 4 of Leukotriene A-4 hydrolase OS=Homo sapiens OX=9606 GN=LTA4H	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	112-UNIMOD:4,117-UNIMOD:4	0.05	30.0	2	1	0
PRT	sp|P14866|HNRPL_HUMAN	Heterogeneous nuclear ribonucleoprotein L OS=Homo sapiens OX=9606 GN=HNRNPL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.08	30.0	1	1	1
PRT	sp|P43405-2|KSYK_HUMAN	Isoform Short of Tyrosine-protein kinase SYK OS=Homo sapiens OX=9606 GN=SYK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	89-UNIMOD:4,101-UNIMOD:4	0.09	30.0	4	2	1
PRT	sp|Q9C0J8|WDR33_HUMAN	pre-mRNA 3' end processing protein WDR33 OS=Homo sapiens OX=9606 GN=WDR33 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	1	1	1
PRT	sp|Q9NP81|SYSM_HUMAN	Serine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=SARS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	1	1	1
PRT	sp|P35579-2|MYH9_HUMAN	Isoform 2 of Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	1	1	1
PRT	sp|P11940-2|PABP1_HUMAN	Isoform 2 of Polyadenylate-binding protein 1 OS=Homo sapiens OX=9606 GN=PABPC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	1	1	1
PRT	sp|Q01081-4|U2AF1_HUMAN	Isoform 4 of Splicing factor U2AF 35 kDa subunit OS=Homo sapiens OX=9606 GN=U2AF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	96-UNIMOD:4	0.09	29.0	1	1	1
PRT	sp|Q9BV20-2|MTNA_HUMAN	Isoform 2 of Methylthioribose-1-phosphate isomerase OS=Homo sapiens OX=9606 GN=MRI1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	238-UNIMOD:4,241-UNIMOD:267	0.06	29.0	1	1	1
PRT	sp|O60313-13|OPA1_HUMAN	Isoform 7 of Dynamin-like 120 kDa protein, mitochondrial OS=Homo sapiens OX=9606 GN=OPA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	1	1	1
PRT	sp|Q7L014|DDX46_HUMAN	Probable ATP-dependent RNA helicase DDX46 OS=Homo sapiens OX=9606 GN=DDX46 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	696-UNIMOD:4,706-UNIMOD:267	0.02	29.0	1	1	1
PRT	sp|Q92973-3|TNPO1_HUMAN	Isoform 3 of Transportin-1 OS=Homo sapiens OX=9606 GN=TNPO1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	155-UNIMOD:4	0.02	29.0	1	1	1
PRT	sp|P53396|ACLY_HUMAN	ATP-citrate synthase OS=Homo sapiens OX=9606 GN=ACLY PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	2	1	0
PRT	sp|P10599|THIO_HUMAN	Thioredoxin OS=Homo sapiens OX=9606 GN=TXN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	37-UNIMOD:35,39-UNIMOD:188,48-UNIMOD:188	0.12	29.0	2	1	0
PRT	sp|Q01813-2|PFKAP_HUMAN	Isoform 2 of ATP-dependent 6-phosphofructokinase, platelet type OS=Homo sapiens OX=9606 GN=PFKP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	1	1	1
PRT	sp|P14735|IDE_HUMAN	Insulin-degrading enzyme OS=Homo sapiens OX=9606 GN=IDE PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	299-UNIMOD:188	0.02	29.0	1	1	1
PRT	sp|O43598-2|DNPH1_HUMAN	Isoform 2 of 2'-deoxynucleoside 5'-phosphate N-hydrolase 1 OS=Homo sapiens OX=9606 GN=DNPH1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	48-UNIMOD:267,65-UNIMOD:267	0.13	29.0	1	1	1
PRT	sp|O75131|CPNE3_HUMAN	Copine-3 OS=Homo sapiens OX=9606 GN=CPNE3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.04	29.0	2	1	0
PRT	sp|P78527-2|PRKDC_HUMAN	Isoform 2 of DNA-dependent protein kinase catalytic subunit OS=Homo sapiens OX=9606 GN=PRKDC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	1	1	1
PRT	sp|P31939-2|PUR9_HUMAN	Isoform 2 of Bifunctional purine biosynthesis protein PURH OS=Homo sapiens OX=9606 GN=ATIC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	78-UNIMOD:267	0.02	29.0	1	1	1
PRT	sp|P48059|LIMS1_HUMAN	LIM and senescent cell antigen-like-containing domain protein 1 OS=Homo sapiens OX=9606 GN=LIMS1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	null	138-UNIMOD:385,138-UNIMOD:4,161-UNIMOD:4,164-UNIMOD:4	0.09	29.0	2	1	0
PRT	sp|P12236|ADT3_HUMAN	ADP/ATP translocase 3 OS=Homo sapiens OX=9606 GN=SLC25A6 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	null	97-UNIMOD:28	0.05	29.0	1	1	1
PRT	sp|O94901-6|SUN1_HUMAN	Isoform 6 of SUN domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SUN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|P09651-3|ROA1_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.07	28.0	1	1	1
PRT	sp|Q13347|EIF3I_HUMAN	Eukaryotic translation initiation factor 3 subunit I OS=Homo sapiens OX=9606 GN=EIF3I PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	298-UNIMOD:188	0.05	28.0	2	1	0
PRT	sp|P57740-3|NU107_HUMAN	Isoform 3 of Nuclear pore complex protein Nup107 OS=Homo sapiens OX=9606 GN=NUP107	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	534-UNIMOD:188,546-UNIMOD:188	0.03	28.0	1	1	1
PRT	sp|Q16891-3|MIC60_HUMAN	Isoform 3 of MICOS complex subunit MIC60 OS=Homo sapiens OX=9606 GN=IMMT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	533-UNIMOD:188,545-UNIMOD:188	0.02	28.0	1	1	1
PRT	sp|Q9BUP3|HTAI2_HUMAN	Oxidoreductase HTATIP2 OS=Homo sapiens OX=9606 GN=HTATIP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.10	28.0	1	1	1
PRT	sp|Q14203-5|DCTN1_HUMAN	Isoform 5 of Dynactin subunit 1 OS=Homo sapiens OX=9606 GN=DCTN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|Q15149|PLEC_HUMAN	Plectin OS=Homo sapiens OX=9606 GN=PLEC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	2892-UNIMOD:188,2903-UNIMOD:188	0.00	28.0	3	1	0
PRT	sp|P06744|G6PI_HUMAN	Glucose-6-phosphate isomerase OS=Homo sapiens OX=9606 GN=GPI PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	404-UNIMOD:4	0.03	28.0	1	1	1
PRT	sp|P15559-3|NQO1_HUMAN	Isoform 3 of NAD(P)H dehydrogenase [quinone] 1 OS=Homo sapiens OX=9606 GN=NQO1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	5-UNIMOD:267,15-UNIMOD:267	0.05	28.0	1	1	1
PRT	sp|P11802|CDK4_HUMAN	Cyclin-dependent kinase 4 OS=Homo sapiens OX=9606 GN=CDK4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.04	28.0	1	1	1
PRT	sp|P50402|EMD_HUMAN	Emerin OS=Homo sapiens OX=9606 GN=EMD PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	18-UNIMOD:267,31-UNIMOD:267	0.06	28.0	1	1	1
PRT	sp|Q7Z6Z7-2|HUWE1_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens OX=9606 GN=HUWE1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	3243-UNIMOD:4	0.00	28.0	1	1	1
PRT	sp|P46379-4|BAG6_HUMAN	Isoform 4 of Large proline-rich protein BAG6 OS=Homo sapiens OX=9606 GN=BAG6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	673-UNIMOD:267	0.02	28.0	2	1	0
PRT	sp|P51580|TPMT_HUMAN	Thiopurine S-methyltransferase OS=Homo sapiens OX=9606 GN=TPMT PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	50-UNIMOD:188,51-UNIMOD:188	0.06	28.0	2	1	0
PRT	sp|P46459|NSF_HUMAN	Vesicle-fusing ATPase OS=Homo sapiens OX=9606 GN=NSF PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|Q6Y7W6-4|GGYF2_HUMAN	Isoform 3 of GRB10-interacting GYF protein 2 OS=Homo sapiens OX=9606 GN=GIGYF2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	603-UNIMOD:267	0.02	28.0	1	1	1
PRT	sp|P00491|PNPH_HUMAN	Purine nucleoside phosphorylase OS=Homo sapiens OX=9606 GN=PNP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	31-UNIMOD:4	0.07	28.0	1	1	1
PRT	sp|Q9HCE1|MOV10_HUMAN	Helicase MOV-10 OS=Homo sapiens OX=9606 GN=MOV10 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	356-UNIMOD:267	0.02	28.0	1	1	1
PRT	sp|Q7L3T8|SYPM_HUMAN	Probable proline--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=PARS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	null	153-UNIMOD:4	0.05	28.0	1	1	1
PRT	sp|Q92572|AP3S1_HUMAN	AP-3 complex subunit sigma-1 OS=Homo sapiens OX=9606 GN=AP3S1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.07	27.0	1	1	1
PRT	sp|Q02878|RL6_HUMAN	60S ribosomal protein L6 OS=Homo sapiens OX=9606 GN=RPL6 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	156-UNIMOD:267	0.06	27.0	1	1	1
PRT	sp|P49736|MCM2_HUMAN	DNA replication licensing factor MCM2 OS=Homo sapiens OX=9606 GN=MCM2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.04	27.0	1	1	1
PRT	sp|A1L0T0|ILVBL_HUMAN	Acetolactate synthase-like protein OS=Homo sapiens OX=9606 GN=ILVBL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|P62701|RS4X_HUMAN	40S ribosomal protein S4, X isoform OS=Homo sapiens OX=9606 GN=RPS4X PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	211-UNIMOD:188	0.05	27.0	1	1	1
PRT	sp|Q9NZM1-5|MYOF_HUMAN	Isoform 5 of Myoferlin OS=Homo sapiens OX=9606 GN=MYOF	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	1242-UNIMOD:267	0.01	27.0	2	1	0
PRT	sp|P46776|RL27A_HUMAN	60S ribosomal protein L27a OS=Homo sapiens OX=9606 GN=RPL27A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.09	27.0	1	1	1
PRT	sp|P07741-2|APT_HUMAN	Isoform 2 of Adenine phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=APRT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.12	27.0	1	1	1
PRT	sp|P08034|CXB1_HUMAN	Gap junction beta-1 protein OS=Homo sapiens OX=9606 GN=GJB1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.06	27.0	1	1	1
PRT	sp|Q9Y5Q0|FADS3_HUMAN	Fatty acid desaturase 3 OS=Homo sapiens OX=9606 GN=FADS3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.04	27.0	1	1	1
PRT	sp|P08195-2|4F2_HUMAN	Isoform 2 of 4F2 cell-surface antigen heavy chain OS=Homo sapiens OX=9606 GN=SLC3A2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|Q2NKX8|ERC6L_HUMAN	DNA excision repair protein ERCC-6-like OS=Homo sapiens OX=9606 GN=ERCC6L PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|P58557|YBEY_HUMAN	Endoribonuclease YbeY OS=Homo sapiens OX=9606 GN=YBEY PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	73-UNIMOD:188	0.10	27.0	1	1	1
PRT	sp|Q96DV4|RM38_HUMAN	39S ribosomal protein L38, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL38 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	60-UNIMOD:267,72-UNIMOD:267	0.04	27.0	1	1	1
PRT	sp|P62993-2|GRB2_HUMAN	Isoform 2 of Growth factor receptor-bound protein 2 OS=Homo sapiens OX=9606 GN=GRB2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.10	27.0	1	1	1
PRT	sp|Q9NY26|S39A1_HUMAN	Zinc transporter ZIP1 OS=Homo sapiens OX=9606 GN=SLC39A1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.04	27.0	1	1	1
PRT	sp|Q04446|GLGB_HUMAN	1,4-alpha-glucan-branching enzyme OS=Homo sapiens OX=9606 GN=GBE1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|P30046-2|DOPD_HUMAN	Isoform 2 of D-dopachrome decarboxylase OS=Homo sapiens OX=9606 GN=DDT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.12	27.0	1	1	1
PRT	sp|Q01082|SPTB2_HUMAN	Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|P50914|RL14_HUMAN	60S ribosomal protein L14 OS=Homo sapiens OX=9606 GN=RPL14 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	null	54-UNIMOD:385,54-UNIMOD:4,55-UNIMOD:35,63-UNIMOD:188,71-UNIMOD:188	0.09	27.0	1	1	1
PRT	sp|Q8TDD1|DDX54_HUMAN	ATP-dependent RNA helicase DDX54 OS=Homo sapiens OX=9606 GN=DDX54 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|P51991|ROA3_HUMAN	Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens OX=9606 GN=HNRNPA3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	null	196-UNIMOD:4,199-UNIMOD:188,200-UNIMOD:188	0.04	27.0	2	1	0
PRT	sp|P50502|F10A1_HUMAN	Hsc70-interacting protein OS=Homo sapiens OX=9606 GN=ST13 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	209-UNIMOD:4,210-UNIMOD:188	0.05	27.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	LGHAGGNQSDASHLLNQSGGAGEDCQIFSTPGHPK	1	sp|Q9P2N5|RBM27_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	25-UNIMOD:4	ms_run[2]:scan=5849	39.273	3	3543.6186	3543.6186	R	M	752	787
PSM	HKITSADGHIESSALLK	2	sp|Q8N573-6|OXR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=3688	25.586	2	1805.9636	1805.9636	K	E	21	38
PSM	KEVVHTVSLHEIDVINSR	3	sp|Q9Y230-2|RUVB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=5841	39.223	2	2074.1171	2074.1171	R	T	191	209
PSM	TKLHQLSGSDQLESTAHSR	4	sp|O60271-5|JIP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=2841	20.166	2	2094.0454	2094.0454	R	I	177	196
PSM	TGISHGHTVYVVHDGFEGLAK	5	sp|P17858|PFKAL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=5333	35.953	2	2223.1073	2223.1073	R	G	424	445
PSM	KHISQISVAEDDDESLLGHLMIVGK	6	sp|P49773|HINT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0		ms_run[1]:scan=9712	64.97266666666667	3	2734.400072	2733.400731	K	K	58	83
PSM	DHAATTAGAASLAGGHHR	7	sp|P29083|T2EA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=1506	11.829	2	1699.8139	1699.8139	K	E	219	237
PSM	HFLLEEDKPEEPTAHAFVSTLTR	8	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=7915	52.667	2	2666.334	2666.3340	R	G	1516	1539
PSM	HLAGELGYQPEHIDSFTHEACPVR	9	sp|P08138-2|TNR16_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	21-UNIMOD:4	ms_run[2]:scan=6303	42.193	3	2762.2871	2762.2871	R	A	267	291
PSM	HLWDYTFGPEKLNIDTR	10	sp|P61160|ARP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=9061	60.477	2	2104.0378	2104.0378	K	N	87	104
PSM	IDKAVAFQNPQTHVIENLHAAAYR	11	sp|P22695|QCR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=6623	44.236	2	2705.4038	2705.4038	K	N	160	184
PSM	KLASQGDSISSQLGPIHPPPR	12	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=5379	36.236	2	2184.1651	2184.1651	K	T	122	143
PSM	HGVSHKVDDSSGSIGR	13	sp|P41250|GARS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0		ms_run[1]:scan=905	8.201703333333334	2	1636.799433	1636.791746	R	R	641	657
PSM	HATGNYIIIMDADLSHHPK	14	sp|O60762|DPM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=6665	44.485	2	2132.0473	2132.0473	K	F	108	127
PSM	HWILPQDYDHAQAEAR	15	sp|Q15293-2|RCN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=5792	38.91	2	1948.918	1948.9180	R	H	220	236
PSM	HYNGEAYEDDEHHPR	16	sp|P31689|DNJA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=1156	9.6977	2	1867.751	1867.7510	R	G	375	390
PSM	KYFDFLSSYSAVNQGHCHPK	17	sp|P04181|OAT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	17-UNIMOD:4	ms_run[2]:scan=7209	48.052	2	2384.1008	2384.1008	R	I	77	97
PSM	LLVPGKIQHILCTGNLCTK	18	sp|Q9UBQ0|VPS29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	12-UNIMOD:4,17-UNIMOD:4	ms_run[2]:scan=8310	55.323	2	2164.186	2164.1861	K	E	25	44
PSM	RCEAFGWHAIIVDGHSVEELCK	19	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	2-UNIMOD:4,21-UNIMOD:4	ms_run[2]:scan=7873	52.399	3	2612.2264	2612.2264	K	A	205	227
PSM	RGDQLLSVNGVSVEGEHHEK	20	sp|Q9NUP9|LIN7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=4659	31.708	3	2189.0825	2189.0825	K	A	136	156
PSM	TGVHHYSGNNIELGTACGKYYR	21	sp|P62888|RL30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	17-UNIMOD:4	ms_run[2]:scan=4278	29.303	2	2496.1604	2496.1604	K	V	69	91
PSM	VHELKEHNGQVTGIDWAPESNR	22	sp|O15143|ARC1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=5021	34.005	2	2515.2204	2515.2204	K	I	45	67
PSM	VHELKEHNGQVTGIDWAPESNR	23	sp|O15143|ARC1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	5-UNIMOD:188,22-UNIMOD:267	ms_run[1]:scan=5005	33.91077833333333	3	2532.234310	2531.248796	K	I	45	67
PSM	RGDQLLSVNGVSVEGEHHEK	24	sp|O14910|LIN7A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	1-UNIMOD:267,20-UNIMOD:188	ms_run[1]:scan=4654	31.674590000000002	3	2206.122000	2205.110906	K	A	151	171
PSM	DHSSLLQGTLAEHFGVLPGPR	25	sp|Q5VT52-2|RPRD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=9675	64.725	3	2230.1495	2230.1495	K	D	1290	1311
PSM	GKHYYEVSCHDQGLCR	26	sp|Q92499-3|DDX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	9-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=2633	18.875	2	2007.868	2007.8680	K	V	3	19
PSM	HASSGSFLPSANEHLKEDLNLR	27	sp|O76003|GLRX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=6675	44.547	2	2421.2037	2421.2037	R	L	115	137
PSM	HHLQPENPGPGGAAPSLEQNR	28	sp|Q14684-2|RRP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=3412	23.862	2	2205.0675	2205.0675	K	G	389	410
PSM	HLAGELGYQPEHIDSFTHEACPVR	29	sp|P08138-2|TNR16_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	21-UNIMOD:4	ms_run[2]:scan=6310	42.238	2	2762.2871	2762.2871	R	A	267	291
PSM	HLEINPDHSIIETLR	30	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=6978	46.519	2	1785.9373	1785.9373	K	Q	633	648
PSM	HLQVNVTNPVQCSLHGKK	31	sp|O94832|MYO1D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	12-UNIMOD:4	ms_run[2]:scan=4435	30.302	2	2058.0793	2058.0793	R	C	959	977
PSM	HVAEVLEYTKDEQLESLFQR	32	sp|P05198|IF2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=9299	62.083	2	2433.2176	2433.2176	R	T	114	134
PSM	NITLNFGPQHPAAHGVLR	33	sp|O75306-2|NDUS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	18-UNIMOD:267	ms_run[2]:scan=6380	42.685	2	1951.0416	1951.0416	K	L	79	97
PSM	RCEAFGWHAIIVDGHSVEELCK	34	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	2-UNIMOD:4,21-UNIMOD:4	ms_run[2]:scan=7867	52.357	2	2612.2264	2612.2264	K	A	205	227
PSM	SISFHPSGDFILVGTQHPTLR	35	sp|Q05048|CSTF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=8585	57.207	2	2308.1964	2308.1964	R	L	222	243
PSM	SLENYHFVDEHGKDQGINIR	36	sp|Q14677|EPN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=5687	38.24	2	2370.1353	2370.1353	R	Q	110	130
PSM	TGISHGHTVYVVHDGFEGLAK	37	sp|P17858|PFKAL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	21-UNIMOD:188	ms_run[2]:scan=5336	35.97	2	2229.1274	2229.1274	R	G	424	445
PSM	VGAVDADKHHSLGGQYGVQGFPTIK	38	sp|Q15084-3|PDIA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	8-UNIMOD:188,25-UNIMOD:188	ms_run[2]:scan=6222	41.633	3	2592.3487	2592.3487	K	I	75	100
PSM	VGTTEKEHEEHVCSILASLLR	39	sp|Q8WYA6-3|CTBL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	13-UNIMOD:4	ms_run[2]:scan=9311	62.159	2	2407.2166	2407.2166	K	N	144	165
PSM	HYNGEAYEDDEHHPR	40	sp|P31689|DNJA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	15-UNIMOD:267	ms_run[2]:scan=1154	9.6859	2	1877.7593	1877.7593	R	G	375	390
PSM	IDKAVAFQNPQTHVIENLHAAAYR	41	sp|P22695|QCR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=6615	44.185	3	2705.4038	2705.4038	K	N	160	184
PSM	IEHLYKNPQAHIEGNMK	42	sp|O60547-2|GMDS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=3390	23.718	2	2033.0555	2033.0555	R	L	35	52
PSM	ILDHLTMIDNKNESELEAHLCR	43	sp|Q14008-2|CKAP5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	21-UNIMOD:4	ms_run[2]:scan=7644	50.89	2	2650.2843	2650.2843	K	M	1715	1737
PSM	KFVIHPESNNLIIIETDHNAYTEATK	44	sp|Q15393|SF3B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=7566	50.371	3	2996.5244	2996.5244	R	A	787	813
PSM	KHEAFESDLAAHQDR	45	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=2510	18.106	2	1752.818	1752.8180	R	V	455	470
PSM	KHQILEQAVEDYAETVHQLSK	46	sp|Q01082-3|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:188,21-UNIMOD:188	ms_run[2]:scan=9705	64.927	2	2477.2953	2477.2953	K	T	1620	1641
PSM	REPFFHGQDNYDQLVR	47	sp|P19784|CSK22_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=6187	41.413	2	2039.9717	2039.9717	R	I	230	246
PSM	REPWLLPSQHNDIIR	48	sp|Q14697|GANAB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:267,15-UNIMOD:267	ms_run[2]:scan=6810	45.41	2	1893.0124	1893.0124	R	D	684	699
PSM	SISFHPSGDFILVGTQHPTLR	49	sp|Q05048|CSTF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	21-UNIMOD:267	ms_run[2]:scan=8584	57.201	2	2318.2047	2318.2047	R	L	222	243
PSM	SKPHSEAGTAFIQTQQLHAAMADTFLEHMCR	50	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:1,21-UNIMOD:35,30-UNIMOD:4	ms_run[2]:scan=8850	59.046	3	3570.6442	3570.6442	M	L	2	33
PSM	SLSHLPLHSSKEDAYDGVTSENMR	51	sp|Q9NUM4|T106B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=4991	33.818	2	2672.25	2672.2500	K	N	4	28
PSM	VHELKEHNGQVTGIDWAPESNR	52	sp|O15143|ARC1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	5-UNIMOD:188,22-UNIMOD:267	ms_run[1]:scan=5010	33.937871666666666	2	2532.234772	2531.248796	K	I	45	67
PSM	QSQHDKIDASELSFPFHESILK	53	sp|P42166|LAP2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:28	ms_run[1]:scan=9459	63.201143333333334	2	2538.2323	2538.2385	K	V	479	501
PSM	MREIVHIQAGQCGNQIGAK	54	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	1-UNIMOD:35,12-UNIMOD:4	ms_run[1]:scan=3773	26.11850666666667	2	2125.049988	2125.052077	-	F	1	20
PSM	ALEHAFQLEHIMDLTR	55	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=9319	62.213	2	1922.9673	1922.9673	K	L	2436	2452
PSM	GKDHVVSDFSEHGSLK	56	sp|P54886-2|P5CS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=3042	21.502	2	1740.8431	1740.8431	R	Y	764	780
PSM	GNPSSSVEDHIEYHGHR	57	sp|Q8WUJ3-2|CEMIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	17-UNIMOD:267	ms_run[2]:scan=3015	21.333	2	1929.8593	1929.8593	K	G	276	293
PSM	HHGDVMDLQFFDQER	58	sp|Q8NFH3-2|NUP43_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=8084	53.814	2	1872.8213	1872.8213	R	I	73	88
PSM	HHLQPENPGPGGAAPSLEQNR	59	sp|Q14684-2|RRP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	21-UNIMOD:267	ms_run[2]:scan=3414	23.874	2	2215.0758	2215.0758	K	G	389	410
PSM	HHNQSTAINLNNPESQSMHLETR	60	sp|Q14152-2|EIF3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=4852	32.939	3	2657.2365	2657.2365	R	L	177	200
PSM	HLDHVAALFPGDVDR	61	sp|P11216|PYGB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=6333	42.385	2	1660.8322	1660.8322	R	L	411	426
PSM	HLHPIQTSFQEATASK	62	sp|Q8TEM1|PO210_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	16-UNIMOD:188	ms_run[2]:scan=4285	29.348	2	1799.9262	1799.9262	R	V	1561	1577
PSM	KPLFHGDSEIDQLFR	63	sp|P06493-2|CDK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=8181	54.46	2	1800.9159	1800.9159	K	I	144	159
PSM	LGWDPKPGEGHLDALLR	64	sp|P55786|PSA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=7971	53.027	2	1872.9846	1872.9846	R	G	690	707
PSM	LKHYGPGWVSMANAGK	65	sp|P23284|PPIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	2-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=5006	33.917	2	1726.9016	1726.9016	K	D	130	146
PSM	LKLEQIDGHIAEHNSK	66	sp|Q9NTJ3|SMC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=4252	29.136	2	1830.9588	1830.9588	K	I	1016	1032
PSM	LLVPGKIQHILCTGNLCTK	67	sp|Q9UBQ0|VPS29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:188,12-UNIMOD:4,17-UNIMOD:4,19-UNIMOD:188	ms_run[2]:scan=8308	55.311	2	2176.2263	2176.2263	K	E	25	44
PSM	LNFSHGTHEYHAETIK	68	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	16-UNIMOD:188	ms_run[2]:scan=3348	23.458	2	1888.9163	1888.9163	R	N	74	90
PSM	SHEVKAEGYEVAHGGR	69	sp|P53041|PPP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=1600	12.415	2	1724.823	1724.8230	R	C	426	442
PSM	SLSHLPLHSSKEDAYDGVTSENMR	70	sp|Q9NUM4|T106B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=4996	33.852	3	2672.25	2672.2500	K	N	4	28
PSM	VYADGIFDLFHSGHAR	71	sp|Q9Y5K3-2|PCY1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	16-UNIMOD:267	ms_run[2]:scan=9732	65.104	2	1813.8775	1813.8775	R	A	79	95
PSM	QLFHPEQLITGKEDAANNYAR	72	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:28,12-UNIMOD:188,21-UNIMOD:267	ms_run[1]:scan=8762	58.451056666666666	3	2413.2042	2413.1992	R	G	85	106
PSM	ASALRHEEQPAPGYDTHGR	73	sp|Q07157-2|ZO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=1768	13.475	2	2090.9882	2090.9882	R	L	1072	1091
PSM	FAGAHLRPEGQNLVQEELAAR	74	sp|Q96G46-2|DUS3L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=6669	44.513	3	2305.1927	2305.1927	R	G	179	200
PSM	GKDHVVSDFSEHGSLK	75	sp|P54886-2|P5CS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=3037	21.469	2	1752.8834	1752.8834	R	Y	764	780
PSM	HFLLEEDKPEEPTAHAFVSTLTR	76	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=7910	52.638	3	2666.334	2666.3340	R	G	1516	1539
PSM	HHGDVMDLQFFDQER	77	sp|Q8NFH3-2|NUP43_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	15-UNIMOD:267	ms_run[2]:scan=8078	53.775	2	1882.8296	1882.8296	R	I	73	88
PSM	HHNQSTAINLNNPESQSMHLETR	78	sp|Q14152-2|EIF3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=4856	32.96	2	2657.2365	2657.2365	R	L	177	200
PSM	HHNQSTAINLNNPESQSMHLETR	79	sp|Q14152-2|EIF3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	23-UNIMOD:267	ms_run[2]:scan=4872	33.063	2	2667.2447	2667.2447	R	L	177	200
PSM	HIDIHPENTHILDGNAVDLQAECDAFEEK	80	sp|P46926|GNPI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	23-UNIMOD:4	ms_run[2]:scan=8208	54.65	3	3329.5259	3329.5259	K	I	96	125
PSM	HIFMNNYHLCNEISER	81	sp|Q14571|ITPR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	10-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=5966	39.994	2	2085.9388	2085.9388	R	V	1276	1292
PSM	HIVLSGGSTMYPGLPSRLER	82	sp|P61160|ARP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=6904	46.039	2	2169.1365	2169.1365	K	E	300	320
PSM	HLEINPDHPIVETLR	83	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=6175	41.338	2	1781.9424	1781.9424	K	Q	625	640
PSM	IINEVSKPLAHHIPVEK	84	sp|P55145|MANF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=4366	29.861	2	1923.0942	1923.0942	K	I	88	105
PSM	IKGEHPGLSIGDVAK	85	sp|P09429|HMGB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=4201	28.82	2	1519.8358	1519.8358	K	K	113	128
PSM	KGLIAAICAGPTALLAHEIGFGSK	86	sp|Q99497|PARK7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:188,8-UNIMOD:4,24-UNIMOD:188	ms_run[2]:scan=11141	75.904	3	2406.3496	2406.3496	R	V	99	123
PSM	NRHEIAVMLLEGGANPDAK	87	sp|O75832-2|PSD10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=6724	44.862	2	2034.0317	2034.0317	K	D	117	136
PSM	REPWLLPSQHNDIIR	88	sp|Q14697|GANAB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=6816	45.45	2	1872.9959	1872.9959	R	D	684	699
PSM	RGHVFEESQVAGTPMFVVK	89	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=6785	45.252	2	2117.0728	2117.0728	K	A	767	786
PSM	RLEGTNVTVNVLHPGIVR	90	sp|Q9HBH5|RDH14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=6475	43.298	2	1973.117	1973.1170	R	T	234	252
PSM	SEEAHAEDSVMDHHFR	91	sp|Q8NC51-3|PAIRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	16-UNIMOD:267	ms_run[2]:scan=3700	25.665	3	1905.7939	1905.7939	K	K	315	331
PSM	THINIVVIGHVDSGK	92	sp|P68104-2|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=5401	36.376	2	1587.8733	1587.8733	K	S	6	21
PSM	THINIVVIGHVDSGK	93	sp|P68104-2|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	15-UNIMOD:188	ms_run[2]:scan=5403	36.393	2	1593.8934	1593.8934	K	S	6	21
PSM	VILHLKEDQTEYLEER	94	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=5932	39.788	2	2014.0371	2014.0371	K	R	181	197
PSM	VYADGIFDLFHSGHAR	95	sp|Q9Y5K3-2|PCY1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=9731	65.098	2	1803.8693	1803.8693	R	A	79	95
PSM	SFFHQHYLGGQEPTPSNIR	96	sp|P46379|BAG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	19-UNIMOD:267	ms_run[1]:scan=5800	38.96011333333334	2	2225.066700	2224.068919	R	M	787	806
PSM	RGDQLLSVNGVSVEGEHHEK	97	sp|O14910|LIN7A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=4663	31.733125	2	2190.081464	2189.082508	K	A	151	171
PSM	ALEHSALAINHKLEIK	98	sp|P17812-2|PYRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=4871	33.057	2	1786.0101	1786.0101	K	Y	89	105
PSM	ANGTTVHVGIHPSKVVITR	99	sp|Q9UNX3|RL26L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=4186	28.735	2	1985.117	1985.1170	K	L	90	109
PSM	CWKFEHCNFNDVTTR	100	sp|P13987|CD59_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=5783	38.852	2	2012.8621	2012.8622	K	L	64	79
PSM	DTRDQFLDTLQAHGHDVNSFVR	101	sp|Q15021|CND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=8243	54.876	3	2570.2262	2570.2262	R	S	360	382
PSM	FAGAHLRPEGQNLVQEELAAR	102	sp|Q96G46-2|DUS3L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	7-UNIMOD:267,21-UNIMOD:267	ms_run[2]:scan=6682	44.59	3	2325.2093	2325.2093	R	G	179	200
PSM	GHYTEGAELVDSVLDVVRK	103	sp|P68371|TBB4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=10640	71.91	2	2086.0695	2086.0695	K	E	104	123
PSM	GLHVVEIREECGPLPIVVASPR	104	sp|P82675|RT05_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	8-UNIMOD:267,11-UNIMOD:4,22-UNIMOD:267	ms_run[2]:scan=8590	57.241	3	2446.3269	2446.3269	K	G	367	389
PSM	HGCDATCWGPGPGGCLQTLLHR	105	sp|Q9P2R3|ANFY1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:4,7-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=8492	56.571	3	2449.0838	2449.0838	R	A	710	732
PSM	HHNQSTAINLNNPESQSMHLETR	106	sp|Q14152-2|EIF3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	23-UNIMOD:267	ms_run[2]:scan=4853	32.944	3	2667.2447	2667.2447	R	L	177	200
PSM	HIVLSGGSTMYPGLPSRLER	107	sp|P61160|ARP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	17-UNIMOD:267,20-UNIMOD:267	ms_run[2]:scan=6911	46.084	2	2189.153	2189.1530	K	E	300	320
PSM	HLEINPDHSIIETLR	108	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	15-UNIMOD:267	ms_run[2]:scan=6975	46.497	2	1795.9456	1795.9456	K	Q	633	648
PSM	HTGPGILSMANAGPNTNGSQFFICTAK	109	sp|P62937|PPIA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	24-UNIMOD:4,27-UNIMOD:188	ms_run[2]:scan=9223	61.581	3	2796.3419	2796.3419	K	T	92	119
PSM	IINEVSKPLAHHIPVEK	110	sp|P55145|MANF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	7-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=4364	29.85	2	1935.1344	1935.1344	K	I	88	105
PSM	KHISQISVAEDDDESLLGHLMIVGK	111	sp|P49773|HINT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=9722	65.038	2	2733.4007	2733.4007	K	K	58	83
PSM	KHQILEQAVEDYAETVHQLSK	112	sp|Q01082-3|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=9710	64.96	2	2465.2551	2465.2551	K	T	1620	1641
PSM	LKHYGPGWVSMANAGK	113	sp|P23284|PPIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=5012	33.95	2	1714.8613	1714.8613	K	D	130	146
PSM	LKLEQIDGHIAEHNSK	114	sp|Q9NTJ3|SMC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	2-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=4260	29.189	2	1842.9991	1842.9991	K	I	1016	1032
PSM	LKTNHIGHTGYLNTVTVSPDGSLCASGGK	115	sp|P63244|RACK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	2-UNIMOD:188,24-UNIMOD:4,29-UNIMOD:188	ms_run[2]:scan=5532	37.241	3	2995.5224	2995.5224	K	D	184	213
PSM	RFGVPVIADGGIQNVGHIAK	116	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=7500	49.939	3	2047.1327	2047.1327	R	A	356	376
PSM	SISFHPSGDFILVGTQHPTLR	117	sp|Q05048|CSTF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=8598	57.298	2	2308.1964	2308.1964	R	L	222	243
PSM	SIYGEKFEDENFILK	118	sp|P62937|PPIA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=8318	55.381	2	1842.9442	1842.9442	K	H	77	92
PSM	SKPHSEAGTAFIQTQQLHAAMADTFLEHMCR	119	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:1,30-UNIMOD:4	ms_run[2]:scan=10123	68.055	3	3554.6493	3554.6493	M	L	2	33
PSM	VNESSHYDLAFTDVHFKPGQIR	120	sp|P29144|TPP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=7335	48.86	2	2559.2506	2559.2506	K	R	639	661
PSM	YVLENHPGTNSNYQMHLLKK	121	sp|Q5SSJ5-3|HP1B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	19-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=5033	34.083	3	2397.2302	2397.2302	K	T	215	235
PSM	LQVKEHQHEEIQNVR	122	sp|Q6DD88|ATLA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=2074	15.390863333333334	2	1885.964414	1885.975858	R	N	236	251
PSM	HVAEVLEYTKDEQLESLFQR	123	sp|P05198|IF2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=9286	61.995934999999996	3	2434.229858	2433.217605	R	T	114	134
PSM	AAQLVDKDSTFLSTLEHHLSR	124	sp|Q969V3-2|NCLN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=9318	62.207	3	2367.2183	2367.2183	R	Y	464	485
PSM	GATYGKPVHHGVNQLK	125	sp|P61313-2|RL15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=1325	10.712	2	1704.906	1704.9060	K	F	78	94
PSM	HADIVTTTTHKTLR	126	sp|P34897-3|GLYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=2318	16.907	2	1592.8635	1592.8635	K	G	249	263
PSM	HASSGSFLPSANEHLKEDLNLR	127	sp|O76003|GLRX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=6662	44.469	3	2421.2037	2421.2037	R	L	115	137
PSM	HGATHVFASKESEITDEDIDGILER	128	sp|O60264|SMCA5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=7552	50.278	3	2768.3253	2768.3253	R	G	656	681
PSM	HGCDATCWGPGPGGCLQTLLHR	129	sp|Q9P2R3|ANFY1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:4,7-UNIMOD:4,15-UNIMOD:4,22-UNIMOD:267	ms_run[2]:scan=8477	56.47	3	2459.0921	2459.0921	R	A	710	732
PSM	HKVNEHEQDGNELQTTPEFR	130	sp|Q96C57|CSTOS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=3450	24.102	2	2407.1153	2407.1153	R	A	64	84
PSM	HNNLDLVIIREQTEGEYSSLEHESAR	131	sp|O43837|IDH3B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=8289	55.188	3	3038.4694	3038.4694	R	G	155	181
PSM	IAQNFGLQHLSSGHFLR	132	sp|P27144|KAD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=7295	48.607	2	1924.0068	1924.0068	R	E	25	42
PSM	IGYPKPALLHSTFFPALQGAQTK	133	sp|P23381-2|SYWC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	5-UNIMOD:188,23-UNIMOD:188	ms_run[2]:scan=9287	62.002	2	2496.3932	2496.3932	R	M	286	309
PSM	KAGLLVLAVLSDGAGDHIR	134	sp|Q8TEX9|IPO4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=10027	67.35	3	1904.0843	1904.0843	R	Q	370	389
PSM	LGGHGPSFPLKGITEQQK	135	sp|P13010|XRCC5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	11-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=5535	37.259	2	1905.0511	1905.0511	R	E	185	203
PSM	LHAIKEQLIQEGLLDR	136	sp|Q9UBN7|HDAC6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=6880	45.877	2	1875.0578	1875.0578	R	C	112	128
PSM	NRFSLVPHNYGLVLYENK	137	sp|Q96TA1-2|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=8159	54.316	2	2162.1273	2162.1273	R	A	74	92
PSM	SEEAHAEDSVMDHHFR	138	sp|Q8NC51-3|PAIRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	11-UNIMOD:35,16-UNIMOD:267	ms_run[2]:scan=2519	18.162	3	1921.7889	1921.7889	K	K	315	331
PSM	SHEVKAEGYEVAHGGR	139	sp|P53041|PPP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=1590	12.354	3	1724.823	1724.8230	R	C	426	442
PSM	THMQNIKDITSSIHFEAYR	140	sp|Q9UHD8-4|SEPT9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=7640	50.865	2	2290.1165	2290.1165	R	V	292	311
PSM	TVQGSGHQEHINIHK	141	sp|Q14247-3|SRC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:188	ms_run[2]:scan=1197	9.9418	2	1689.8642	1689.8642	K	L	43	58
PSM	VALEGLRPTIPPGISPHVCK	142	sp|Q13418|ILK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	19-UNIMOD:4	ms_run[2]:scan=7429	49.483	2	2140.1827	2140.1827	K	L	404	424
PSM	VHELKEHNGQVTGIDWAPESNR	143	sp|O15143|ARC1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=5000	33.877	3	2515.2204	2515.2204	K	I	45	67
PSM	QSQHDKIDASELSFPFHESILK	144	sp|P42166|LAP2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:28,6-UNIMOD:188,22-UNIMOD:188	ms_run[1]:scan=9465	63.242419999999996	2	2550.2715	2550.2788	K	V	479	501
PSM	CWKFEHCNFNDVTTR	145	sp|P13987|CD59_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:385,1-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=7651	50.936225	2	1995.8364	1995.8351	K	L	64	79
PSM	MREIVHIQAGQCGNQIGAK	146	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	1-UNIMOD:35,2-UNIMOD:267,12-UNIMOD:4,19-UNIMOD:188	ms_run[1]:scan=3790	26.225945	2	2141.078431	2141.080475	-	F	1	20
PSM	AIEMLGGELGSKIPVHPNDHVNK	147	sp|P07954-2|FUMH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=6727	44.883	2	2454.2689	2454.2689	R	S	118	141
PSM	DTRDQFLDTLQAHGHDVNSFVR	148	sp|Q15021|CND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:267,22-UNIMOD:267	ms_run[2]:scan=8253	54.939	2	2590.2427	2590.2427	R	S	360	382
PSM	HIADLAGNSEVILPVPAFNVINGGSHAGNK	149	sp|P06733-2|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=10252	69.008	3	3010.5625	3010.5625	R	L	40	70
PSM	HQLLEADISAHEDRLK	150	sp|Q13813-3|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=4777	32.46	2	1873.9646	1873.9646	K	D	1680	1696
PSM	HSQYHVDGSLEKDR	151	sp|Q96HS1|PGAM5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=1996	14.899	2	1669.7808	1669.7808	R	T	105	119
PSM	HYNGEAYEDDEHHPR	152	sp|P31689|DNJA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	15-UNIMOD:267	ms_run[2]:scan=1158	9.7095	3	1877.7593	1877.7593	R	G	375	390
PSM	KPVGEVHSQFSTGHANSPCTIIIGK	153	sp|P46013-2|KI67_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	19-UNIMOD:4	ms_run[2]:scan=5063	34.271	3	2663.349	2663.3490	K	A	337	362
PSM	KYFDFLSSYSAVNQGHCHPK	154	sp|P04181|OAT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	17-UNIMOD:4	ms_run[2]:scan=7206	48.034	3	2384.1008	2384.1008	R	I	77	97
PSM	LQCPQVDLFYLHAPDHGTPVEETLHACQR	155	sp|O43488|ARK72_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:4,27-UNIMOD:4,29-UNIMOD:267	ms_run[2]:scan=8734	58.269	3	3440.6269	3440.6269	R	L	130	159
PSM	LVPGRHDIAFVEFENDGQAGAAR	156	sp|P08579|RU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=6853	45.698	3	2468.2197	2468.2197	R	D	182	205
PSM	RGEDGLHGIVSCTACGQQVNHFQK	157	sp|P46100-3|ATRX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	12-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=4938	33.483	3	2697.25	2697.2500	K	D	43	67
PSM	SAATLITHPFHVITLR	158	sp|Q9Y6C9|MTCH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	16-UNIMOD:267	ms_run[2]:scan=8231	54.796	2	1786.0129	1786.0129	R	S	132	148
PSM	SAATLITHPFHVITLR	159	sp|Q9Y6C9|MTCH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=8235	54.819	2	1776.0046	1776.0046	R	S	132	148
PSM	SKPHSEAGTAFIQTQQLHAAMADTFLEHMCR	160	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:1,30-UNIMOD:4	ms_run[2]:scan=10156	68.296	4	3554.6493	3554.6493	M	L	2	33
PSM	SRAHLVAVFNEYQR	161	sp|P50995-2|ANX11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:267,14-UNIMOD:267	ms_run[2]:scan=5313	35.832	2	1708.8912	1708.8912	R	M	354	368
PSM	YGNRGHNQPCLLVGSGR	162	sp|P27708|PYR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:267,10-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=3369	23.587	2	1903.9338	1903.9338	R	C	271	288
PSM	YVATLGVEVHPLVFHTNR	163	sp|P62826|RAN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=7817	52.033	2	2051.0952	2051.0952	K	G	39	57
PSM	QATYGYYLGNPAEFHDSSDHHTFKK	164	sp|Q15293|RCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:28	ms_run[1]:scan=6548	43.75599166666667	2	2895.2885	2895.2883	K	M	142	167
PSM	QLFHPEQLITGKEDAANNYAR	165	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:28	ms_run[1]:scan=8778	58.55587833333333	3	2397.1759	2397.1708	R	G	85	106
PSM	QSQHDKIDASELSFPFHESILK	166	sp|P42166|LAP2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:28,6-UNIMOD:188,22-UNIMOD:188	ms_run[1]:scan=9447	63.123290000000004	3	2550.2749	2550.2788	K	V	479	501
PSM	LQVKEHQHEEIQNVR	167	sp|Q6DD88|ATLA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	4-UNIMOD:188,15-UNIMOD:267	ms_run[1]:scan=2077	15.409104999999998	2	1901.996355	1902.004256	R	N	236	251
PSM	MNSGHSFSQTPSASFHGAGGGWGRPR	168	sp|Q9C075|K1C23_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	1-UNIMOD:1	ms_run[1]:scan=5986	40.12726	3	2714.213605	2714.215665	-	S	1	27
PSM	AIEMLGGELGSKIPVHPNDHVNK	169	sp|P07954-2|FUMH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	12-UNIMOD:188,23-UNIMOD:188	ms_run[2]:scan=6723	44.855	2	2466.3092	2466.3092	R	S	118	141
PSM	AIQWGEDGRPFHYLFYTGK	170	sp|P82933|RT09_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=9589	64.118	2	2284.1065	2284.1065	R	Q	137	156
PSM	DTRDQFLDTLQAHGHDVNSFVR	171	sp|Q15021|CND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=8244	54.882	4	2570.2262	2570.2262	R	S	360	382
PSM	ELYERPPHLFAIADAAYK	172	sp|O94832|MYO1D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=8150	54.258	2	2103.0789	2103.0789	R	A	70	88
PSM	HHNQPYCGIAPYIR	173	sp|P08621|RU17_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	7-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=5104	34.53	2	1734.8288	1734.8288	K	E	33	47
PSM	HLMHLELDISDSK	174	sp|P16435|NCPR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	13-UNIMOD:188	ms_run[2]:scan=6352	42.506	2	1542.7808	1542.7808	R	I	299	312
PSM	HLQLAIRNDEELNK	175	sp|Q99878|H2A1J_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=4589	31.27	2	1691.8955	1691.8955	R	L	83	97
PSM	HRVVGAVIDQGLITR	176	sp|E9PRG8|CK098_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=5270	35.571	2	1632.9424	1632.9424	R	H	34	49
PSM	HYAHTDCPGHADYVK	177	sp|P49411|EFTU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	7-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=1316	10.658	2	1775.7781	1775.7781	R	N	121	136
PSM	IKGEHPGLSIGDVAK	178	sp|P09429|HMGB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=4205	28.848	2	1531.8761	1531.8761	K	K	113	128
PSM	KGSEHQAIVQHLEK	179	sp|Q14690|RRP5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=1870	14.111	2	1602.8478	1602.8478	R	S	924	938
PSM	KHQILEQAVEDYAETVHQLSK	180	sp|Q01082-3|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=9701	64.903	3	2465.2551	2465.2551	K	T	1620	1641
PSM	KPGINVASDWSIHLR	181	sp|Q14697|GANAB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=7293	48.59	2	1691.9107	1691.9107	R	-	930	945
PSM	KSNAHYNLQNAFNLAEQHLGLTK	182	sp|Q01082-3|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=9561	63.927	3	2610.3303	2610.3303	K	L	214	237
PSM	LKTNHIGHTGYLNTVTVSPDGSLCASGGK	183	sp|P63244|RACK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	24-UNIMOD:4	ms_run[2]:scan=5522	37.177	3	2983.4822	2983.4822	K	D	184	213
PSM	LNFSHGTHEYHAETIK	184	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=3347	23.452	2	1882.8962	1882.8962	R	N	74	90
PSM	LQCPQVDLFYLHAPDHGTPVEETLHACQR	185	sp|O43488|ARK72_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:4,27-UNIMOD:4	ms_run[2]:scan=8741	58.313	3	3430.6187	3430.6187	R	L	130	159
PSM	LRAFHNEAQVNPER	186	sp|P17987|TCPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:267,14-UNIMOD:267	ms_run[2]:scan=2723	19.438	2	1699.8657	1699.8657	K	K	467	481
PSM	LRAPIICVLGHVDTGK	187	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	7-UNIMOD:4	ms_run[2]:scan=7482	49.823	2	1747.9767	1747.9767	K	T	629	645
PSM	LVPGRHDIAFVEFENDGQAGAAR	188	sp|P08579|RU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=6870	45.811	2	2468.2197	2468.2197	R	D	182	205
PSM	MFPHHSITESVNYDVK	189	sp|Q8WUM0|NU133_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:35	ms_run[2]:scan=4724	32.118	2	1918.8883	1918.8883	R	T	67	83
PSM	MIKNEVDMQVLHLLGPK	190	sp|P47897-2|SYQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:35	ms_run[2]:scan=8818	58.83	3	1980.0536	1980.0536	K	L	153	170
PSM	MIKNEVDMQVLHLLGPK	191	sp|P47897-2|SYQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:35	ms_run[2]:scan=8828	58.896	2	1980.0536	1980.0536	K	L	153	170
PSM	MKLPQFGISTPGSDLHVNAK	192	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:35	ms_run[2]:scan=6708	44.76	2	2155.1096	2155.1096	K	G	5406	5426
PSM	QLFHPEQLITGKEDAANNYAR	193	sp|P68363-2|TBA1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=6937	46.253	3	2414.1979	2414.1979	R	G	85	106
PSM	RGSNTTSHLHQAVAK	194	sp|P22695|QCR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=770	7.4089	2	1605.8336	1605.8336	K	A	301	316
PSM	RLHTLEEVNNNVR	195	sp|Q9NZ52-3|GGA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=3047	21.53	2	1592.8383	1592.8383	K	L	92	105
PSM	RLSTLILHGGGTVCR	196	sp|Q9NYB0|TE2IP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:267,14-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=4807	32.651	2	1658.9153	1658.9153	R	V	41	56
PSM	SIIPLPHPVRPEDIE	197	sp|P61599|NAA20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=7923	52.716	2	1710.9305	1710.9305	K	-	164	179
PSM	SYIYSGSHDGHINYWDSETGENDSFAGKGHTNQVSR	198	sp|O75083-3|WDR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=5802	38.972	3	4014.743	4014.7430	K	M	195	231
PSM	TFEEKDIELHLESSSHQETLDHIQK	199	sp|Q5BKZ1-3|ZN326_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=6484	43.356	3	2992.4414	2992.4414	R	Q	115	140
PSM	TKGVDEVTIVNILTNR	200	sp|P07355-2|ANXA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=9793	65.576	2	1770.984	1770.9840	K	S	66	82
PSM	TQHHVEALVEHQNGK	201	sp|Q9H0U6|RM18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=1468	11.594	2	1725.8547	1725.8547	R	V	86	101
PSM	TVQGSGHQEHINIHK	202	sp|Q14247-3|SRC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=1200	9.9616	2	1683.8441	1683.8441	K	L	43	58
PSM	GQAGGKLHIIEVGTPPTGNQPFPK	203	sp|Q00610|CLH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=6552	43.780748333333335	2	2443.299424	2442.301943	R	K	222	246
PSM	HYNGEAYEDDEHHPR	204	sp|P31689|DNJA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	15-UNIMOD:267	ms_run[1]:scan=1471	11.612366666666667	2	1878.740654	1877.759272	R	G	375	390
PSM	HKITSADGHIESSALLK	205	sp|Q8N573|OXR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=3693	25.619405	3	1806.965232	1805.963562	K	E	532	549
PSM	CLLLHPAGHAEPAAGSHR	206	sp|Q96S55|WRIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:385,1-UNIMOD:4,18-UNIMOD:267	ms_run[1]:scan=5507	37.079636666666666	2	1885.9192	1885.9240	R	A	39	57
PSM	AFGFSHLEALLDDSKELQR	207	sp|Q96FW1|OTUB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=10540	71.124	3	2175.096	2175.0960	R	F	95	114
PSM	ALEHAFQLEHIMDLTR	208	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	16-UNIMOD:267	ms_run[2]:scan=9320	62.219	3	1932.9755	1932.9755	K	L	2436	2452
PSM	ASALRHEEQPAPGYDTHGR	209	sp|Q07157-2|ZO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	5-UNIMOD:267,19-UNIMOD:267	ms_run[2]:scan=1772	13.499	2	2111.0048	2111.0048	R	L	1072	1091
PSM	CENKHIANYISGIQTIGHR	210	sp|Q15393|SF3B3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:4	ms_run[2]:scan=5813	39.046	3	2210.1015	2210.1015	K	V	981	1000
PSM	DCQLNAHKDHQYQFLEDAVR	211	sp|Q13263-2|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:4	ms_run[2]:scan=6057	40.593	2	2486.1397	2486.1397	R	N	149	169
PSM	DTRDQFLDTLQAHGHDVNSFVR	212	sp|Q15021|CND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=8245	54.887	2	2570.2262	2570.2262	R	S	360	382
PSM	DYHFKVDNDENEHQLSLR	213	sp|P06748-3|NPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=5441	36.637	2	2258.0352	2258.0352	K	T	28	46
PSM	ELHINLIPNKQDR	214	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=5625	37.836	2	1588.8685	1588.8685	K	T	75	88
PSM	FLEHKGPVFAPPYEPLPENVK	215	sp|P11387|TOP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	5-UNIMOD:188,21-UNIMOD:188	ms_run[2]:scan=7687	51.166	2	2419.2979	2419.2979	K	F	219	240
PSM	FVNLGIEPPKGVLLFGPPGTGK	216	sp|P35998-2|PRS7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=10910	73.989	3	2236.262	2236.2620	R	T	64	86
PSM	GATYGKPVHHGVNQLK	217	sp|P61313-2|RL15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=1319	10.673	2	1716.9462	1716.9462	K	F	78	94
PSM	GLHVVEIREECGPLPIVVASPR	218	sp|P82675|RT05_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	8-UNIMOD:267,11-UNIMOD:4,22-UNIMOD:267	ms_run[2]:scan=8613	57.43	2	2446.3269	2446.3269	K	G	367	389
PSM	GYAFIEYEHERDMHSAYK	219	sp|P08621|RU17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=5463	36.79	2	2244.9899	2244.9899	R	H	145	163
PSM	HGVYNPNKIFGVTTLDIVR	220	sp|P40926|MDHM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=8878	59.229	2	2142.1586	2142.1586	K	A	158	177
PSM	HHNQSTAINLNNPESQSMHLETR	221	sp|Q14152-2|EIF3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	18-UNIMOD:35	ms_run[2]:scan=3819	26.409	3	2673.2314	2673.2314	R	L	177	200
PSM	HLAGELGYQPEHIDSFTHEACPVR	222	sp|P08138-2|TNR16_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	21-UNIMOD:4	ms_run[2]:scan=6308	42.226	4	2762.2871	2762.2871	R	A	267	291
PSM	HLDHVAALFPGDVDR	223	sp|P11216|PYGB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	15-UNIMOD:267	ms_run[2]:scan=6324	42.329	2	1670.8404	1670.8404	R	L	411	426
PSM	HLFEKELAGQSR	224	sp|O00515|LAD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=3367	23.576	2	1413.7365	1413.7365	R	A	443	455
PSM	HRVIGSGCNLDSAR	225	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	8-UNIMOD:4	ms_run[2]:scan=2028	15.098	2	1540.7529	1540.7529	K	F	157	171
PSM	HSQFIGYPITLFVEKER	226	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9784	65.507	3	2063.084	2063.0840	K	D	210	227
PSM	HSVSIHSFQSTSLHNSK	227	sp|Q9ULE6|PALD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	17-UNIMOD:188	ms_run[2]:scan=3201	22.515	2	1900.9487	1900.9487	R	A	31	48
PSM	HYAHTDCPGHADYVK	228	sp|P49411|EFTU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:4	ms_run[2]:scan=1309	10.614	2	1769.758	1769.7580	R	N	121	136
PSM	IGYPKPALLHSTFFPALQGAQTK	229	sp|P23381-2|SYWC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9296	62.065	3	2484.3529	2484.3529	R	M	286	309
PSM	KHISQISVAEDDDESLLGHLMIVGK	230	sp|P49773|HINT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	21-UNIMOD:35	ms_run[2]:scan=8725	58.211	3	2749.3956	2749.3956	K	K	58	83
PSM	LRHVVSCSSQDSTHCAENLLK	231	sp|P18887|XRCC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=4179	28.689	3	2440.1587	2440.1587	R	A	6	27
PSM	LVDEPGHCADFHPSGTVVAIGTHSGR	232	sp|Q9HC35-2|EMAL4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	8-UNIMOD:4	ms_run[2]:scan=5405	36.404	3	2715.2823	2715.2823	R	W	573	599
PSM	LVDEPGHCADFHPSGTVVAIGTHSGR	233	sp|Q9HC35-2|EMAL4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	8-UNIMOD:4,26-UNIMOD:267	ms_run[2]:scan=5415	36.468	3	2725.2906	2725.2906	R	W	573	599
PSM	NLHHELELGVVMGK	234	sp|Q6P587|FAHD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=6049	40.542	2	1574.8239	1574.8239	R	R	67	81
PSM	RFGVPVIADGGIQNVGHIAK	235	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7504	49.963	2	2047.1327	2047.1327	R	A	356	376
PSM	RHVFGESDELIGQK	236	sp|P60174-4|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=4406	30.114	2	1613.8162	1613.8162	R	V	18	32
PSM	SAVADKHELLSLASSNHLGK	237	sp|O15372|EIF3H_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=5767	38.749	2	2076.0964	2076.0964	K	N	222	242
PSM	SEEAHAEDSVMDHHFR	238	sp|Q8NC51-3|PAIRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=3679	25.529	2	1895.7857	1895.7857	K	K	315	331
PSM	SHLLNCCPHDVLSGTR	239	sp|Q9Y383-3|LC7L2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:4,7-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=4683	31.856	2	1874.8755	1874.8755	K	M	35	51
PSM	SKIVGAPMHDLLLWNNATVTTCHSK	240	sp|P11586|C1TC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:188,22-UNIMOD:4,25-UNIMOD:188	ms_run[2]:scan=8074	53.751	3	2804.4504	2804.4504	R	T	174	199
PSM	SKPHSEAGTAFIQTQQLHAAMADTFLEHMCR	241	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:1,21-UNIMOD:35,30-UNIMOD:4	ms_run[2]:scan=8842	58.992	4	3570.6442	3570.6442	M	L	2	33
PSM	TGVHHYSGNNIELGTACGKYYR	242	sp|P62888|RL30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	17-UNIMOD:4	ms_run[2]:scan=4276	29.291	3	2496.1604	2496.1604	K	V	69	91
PSM	VGTTEKEHEEHVCSILASLLR	243	sp|Q8WYA6-3|CTBL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:4	ms_run[2]:scan=9313	62.176	3	2407.2166	2407.2166	K	N	144	165
PSM	VILHLKEDQTEYLEER	244	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=5929	39.772	3	2014.0371	2014.0371	K	R	181	197
PSM	YGAHNYHPLPVALER	245	sp|P04181|OAT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	15-UNIMOD:267	ms_run[2]:scan=5088	34.43	2	1745.8877	1745.8877	K	G	50	65
PSM	YQLSIHKNPNTSEPQHLLVMK	246	sp|P05023-2|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=5738	38.559	2	2476.2897	2476.2897	K	G	488	509
PSM	FAASGGFLHHMAGLSSSK	247	sp|Q9BY77-2|PDIP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6347	42.471	2	1803.8726	1803.8726	K	L	172	190
PSM	FKSHTDQLVLIFAGK	248	sp|Q9UMX0-4|UBQL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=7951	52.893	2	1714.9809	1714.9809	R	I	69	84
PSM	GKDHVVSDFSEHGSLK	249	sp|P54886-2|P5CS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=3040	21.491	3	1752.8834	1752.8834	R	Y	764	780
PSM	GKDHVVSDFSEHGSLK	250	sp|P54886-2|P5CS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=3041	21.497	3	1740.8431	1740.8431	R	Y	764	780
PSM	GKHDGSHEGTVYFK	251	sp|Q15813|TBCE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=1869	14.105	2	1572.7724	1572.7724	R	C	47	61
PSM	HGLLVPNNTTDQELQHIR	252	sp|P56537|IF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	18-UNIMOD:267	ms_run[2]:scan=5915	39.685	3	2094.0846	2094.0846	R	N	68	86
PSM	HHLQPENPGPGGAAPSLEQNR	253	sp|Q14684-2|RRP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	21-UNIMOD:267	ms_run[2]:scan=3411	23.856	3	2215.0758	2215.0758	K	G	389	410
PSM	HHNQSTAINLNNPESQSMHLETR	254	sp|Q14152-2|EIF3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	18-UNIMOD:35,23-UNIMOD:267	ms_run[2]:scan=3820	26.415	3	2683.2396	2683.2396	R	L	177	200
PSM	HKVNEHEQDGNELQTTPEFR	255	sp|Q96C57|CSTOS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=3440	24.04	3	2407.1153	2407.1153	R	A	64	84
PSM	HLNEIDLFHCIDPNDSK	256	sp|Q15185-3|TEBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	10-UNIMOD:4	ms_run[2]:scan=8191	54.529	2	2065.9527	2065.9527	K	H	49	66
PSM	HLREYQDLLNVK	257	sp|P08670|VIME_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5723	38.466	2	1526.8205	1526.8205	R	M	379	391
PSM	HRVIGSGCNLDSAR	258	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:267,8-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=2026	15.081	3	1560.7694	1560.7694	K	F	157	171
PSM	HRVVGAVIDQGLITR	259	sp|E9PRG8|CK098_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:267,15-UNIMOD:267	ms_run[2]:scan=5272	35.581	2	1652.9589	1652.9589	R	H	34	49
PSM	IAQNDHDLGDMSTVADPSVISHLFSHR	260	sp|Q9NR19|ACSA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	27-UNIMOD:267	ms_run[2]:scan=9958	66.85	3	2971.4122	2971.4122	K	C	670	697
PSM	IAVDEVHCCSQWGHDFRPDYK	261	sp|P46063|RECQ1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	8-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=6058	40.599	3	2618.1431	2618.1431	R	A	216	237
PSM	IGYPKPALLHSTFFPALQGAQTK	262	sp|P23381-2|SYWC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9271	61.896	2	2484.3529	2484.3529	R	M	286	309
PSM	IISKIENHEGVR	263	sp|P14618|KPYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=2102	15.567	2	1393.7678	1393.7678	K	R	267	279
PSM	IMYTVFEHTFHVR	264	sp|P41250|GARS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:267	ms_run[2]:scan=8063	53.677	2	1688.8373	1688.8373	R	E	584	597
PSM	KAHQDIHTQLQDVK	265	sp|O00461|GOLI4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=2107	15.597	2	1659.8693	1659.8693	R	Q	187	201
PSM	KDTSNHFHVFVGDLSPEITTEDIK	266	sp|P31483-2|TIA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:188,24-UNIMOD:188	ms_run[2]:scan=8311	55.329	2	2740.3747	2740.3747	K	A	89	113
PSM	KPPQPPGPCWFCLASPEVEK	267	sp|Q69YN2-3|C19L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=9183	61.305	3	2323.1129	2323.1129	R	H	183	203
PSM	NHICNFFDFDTFGGHIK	268	sp|Q8WUJ3-2|CEMIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	4-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=9737	65.139	3	2073.9463	2073.9463	R	F	513	530
PSM	NIHKLLDEVFFSEK	269	sp|P25789|PSA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9877	66.235	2	1717.9039	1717.9039	R	I	51	65
PSM	NRFSLVPHNYGLVLYENK	270	sp|Q96TA1-2|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8165	54.357	3	2162.1273	2162.1273	R	A	74	92
PSM	RLFQQILSGVDYCHR	271	sp|Q13131|AAPK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:267,13-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=7766	51.683	3	1910.9688	1910.9688	R	H	129	144
PSM	RVLIAAHGNSLR	272	sp|P18669|PGAM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=2592	18.623	2	1305.763	1305.7630	K	G	180	192
PSM	RVNAIEHVIIPR	273	sp|Q9Y5K8|VATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5003	33.895	2	1415.8361	1415.8361	R	I	168	180
PSM	SEEAHAEDSVMDHHFR	274	sp|Q8NC51-3|PAIRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	16-UNIMOD:267	ms_run[2]:scan=3692	25.613	2	1905.7939	1905.7939	K	K	315	331
PSM	SISFHPSGDFILVGTQHPTLR	275	sp|Q05048|CSTF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8589	57.235	3	2308.1964	2308.1964	R	L	222	243
PSM	SPLLAGGSPPQPVVPAHKDK	276	sp|Q8NFH5-2|NUP35_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	18-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=4714	32.054	2	2006.1352	2006.1352	R	S	49	69
PSM	TQHHVEALVEHQNGK	277	sp|Q9H0U6|RM18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	15-UNIMOD:188	ms_run[2]:scan=1464	11.567	2	1731.8748	1731.8748	R	V	86	101
PSM	VLQCHKPVHAEYLEK	278	sp|Q9NZJ9-3|NUDT4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	4-UNIMOD:4	ms_run[2]:scan=2460	17.801	2	1849.9509	1849.9509	K	L	77	92
PSM	VNESSHYDLAFTDVHFKPGQIR	279	sp|P29144|TPP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=7334	48.854	3	2559.2506	2559.2506	K	R	639	661
PSM	YFLHTGHLTIAGCK	280	sp|P49589-2|SYCC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=5653	38.017	2	1622.8335	1622.8335	R	M	393	407
PSM	YHTINGHNAEVRK	281	sp|P22626-2|ROA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=960	8.5293	2	1537.775	1537.7750	K	A	162	175
PSM	YHTINGHNCEVKK	282	sp|P51991-2|ROA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:4	ms_run[2]:scan=852	7.8845	2	1598.7624	1598.7624	K	A	166	179
PSM	YQLSIHKNPNTSEPQHLLVMK	283	sp|P05023-2|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5732	38.519	3	2476.2897	2476.2897	K	G	488	509
PSM	HGVSHKVDDSSGSIGR	284	sp|P41250|GARS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=906	8.206758333333333	3	1636.798706	1636.791746	R	R	641	657
PSM	VGAVDADKHHSLGGQYGVQGFPTIK	285	sp|Q15084|PDIA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	8-UNIMOD:188,25-UNIMOD:188	ms_run[1]:scan=6188	41.418668333333336	2	2592.341446	2592.348743	K	I	78	103
PSM	IAVDEVHCCSQWGHDFRPDYK	286	sp|P46063|RECQ1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	8-UNIMOD:4,9-UNIMOD:4,17-UNIMOD:267,21-UNIMOD:188	ms_run[1]:scan=6068	40.66016	2	2634.166429	2634.171475	R	A	216	237
PSM	TYFPHFDLSHGSAQVK	287	sp|P69905|HBA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=6854	45.70371666666667	2	1832.882159	1832.884583	K	G	42	58
PSM	AIEMLGGELGSKIPVHPNDHVNK	288	sp|P07954-2|FUMH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6721	44.843	3	2454.2689	2454.2689	R	S	118	141
PSM	APKPDGPGGGPGGSHMGGNYGDDR	289	sp|P35637-2|FUS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=2361	17.173	3	2251.9665	2251.9665	K	R	448	472
PSM	CILPFDKETGFHR	290	sp|Q9GZT3-2|SLIRP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:4	ms_run[2]:scan=6431	43.013	2	1618.7926	1618.7926	R	G	48	61
PSM	CILPFDKETGFHR	291	sp|Q9GZT3-2|SLIRP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:4	ms_run[2]:scan=6433	43.025	3	1618.7926	1618.7926	R	G	48	61
PSM	GDAVRDVDIIDHHDNTYTVK	292	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5200	35.138	2	2282.0927	2282.0927	K	Y	917	937
PSM	GFHCESSAHWPIFK	293	sp|P55884|EIF3B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=6572	43.908	2	1707.7923	1707.7923	R	W	417	431
PSM	GIDIHGVPYVINVTLPDEKQNYVHR	294	sp|Q92499-3|DDX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9058	60.459	3	2875.4981	2875.4981	R	I	450	475
PSM	GKHYYEVSCHDQGLCR	295	sp|Q92499-3|DDX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	9-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=2638	18.908	3	2007.868	2007.8680	K	V	3	19
PSM	GSSVDAPPRPCHTTPDSQFGTEHVLR	296	sp|Q9BSJ8|ESYT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	11-UNIMOD:4	ms_run[2]:scan=4649	31.645	3	2847.3358	2847.3358	R	I	625	651
PSM	HEEAPGHRPTTNPNASK	297	sp|P21291|CSRP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=591	6.3937	2	1841.8769	1841.8769	K	F	92	109
PSM	HHCPNTPIILVGTK	298	sp|P63000|RAC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:4	ms_run[2]:scan=4380	29.949	2	1585.8399	1585.8399	R	L	103	117
PSM	HIQHDTIGYLLTR	299	sp|Q14CX7-2|NAA25_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6069	40.666	2	1565.8314	1565.8314	K	Y	536	549
PSM	HKEDVYENLHTK	300	sp|P29350-2|PTN6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=1839	13.922	2	1523.7771	1523.7771	K	N	520	532
PSM	HLQVNVTNPVQCSLHGKK	301	sp|O94832|MYO1D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:4	ms_run[2]:scan=4415	30.17	3	2058.0793	2058.0793	R	C	959	977
PSM	HRDEVVAEHPDASGEEIEELLR	302	sp|O96028-5|NSD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:267,22-UNIMOD:267	ms_run[2]:scan=7441	49.561	3	2549.2261	2549.2261	K	S	467	489
PSM	HRGQAAQPEPSTGFTATPPAPDSPQEPLVLR	303	sp|Q9BVT8|TMUB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:267,31-UNIMOD:267	ms_run[2]:scan=6827	45.522	3	3271.6489	3271.6489	R	L	76	107
PSM	HRVIGSGCNLDSAR	304	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	8-UNIMOD:4	ms_run[2]:scan=2029	15.104	3	1540.7529	1540.7529	K	F	157	171
PSM	HSVDLIGRPFGSK	305	sp|Q96FX7|TRM61_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5107	34.547	2	1411.7572	1411.7572	R	V	45	58
PSM	HSVSIHSFQSTSLHNSK	306	sp|Q9ULE6|PALD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=3218	22.626	2	1894.9286	1894.9286	R	A	31	48
PSM	ISMPDFDLHLKGPK	307	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7989	53.149	2	1596.8334	1596.8334	K	V	2579	2593
PSM	KHFPSVNWLISYSK	308	sp|P38606-2|VATA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=8067	53.7	2	1704.8988	1704.8988	R	Y	410	424
PSM	KLASQGDSISSQLGPIHPPPR	309	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5394	36.334	3	2184.1651	2184.1651	K	T	122	143
PSM	LADFGVLHRNELSGALTGLTR	310	sp|P26639|SYTC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	9-UNIMOD:267,21-UNIMOD:267	ms_run[2]:scan=9209	61.487	2	2259.2239	2259.2239	R	V	434	455
PSM	LKDAVAHCHEAER	311	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	8-UNIMOD:4	ms_run[2]:scan=755	7.3214	2	1534.7311	1534.7311	R	N	181	194
PSM	LLHIEELRELQTK	312	sp|Q9Y224|RTRAF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6741	44.969	2	1620.9199	1620.9199	R	I	206	219
PSM	LQCPQVDLFYLHAPDHGTPVEETLHACQR	313	sp|O43488|ARK72_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:4,27-UNIMOD:4,29-UNIMOD:267	ms_run[2]:scan=8748	58.359	2	3440.6269	3440.6269	R	L	130	159
PSM	LRAPIICVLGHVDTGK	314	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	7-UNIMOD:4	ms_run[2]:scan=7489	49.87	3	1747.9767	1747.9767	K	T	629	645
PSM	LVDEPGHCADFHPSGTVVAIGTHSGR	315	sp|Q9HC35-2|EMAL4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	8-UNIMOD:4	ms_run[2]:scan=5407	36.417	4	2715.2823	2715.2823	R	W	573	599
PSM	MFPHHSITESVNYDVK	316	sp|Q8WUM0|NU133_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:35,16-UNIMOD:188	ms_run[2]:scan=4725	32.124	2	1924.9085	1924.9085	R	T	67	83
PSM	NHTHQQDIDDLKR	317	sp|P61244-3|MAX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=1433	11.376	2	1618.7812	1618.7812	K	Q	78	91
PSM	RHQYSDYDYHSSSEK	318	sp|Q9UDY2-5|ZO2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=1443	11.438	2	1900.7976	1900.7976	R	L	420	435
PSM	RIPHTDPVDYEFQWGPR	319	sp|Q96MG7|NSE3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7547	50.244	3	2112.0177	2112.0177	R	T	237	254
PSM	RSYDVPPPPMEPDHPFYSNISK	320	sp|P18669|PGAM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6700	44.707	3	2572.2057	2572.2057	R	D	117	139
PSM	SAYHSHKDQALLSK	321	sp|Q5T4S7-3|UBR4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=1245	10.23	2	1583.8056	1583.8056	R	A	2548	2562
PSM	SIFDHIKLPQASK	322	sp|Q9NYF8-4|BCLF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	7-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=7453	49.638	2	1494.8597	1494.8597	R	S	414	427
PSM	SLENYHFVDEHGKDQGINIR	323	sp|Q14677|EPN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5681	38.2	3	2370.1353	2370.1353	R	Q	110	130
PSM	SRGFGFITFTNPEHASVAMR	324	sp|P98179|RBM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:267,20-UNIMOD:267	ms_run[2]:scan=8453	56.314	3	2244.1013	2244.1013	R	A	46	66
PSM	SSALQWLTPEQTSGKEHPYLFSQCQAIHCR	325	sp|P09960-4|LKHA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	24-UNIMOD:4,29-UNIMOD:4	ms_run[2]:scan=8496	56.599	3	3558.6773	3558.6773	K	A	89	119
PSM	TDNAGDQHGGGGGGGGGAGAAGGGGGGENYDDPHKTPASPVVHIR	326	sp|P14866|HNRPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=3666	25.45	4	4037.7985	4037.7985	K	G	63	108
PSM	THASPADLCHYHSQESDGLVCLLK	327	sp|P43405-2|KSYK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	9-UNIMOD:4,21-UNIMOD:4	ms_run[2]:scan=6998	46.649	4	2737.2588	2737.2588	R	K	81	105
PSM	TPLLGDGPRAPFNQEGQSTGPPPLIPGLGQQGAQGR	328	sp|Q9C0J8|WDR33_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9573	64.01	3	3607.8495	3607.8495	K	I	907	943
PSM	VGAVDADKHHSLGGQYGVQGFPTIK	329	sp|Q15084-3|PDIA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6164	41.271	2	2580.3085	2580.3085	K	I	75	100
PSM	VLHMVGDKPVFSFQPR	330	sp|Q9NP81|SYSM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7256	48.356	2	1855.9767	1855.9767	R	G	188	204
PSM	VLQCHKPVHAEYLEK	331	sp|Q9NZJ9-3|NUDT4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:4,6-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=2449	17.735	2	1861.9911	1861.9911	K	L	77	92
PSM	ASFNHFDKDHGGALGPEEFK	332	sp|O43707|ACTN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=5657	38.040866666666666	2	2202.993542	2202.013031	R	A	772	792
PSM	KAGLLVLAVLSDGAGDHIR	333	sp|Q8TEX9|IPO4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	1-UNIMOD:188,19-UNIMOD:267	ms_run[1]:scan=9988	67.07305166666667	3	1920.108396	1920.112744	R	Q	370	389
PSM	HYNGEAYEDDEHHPR	334	sp|P31689|DNJA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=1613	12.491831666666666	2	1868.732484	1867.751003	R	G	375	390
PSM	KGLIAAICAGPTALLAHEIGFGSK	335	sp|Q99497|PARK7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	8-UNIMOD:4	ms_run[1]:scan=11129	75.81396333333333	3	2395.307346	2394.309337	R	V	99	123
PSM	VHELKEHNGQVTGIDWAPESNR	336	sp|O15143|ARC1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=5212	35.21329333333333	2	2516.197273	2515.220398	K	I	45	67
PSM	CWKFEHCNFNDVTTR	337	sp|P13987|CD59_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:385,1-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=7647	50.911834999999996	3	1995.8367	1995.8351	K	L	64	79
PSM	AGVLAHLEEERDLK	338	sp|P35579-2|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5499	37.027	2	1578.8366	1578.8366	R	I	629	643
PSM	GFGFVSFERHEDAQK	339	sp|P11940-2|PABP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6205	41.526	2	1752.822	1752.8220	K	A	232	247
PSM	GFHCESSAHWPIFK	340	sp|P55884|EIF3B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	4-UNIMOD:4	ms_run[2]:scan=6559	43.825	2	1701.7722	1701.7722	R	W	417	431
PSM	GGFCNFMHLKPISR	341	sp|Q01081-4|U2AF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	4-UNIMOD:4	ms_run[2]:scan=7275	48.474	2	1662.8123	1662.8123	R	E	93	107
PSM	GHYTEGAELVDSVLDVVRK	342	sp|P68371|TBB4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10635	71.874	3	2086.0695	2086.0695	K	E	104	123
PSM	HHGIPFYVAAPSSSCDLR	343	sp|Q9BV20-2|MTNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	15-UNIMOD:4,18-UNIMOD:267	ms_run[2]:scan=6238	41.736	2	2022.9609	2022.9609	K	L	224	242
PSM	HKWNDFAEDSLR	344	sp|O60313-13|OPA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5413	36.457	2	1516.7059	1516.7059	R	V	676	688
PSM	HLILVVNYSCPNHYEDYVHR	345	sp|Q7L014|DDX46_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	10-UNIMOD:4,20-UNIMOD:267	ms_run[2]:scan=6932	46.219	3	2537.2149	2537.2149	K	A	687	707
PSM	HQLLEADISAHEDRLK	346	sp|Q13813-3|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=4775	32.448	3	1873.9646	1873.9646	K	D	1680	1696
PSM	HRDYETATLSDIK	347	sp|O43707|ACTN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=4015	27.629	2	1547.758	1547.7580	K	A	438	451
PSM	IRSHAVACVNQFIISR	348	sp|Q92973-3|TNPO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	8-UNIMOD:4	ms_run[2]:scan=5899	39.587	3	1869.9996	1869.9996	K	T	148	164
PSM	KEVVHTVSLHEIDVINSR	349	sp|Q9Y230-2|RUVB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5840	39.217	3	2074.1171	2074.1171	R	T	191	209
PSM	KFVIHPESNNLIIIETDHNAYTEATK	350	sp|Q15393|SF3B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7572	50.411	2	2996.5244	2996.5244	R	A	787	813
PSM	KHFPSVNWLISYSK	351	sp|P38606-2|VATA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=8068	53.706	2	1716.939	1716.9390	R	Y	410	424
PSM	KHPEVDVLINFASLR	352	sp|P53396|ACLY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9324	62.248	2	1736.9574	1736.9574	R	S	562	577
PSM	LADFGVLHRNELSGALTGLTR	353	sp|P26639|SYTC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9180	61.287	3	2239.2073	2239.2073	R	V	434	455
PSM	LLVPGKIQHILCTGNLCTK	354	sp|Q9UBQ0|VPS29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:4,17-UNIMOD:4	ms_run[2]:scan=8302	55.272	3	2164.186	2164.1861	K	E	25	44
PSM	MIKPFFHSLSEK	355	sp|P10599|THIO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:35	ms_run[2]:scan=5260	35.511	2	1478.7592	1478.7592	K	Y	37	49
PSM	NIKLGIHEDSQNR	356	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=2793	19.873	2	1522.7852	1522.7852	K	K	444	457
PSM	NVLGHMQQGGAPSPFDRNFGTK	357	sp|Q01813-2|PFKAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6476	43.305	2	2357.1335	2357.1335	K	I	659	681
PSM	NVPLPEFPEHPFQEEHLK	358	sp|P14735|IDE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	18-UNIMOD:188	ms_run[2]:scan=7959	52.946	2	2192.0998	2192.0998	K	Q	282	300
PSM	RFGTVLTEHVAAAELGAR	359	sp|O43598-2|DNPH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:267,18-UNIMOD:267	ms_run[2]:scan=6639	44.327	2	1917.0335	1917.0335	R	G	48	66
PSM	RVNAIEHVIIPR	360	sp|Q9Y5K8|VATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:267,12-UNIMOD:267	ms_run[2]:scan=5018	33.989	2	1435.8527	1435.8527	R	I	168	180
PSM	SDPYLEFHKQTSDGNWLMVHR	361	sp|O75131|CPNE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7578	50.452	3	2559.1965	2559.1965	K	T	159	180
PSM	SEEAHAEDSVMDHHFR	362	sp|Q8NC51-3|PAIRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:35	ms_run[2]:scan=2523	18.186	2	1911.7806	1911.7806	K	K	315	331
PSM	SSFDWLTGSSTDPLVDHTSPSSDSLLFAHKR	363	sp|P78527-2|PRKDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10057	67.56	3	3389.6164	3389.6164	R	S	2654	2685
PSM	TEWLDGKHVVFGK	364	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	7-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=6134	41.082	2	1526.8284	1526.8284	K	V	119	132
PSM	THINIVVIGHVDSGK	365	sp|P68104-2|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5420	36.503	3	1587.8733	1587.8733	K	S	6	21
PSM	THINIVVIGHVDSGK	366	sp|P68104-2|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	15-UNIMOD:188	ms_run[2]:scan=5404	36.399	3	1593.8934	1593.8934	K	S	6	21
PSM	THMQNIKDITSSIHFEAYR	367	sp|Q9UHD8-4|SEPT9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7619	50.729	3	2290.1165	2290.1165	R	V	292	311
PSM	TLHPAVHAGILAR	368	sp|P31939-2|PUR9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:267	ms_run[2]:scan=3911	26.978	2	1364.7916	1364.7916	K	N	66	79
PSM	TVYCNVHKHEPLVLFCESCDTLTCR	369	sp|Q13263-2|TIF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	4-UNIMOD:4,16-UNIMOD:4,19-UNIMOD:4,24-UNIMOD:4	ms_run[2]:scan=7099	47.338	3	3137.4191	3137.4191	R	D	124	149
PSM	YFLHTGHLTIAGCK	370	sp|P49589-2|SYCC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:4	ms_run[2]:scan=5646	37.97	2	1616.8133	1616.8133	R	M	393	407
PSM	CHAIIDEQPLIFKNDPYHPDHFNCANCGK	371	sp|P48059|LIMS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:385,1-UNIMOD:4,24-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=8114	54.017158333333334	3	3492.5435	3492.5433	K	E	138	167
PSM	QIFLGGVDKHTQFWR	372	sp|P12236|ADT3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:28	ms_run[1]:scan=9770	65.397285	2	1813.9263	1813.9259	K	Y	97	112
PSM	ALEHSALAINHKLEIK	373	sp|P17812-2|PYRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=4867	33.03	3	1786.0101	1786.0101	K	Y	89	105
PSM	DAVGQPPRETDFMAFHQEHEVR	374	sp|O94901-6|SUN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5807	39.006	3	2595.1925	2595.1925	R	M	310	332
PSM	DCQLNAHKDHQYQFLEDAVR	375	sp|Q13263-2|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:4	ms_run[2]:scan=6086	40.785	3	2486.1397	2486.1397	R	N	149	169
PSM	EDTEEHHLRDYFEQYGK	376	sp|P09651-3|ROA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6413	42.897	2	2194.9556	2194.9556	K	I	114	131
PSM	GHFGPINSVAFHPDGK	377	sp|Q13347|EIF3I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5778	38.819	3	1678.8216	1678.8216	K	S	283	299
PSM	GHFGPINSVAFHPDGK	378	sp|Q13347|EIF3I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	16-UNIMOD:188	ms_run[2]:scan=5774	38.796	2	1684.8417	1684.8417	K	S	283	299
PSM	GLHVVEIREECGPLPIVVASPR	379	sp|P82675|RT05_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:4	ms_run[2]:scan=8586	57.213	2	2426.3104	2426.3104	K	G	367	389
PSM	GVDEVTIVNILTNR	380	sp|P07355-2|ANXA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	14-UNIMOD:267	ms_run[2]:scan=10932	74.199	2	1551.8496	1551.8496	K	S	68	82
PSM	HFLLEEDKPEEPTAHAFVSTLTR	381	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7911	52.644	4	2666.334	2666.3340	R	G	1516	1539
PSM	HGLLVPNNTTDQELQHIR	382	sp|P56537|IF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5900	39.593	3	2084.0763	2084.0763	R	N	68	86
PSM	HKEDVYENLHTK	383	sp|P29350-2|PTN6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=1830	13.866	2	1511.7369	1511.7369	K	N	520	532
PSM	HMNSVPQKPALIPQPTFTEK	384	sp|P57740-3|NU107_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	8-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=6006	40.262	3	2274.2233	2274.2233	K	V	527	547
PSM	HRVIGSGCNLDSAR	385	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:267,8-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=2023	15.066	2	1560.7694	1560.7694	K	F	157	171
PSM	HYNGEAYEDDEHHPR	386	sp|P31689|DNJA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=1161	9.7261	3	1867.751	1867.7510	R	G	375	390
PSM	KAHQDIHTQLQDVK	387	sp|O00461|GOLI4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=2111	15.624	2	1671.9095	1671.9095	R	Q	187	201
PSM	KAHQLWLSVEALK	388	sp|Q16891-3|MIC60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=7042	46.944	2	1533.907	1533.9070	R	Y	533	546
PSM	KFFGSLPDSWASGHSVPVVTVVR	389	sp|Q9BUP3|HTAI2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9426	62.977	3	2471.2961	2471.2961	R	A	186	209
PSM	KHISQISVAEDDDESLLGHLMIVGK	390	sp|P49773|HINT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9713	64.979	4	2733.4007	2733.4007	K	K	58	83
PSM	KSNAHYNLQNAFNLAEQHLGLTK	391	sp|Q01082-3|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9585	64.088	2	2610.3303	2610.3303	K	L	214	237
PSM	KTSQLLETLNQLSTHTHVVDITR	392	sp|Q14203-5|DCTN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9584	64.082	3	2633.4137	2633.4137	R	T	1012	1035
PSM	LHFFMPGFAPLTSR	393	sp|P68371|TBB4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	5-UNIMOD:35,14-UNIMOD:267	ms_run[2]:scan=9172	61.234	2	1645.8314	1645.8314	R	G	263	277
PSM	LKLEQIDGHIAEHNSK	394	sp|Q9NTJ3|SMC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=4249	29.118	3	1830.9588	1830.9588	K	I	1016	1032
PSM	LLVPGKIQHILCTGNLCTK	395	sp|Q9UBQ0|VPS29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	6-UNIMOD:188,12-UNIMOD:4,17-UNIMOD:4,19-UNIMOD:188	ms_run[2]:scan=8301	55.267	3	2176.2263	2176.2263	K	E	25	44
PSM	LTVNEAVKEGVVGPELHHK	396	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	8-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=5480	36.905	2	2067.1515	2067.1515	R	L	2885	2904
PSM	LVPGRHDIAFVEFENDGQAGAAR	397	sp|P08579|RU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	5-UNIMOD:267,23-UNIMOD:267	ms_run[2]:scan=6892	45.96	3	2488.2362	2488.2362	R	D	182	205
PSM	MIPCDFLIPVQTQHPIRK	398	sp|P06744|G6PI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	4-UNIMOD:4	ms_run[2]:scan=8370	55.73	2	2192.1598	2192.1598	K	G	401	419
PSM	MREIVHLQAGQCGNQIGAK	399	sp|P68371|TBB4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:4	ms_run[2]:scan=4530	30.897	3	2109.0572	2109.0572	-	F	1	20
PSM	RALIVLAHSER	400	sp|P15559-3|NQO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:267,11-UNIMOD:267	ms_run[2]:scan=3393	23.741	2	1283.7577	1283.7577	R	T	5	16
PSM	RHVFGESDELIGQK	401	sp|P60174-4|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=4407	30.119	3	1613.8162	1613.8162	R	V	18	32
PSM	RLEAFEHPNVVR	402	sp|P11802|CDK4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=4320	29.57	2	1465.779	1465.7790	R	L	62	74
PSM	RLFQQILSGVDYCHR	403	sp|Q13131|AAPK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:4	ms_run[2]:scan=7768	51.695	3	1890.9523	1890.9523	R	H	129	144
PSM	RYNIPHGPVVGSTR	404	sp|P50402|EMD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:267,14-UNIMOD:267	ms_run[2]:scan=3865	26.686	2	1571.8435	1571.8435	R	R	18	32
PSM	SCGSSSHENRPLDLLHK	405	sp|Q7Z6Z7-2|HUWE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:4	ms_run[2]:scan=3828	26.466	2	1935.9221	1935.9221	K	M	3242	3259
PSM	SFFHQHYLGGQEPTPSNIR	406	sp|P46379-4|BAG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5806	39	2	2214.0606	2214.0606	R	M	655	674
PSM	SISFHPSGDFILVGTQHPTLR	407	sp|Q05048|CSTF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	21-UNIMOD:267	ms_run[2]:scan=8583	57.195	3	2318.2047	2318.2047	R	L	222	243
PSM	SSALQWLTPEQTSGKEHPYLFSQCQAIHCR	408	sp|P09960-4|LKHA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	24-UNIMOD:4,29-UNIMOD:4	ms_run[2]:scan=8489	56.552	4	3558.6773	3558.6773	K	A	89	119
PSM	TAFHQEQGHQLLKK	409	sp|P51580|TPMT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=2004	14.95	2	1663.8794	1663.8794	K	H	38	52
PSM	TEWLDGKHVVFGK	410	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6136	41.093	2	1514.7882	1514.7882	K	V	119	132
PSM	TGTITTFEHAHNMR	411	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=3721	25.796	2	1614.7573	1614.7573	K	V	482	496
PSM	TGVHHYSGNNIELGTACGKYYR	412	sp|P62888|RL30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	17-UNIMOD:4,19-UNIMOD:188,22-UNIMOD:267	ms_run[2]:scan=4279	29.31	2	2512.1888	2508.2007	K	V	69	91
PSM	THASPADLCHYHSQESDGLVCLLK	413	sp|P43405-2|KSYK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	9-UNIMOD:4,21-UNIMOD:4	ms_run[2]:scan=6992	46.609	3	2737.2588	2737.2588	R	K	81	105
PSM	THASPADLCHYHSQESDGLVCLLK	414	sp|P43405-2|KSYK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	9-UNIMOD:4,21-UNIMOD:4	ms_run[2]:scan=6994	46.62	2	2737.2588	2737.2588	R	K	81	105
PSM	THPSVVPGSIAFSLPQRK	415	sp|P46459|NSF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6758	45.075	2	1920.0581	1920.0581	K	W	51	69
PSM	VCHKDHEISYAK	416	sp|Q5T4S7-3|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:4,4-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=896	8.1458	2	1497.7437	1497.7437	K	Y	1697	1709
PSM	VPFSPGPAPPPHMGELDQER	417	sp|Q6Y7W6-4|GGYF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	20-UNIMOD:267	ms_run[2]:scan=6448	43.124	3	2167.0396	2167.0396	R	L	584	604
PSM	YHTINGHNCEVKK	418	sp|P51991-2|ROA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	9-UNIMOD:4,12-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=851	7.8791	2	1610.8026	1610.8026	K	A	166	179
PSM	YVLENHPGTNSNYQMHLLKK	419	sp|Q5SSJ5-3|HP1B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5035	34.094	3	2385.1899	2385.1899	K	T	215	235
PSM	HSQFIGYPITLFVEKER	420	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=9792	65.57005833333334	2	2063.083400	2063.084011	K	D	210	227
PSM	GYAFIEYEHERDMHSAYK	421	sp|P08621|RU17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	11-UNIMOD:267,13-UNIMOD:35,18-UNIMOD:188	ms_run[1]:scan=4957	33.603775	2	2277.010392	2277.013166	R	H	145	163
PSM	QATYGYYLGNPAEFHDSSDHHTFKK	422	sp|Q15293|RCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:28	ms_run[1]:scan=6563	43.852048333333336	3	2895.2929	2895.2883	K	M	142	167
PSM	HRPQVAIICGSGLGGLTDK	423	sp|P00491|PNPH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	9-UNIMOD:4	ms_run[1]:scan=6297	42.154133333333334	2	1978.051302	1978.041829	K	L	23	42
PSM	SHEVKAEGYEVAHGGR	424	sp|P53041|PPP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	5-UNIMOD:188,16-UNIMOD:267	ms_run[1]:scan=1591	12.359630000000001	3	1740.844808	1740.851444	R	C	426	442
PSM	VHELKEHNGQVTGIDWAPESNR	425	sp|O15143|ARC1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=5206	35.17809333333334	3	2516.200458	2515.220398	K	I	45	67
PSM	QSQHDKIDASELSFPFHESILK	426	sp|P42166|LAP2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:28,6-UNIMOD:188,22-UNIMOD:188	ms_run[1]:scan=9448	63.12947833333333	4	2550.2755	2550.2788	K	V	479	501
PSM	LLLHLEELQMEHDIR	427	sp|Q9HCE1|MOV10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	15-UNIMOD:267	ms_run[1]:scan=8564	57.04826333333333	2	1899.007298	1897.995937	R	H	342	357
PSM	HGKEYCLGPTHEEAITALIASQK	428	sp|Q7L3T8|SYPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	6-UNIMOD:4	ms_run[1]:scan=6894	45.97126333333333	3	2554.3312	2552.2692	R	K	148	171
PSM	AILIFNNHGKPR	429	sp|Q92572|AP3S1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4237	29.04	2	1378.7834	1378.7834	K	L	4	16
PSM	ASITPGTILIILTGR	430	sp|Q02878|RL6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	15-UNIMOD:267	ms_run[2]:scan=12368	91.436	2	1534.9322	1534.9322	R	H	142	157
PSM	DTRDQFLDTLQAHGHDVNSFVR	431	sp|Q15021|CND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	3-UNIMOD:267,22-UNIMOD:267	ms_run[2]:scan=8260	54.987	4	2590.2427	2590.2427	R	S	360	382
PSM	EQSHKVYVQHLLK	432	sp|P16435|NCPR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3006	21.282	2	1607.8784	1607.8784	R	Q	598	611
PSM	ESKFFEHFIEGGR	433	sp|Q96FW1|OTUB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7261	48.389	2	1581.7576	1581.7576	R	T	186	199
PSM	HHCPNTPIILVGTK	434	sp|P63000|RAC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	3-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=4379	29.943	2	1591.86	1591.8600	R	L	103	117
PSM	HHGDVMDLQFFDQER	435	sp|Q8NFH3-2|NUP43_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	15-UNIMOD:267	ms_run[2]:scan=8083	53.808	3	1882.8296	1882.8296	R	I	73	88
PSM	HHLQPENPGPGGAAPSLEQNR	436	sp|Q14684-2|RRP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3410	23.851	3	2205.0675	2205.0675	K	G	389	410
PSM	HHPSNKEEEGLANGSAAEPAMPNTYGVEPLPQEVLK	437	sp|P49736|MCM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7616	50.71	3	3839.8425	3839.8425	R	K	686	722
PSM	HKIPVMALVGNDAGWTQISR	438	sp|A1L0T0|ILVBL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8707	58.089	3	2192.1524	2192.1524	R	E	537	557
PSM	HKITSADGHIESSALLK	439	sp|Q8N573-6|OXR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=3703	25.683	3	1818.0038	1818.0038	K	E	21	38
PSM	HLEINPDHPIVETLR	440	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	15-UNIMOD:267	ms_run[2]:scan=6171	41.315	3	1791.9507	1791.9507	K	Q	625	640
PSM	HLHPIQTSFQEATASK	441	sp|Q8TEM1|PO210_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	16-UNIMOD:188	ms_run[2]:scan=4281	29.322	3	1799.9262	1799.9262	R	V	1561	1577
PSM	HPGSFDVVHVK	442	sp|P62701|RS4X_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:188	ms_run[2]:scan=3595	24.993	2	1226.6503	1226.6503	R	D	201	212
PSM	IEHLYKNPQAHIEGNMK	443	sp|O60547-2|GMDS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	6-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=3379	23.65	3	2033.0555	2033.0555	R	L	35	52
PSM	IGTQGNVNFGGRPQLPGSHPASSPAQGNR	444	sp|P43405-2|KSYK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4978	33.739	3	2900.439	2900.4390	K	Q	262	291
PSM	IKGEHPGLSIGDVAK	445	sp|P09429|HMGB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4198	28.804	3	1519.8358	1519.8358	K	K	113	128
PSM	IKGEHPGLSIGDVAK	446	sp|P09429|HMGB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=4200	28.815	3	1531.8761	1531.8761	K	K	113	128
PSM	ILHQHLGAPEER	447	sp|Q9NZM1-5|MYOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=2269	16.601	2	1398.7368	1398.7368	K	L	1231	1243
PSM	ILHQHLGAPEER	448	sp|Q9NZM1-5|MYOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:267	ms_run[2]:scan=2262	16.557	2	1408.7451	1408.7451	K	L	1231	1243
PSM	IMYTVFEHTFHVR	449	sp|P41250|GARS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8059	53.65	2	1678.829	1678.8290	R	E	584	597
PSM	INFDKYHPGYFGK	450	sp|P46776|RL27A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5861	39.349	2	1584.7725	1584.7725	R	V	43	56
PSM	IRSFPDFPTPGVVFR	451	sp|P07741-2|APT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9766	65.365	2	1733.9253	1733.9253	R	D	13	28
PSM	KHEAFESDLAAHQDR	452	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:188,15-UNIMOD:267	ms_run[2]:scan=2508	18.09	2	1768.8464	1764.8582	R	V	455	470
PSM	KHPEVDVLINFASLR	453	sp|P53396|ACLY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9325	62.254	3	1736.9574	1736.9574	R	S	562	577
PSM	LEGHGDPLHLEEVKR	454	sp|P08034|CXB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4310	29.507	2	1727.8955	1727.8955	R	H	108	123
PSM	LIGHHGAEDATDAFR	455	sp|Q9Y5Q0|FADS3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3784	26.186	2	1608.7645	1608.7645	R	A	61	76
PSM	LKHYGPGWVSMANAGK	456	sp|P23284|PPIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=5001	33.883	3	1726.9016	1726.9016	K	D	130	146
PSM	LKLEPHEGLLLR	457	sp|P08195-2|4F2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5947	39.879	3	1416.8453	1416.8453	R	F	513	525
PSM	LKLEQIDGHIAEHNSK	458	sp|Q9NTJ3|SMC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=4258	29.177	3	1842.9991	1842.9991	K	I	1016	1032
PSM	LNKPQPQPSPLLSTHHTQEEDISSK	459	sp|Q2NKX8|ERC6L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4007	27.577	4	2810.4199	2810.4199	K	M	747	772
PSM	LTVNEAVKEGVVGPELHHK	460	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5440	36.631	2	2055.1113	2055.1113	R	L	2885	2904
PSM	LTVNEAVKEGVVGPELHHK	461	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5452	36.717	2	2055.1113	2055.1113	R	L	2885	2904
PSM	LVPGRHDIAFVEFENDGQAGAAR	462	sp|P08579|RU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	5-UNIMOD:267,23-UNIMOD:267	ms_run[2]:scan=6864	45.772	2	2488.2362	2488.2362	R	D	182	205
PSM	LWLDNTENDLNQGDDHGFSPLHWACR	463	sp|Q13418|ILK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	25-UNIMOD:4	ms_run[2]:scan=10166	68.371	3	3109.3737	3109.3737	R	E	18	44
PSM	MIKPFFHSLSEK	464	sp|P10599|THIO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:35,3-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=5273	35.586	2	1490.7994	1490.7994	K	Y	37	49
PSM	MNSGHSFSQTPSASFHGAGGGWGRPR	465	sp|Q9C075|K1C23_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:1	ms_run[2]:scan=6002	40.234	2	2714.2157	2714.2157	-	S	1	27
PSM	NVPTDVLSFPFHEHLK	466	sp|P58557|YBEY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	16-UNIMOD:188	ms_run[2]:scan=9022	60.216	2	1884.983	1884.9830	R	A	58	74
PSM	PPSAFFLFCSEYRPK	467	sp|P09429|HMGB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	9-UNIMOD:4	ms_run[2]:scan=10015	67.267	3	1844.892	1844.8920	R	I	98	113
PSM	RAEQEAQAPHWWR	468	sp|Q96DV4|RM38_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:267,13-UNIMOD:267	ms_run[2]:scan=4767	32.396	3	1683.8133	1683.8133	R	T	60	73
PSM	RGDFIHVMDNSDPNWWK	469	sp|P62993-2|GRB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8835	58.943	2	2115.9585	2115.9585	R	G	138	155
PSM	RLEGTNVTVNVLHPGIVR	470	sp|Q9HBH5|RDH14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6465	43.234	3	1973.117	1973.1170	R	T	234	252
PSM	RPGANHEGSASR	471	sp|Q9NY26|S39A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=402	5.2901	2	1237.5912	1237.5912	R	Q	54	66
PSM	RQFHLTDDDLLR	472	sp|Q04446|GLGB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6039	40.48	2	1527.7794	1527.7794	R	Y	565	577
PSM	SAATLITHPFHVITLR	473	sp|Q9Y6C9|MTCH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8234	54.814	3	1776.0046	1776.0046	R	S	132	148
PSM	SDPYLEFHKQTSDGNWLMVHR	474	sp|O75131|CPNE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7581	50.47	2	2559.1965	2559.1965	K	T	159	180
PSM	SFFHQHYLGGQEPTPSNIR	475	sp|P46379-4|BAG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	19-UNIMOD:267	ms_run[2]:scan=5799	38.955	3	2224.0689	2224.0689	R	M	655	674
PSM	SHEVKAEGYEVAHGGR	476	sp|P53041|PPP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	5-UNIMOD:188,16-UNIMOD:267	ms_run[2]:scan=1589	12.348	2	1740.8514	1736.8633	R	C	426	442
PSM	SHSAHFFEFLTK	477	sp|P30046-2|DOPD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7120	47.47	2	1449.7041	1449.7041	R	E	76	88
PSM	SKPHSEAGTAFIQTQQLHAAMADTFLEHMCR	478	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:1,21-UNIMOD:35,29-UNIMOD:35,30-UNIMOD:4	ms_run[2]:scan=7483	49.829	3	3586.6392	3586.6392	M	L	2	33
PSM	SKPHSEAGTAFIQTQQLHAAMADTFLEHMCR	479	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:1,21-UNIMOD:35,29-UNIMOD:35,30-UNIMOD:4	ms_run[2]:scan=7506	49.979	4	3586.6392	3586.6392	M	L	2	33
PSM	SPLLAGGSPPQPVVPAHKDK	480	sp|Q8NFH5-2|NUP35_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4708	32.014	2	1994.0949	1994.0949	R	S	49	69
PSM	TAFHQEQGHQLLKK	481	sp|P51580|TPMT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=2002	14.939	2	1675.9197	1675.9197	K	H	38	52
PSM	TGISHGHTVYVVHDGFEGLAK	482	sp|P17858|PFKAL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5332	35.948	3	2223.1073	2223.1073	R	G	424	445
PSM	TGTITTFEHAHNMR	483	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	14-UNIMOD:267	ms_run[2]:scan=3716	25.763	2	1624.7655	1624.7655	K	V	482	496
PSM	TQHHVEALVEHQNGK	484	sp|Q9H0U6|RM18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=1477	11.651	3	1725.8547	1725.8547	R	V	86	101
PSM	VCHKDHEISYAK	485	sp|Q5T4S7-3|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:4	ms_run[2]:scan=898	8.1566	2	1485.7034	1485.7034	K	Y	1697	1709
PSM	VGAVDADKHHSLGGQYGVQGFPTIK	486	sp|Q15084-3|PDIA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6163	41.265	3	2580.3085	2580.3085	K	I	75	100
PSM	HRAFEDEMSGR	487	sp|Q01082|SPTB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=2353	17.123935	2	1333.588110	1333.583333	K	S	680	691
PSM	CHAIIDEQPLIFKNDPYHPDHFNCANCGK	488	sp|P48059|LIMS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:385,1-UNIMOD:4,24-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=8118	54.045775	4	3492.5473	3492.5433	K	E	138	167
PSM	AFGFSHLEALLDDSKELQR	489	sp|Q96FW1|OTUB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	15-UNIMOD:188,19-UNIMOD:267	ms_run[1]:scan=10548	71.17905666666667	2	2192.122404	2191.124431	R	F	95	114
PSM	VALEGLRPTIPPGISPHVCK	490	sp|Q13418|ILK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	7-UNIMOD:267,19-UNIMOD:4,20-UNIMOD:188	ms_run[1]:scan=7432	49.50174666666667	2	2156.215337	2156.211078	K	L	404	424
PSM	HYNGEAYEDDEHHPR	491	sp|P31689|DNJA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	15-UNIMOD:267	ms_run[1]:scan=1474	11.62851	3	1878.740182	1877.759272	R	G	375	390
PSM	CMQLTDFILKFPHSAHQK	492	sp|P50914|RL14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:35,10-UNIMOD:188,18-UNIMOD:188	ms_run[1]:scan=10572	71.34860666666667	2	2211.0938	2211.1002	K	Y	54	72
PSM	DTRDQFLDTLQAHGHDVNSFVR	493	sp|Q15021|CND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:267,22-UNIMOD:267	ms_run[1]:scan=8259	54.980398333333326	3	2591.249410	2590.242750	R	S	360	382
PSM	AKEMDLVGLGLHPLFSSR	494	sp|Q8TDD1|DDX54_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=9747	65.20717333333333	3	1970.046772	1969.045517	R	F	534	552
PSM	YHTINGHNCEVKK	495	sp|P51991|ROA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	9-UNIMOD:4,12-UNIMOD:188,13-UNIMOD:188	ms_run[1]:scan=1043	9.020171666666666	2	1611.7922	1610.8022	K	A	188	201
PSM	YHTINGHNCEVKK	496	sp|P51991|ROA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	9-UNIMOD:4	ms_run[1]:scan=1036	8.975315	2	1599.7532	1598.7622	K	A	188	201
PSM	LLGHWEEAAHDLALACK	497	sp|P50502|F10A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	16-UNIMOD:4,17-UNIMOD:188	ms_run[1]:scan=8179	54.448053333333334	3	1939.961006	1938.971746	R	L	194	211
PSM	MREIVHIQAGQCGNQIGAK	498	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	2-UNIMOD:267,12-UNIMOD:4,19-UNIMOD:188	ms_run[1]:scan=4529	30.890790000000003	3	2125.082252	2125.085560	-	F	1	20
PSM	MREIVHIQAGQCGNQIGAK	499	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:35,2-UNIMOD:267,12-UNIMOD:4,19-UNIMOD:188	ms_run[1]:scan=3763	26.056983333333335	3	2141.079602	2141.080475	-	F	1	20
FHPSGDFILVGTQHPTLR	463	sp|Q05048|CSTF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	21-UNIMOD:267	ms_run[1]:scan=8583	57.194583333333334	3	2318.210224	2318.204685	R	L	222	243
PSM	LHAIKEQLIQEGLLDR	464	sp|Q9UBN7|HDAC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	5-UNIMOD:188,16-UNIMOD:267	ms_run[1]:scan=6882	45.893945	3	1891.088685	1891.086195	R	C	112	128
PSM	RHVFGESDELIGQK	465	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=4407	30.119320000000002	3	1613.812267	1613.816169	R	V	137	151
PSM	RHVFGESDELIGQK	466	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	1-UNIMOD:267,14-UNIMOD:188	ms_run[1]:scan=4404	30.102725	3	1629.840378	1629.844567	R	V	137	151
PSM	HRVIGSGCNLDSAR	467	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	2-UNIMOD:267,8-UNIMOD:4,14-UNIMOD:267	ms_run[1]:scan=2023	15.065585	2	1560.766110	1560.769396	K	F	157	171
PSM	SFFHQHYLGGQEPTPSNIR	468	sp|P46379|BAG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=5806	39.00005	2	2214.054347	2214.060650	R	M	787	806
PSM	LKDAVAHCHEAER	469	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	2-UNIMOD:188,8-UNIMOD:4,13-UNIMOD:267	ms_run[1]:scan=762	7.36233	2	1550.760461	1550.759458	R	N	181	194
PSM	LLVPGKIQHILCTGNLCTK	470	sp|Q9UBQ0|VPS29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	6-UNIMOD:188,12-UNIMOD:4,17-UNIMOD:4,19-UNIMOD:188	ms_run[1]:scan=8301	55.26688333333334	3	2176.228307	2176.226309	K	E	25	44
PSM	VPFSPGPAPPPHMGELDQER	471	sp|Q6Y7W6|GGYF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	20-UNIMOD:267	ms_run[1]:scan=6448	43.12387833333333	3	2167.040688	2167.039593	R	L	590	610
PSM	RLFQQILSGVDYCHR	472	sp|Q13131|AAPK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	13-UNIMOD:4	ms_run[1]:scan=7768	51.695040000000006	3	1890.954350	1890.952286	R	H	129	144
PSM	HKEDVYENLHTK	473	sp|P29350|PTN6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1830	13.866383333333335	2	1511.733862	1511.736856	K	N	559	571
PSM	KTSQLLETLNQLSTHTHVVDITR	474	sp|Q14203|DCTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=9584	64.08236833333333	3	2633.409392	2633.413679	R	T	1151	1174
PSM	YHTINGHNCEVKK	475	sp|P51991|ROA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	9-UNIMOD:4,12-UNIMOD:188,13-UNIMOD:188	ms_run[1]:scan=851	7.879115	2	1610.808768	1610.802618	K	A	188	201
PSM	HMNSVPQKPALIPQPTFTEK	476	sp|P57740|NU107_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	8-UNIMOD:188,20-UNIMOD:188	ms_run[1]:scan=6006	40.261925	3	2274.222368	2274.223332	K	V	766	786
PSM	SRGFGFITFTNPEHASVAMR	477	sp|P98179|RBM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=8445	56.262165	3	2224.087481	2224.084757	R	A	46	66
PSM	LKLEQIDGHIAEHNSK	478	sp|Q9NTJ3|SMC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=4249	29.117751666666667	3	1830.956900	1830.958811	K	I	1016	1032
PSM	GHFGPINSVAFHPDGK	479	sp|Q13347|EIF3I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	16-UNIMOD:188	ms_run[1]:scan=5774	38.79596	2	1684.840564	1684.841718	K	S	283	299
PSM	GHFGPINSVAFHPDGK	480	sp|Q13347|EIF3I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=5778	38.81862666666667	3	1678.819789	1678.821589	K	S	283	299
PSM	HGLLVPNNTTDQELQHIR	481	sp|P56537|IF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=5900	39.59275833333333	3	2084.077748	2084.076300	R	N	68	86
PSM	CILPFDKETGFHR	482	sp|Q9GZT3|SLIRP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	1-UNIMOD:4,7-UNIMOD:188,13-UNIMOD:267	ms_run[1]:scan=6438	43.05902666666667	2	1634.824638	1634.820995	R	G	48	61
PSM	ALEHSALAINHKLEIK	483	sp|P17812|PYRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=4867	33.03005666666667	3	1786.010137	1786.010118	K	Y	320	336
PSM	RYNIPHGPVVGSTR	484	sp|P50402|EMD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	1-UNIMOD:267,14-UNIMOD:267	ms_run[1]:scan=3865	26.685563333333334	2	1571.842473	1571.843547	R	R	18	32
PSM	KAHQLWLSVEALK	485	sp|Q16891|MIC60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	1-UNIMOD:188,13-UNIMOD:188	ms_run[1]:scan=7042	46.94363666666666	2	1533.908333	1533.907006	R	Y	565	578
PSM	SLFFPDEAINKHPR	486	sp|P48506|GSH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	11-UNIMOD:188,14-UNIMOD:267	ms_run[1]:scan=6406	42.850525	2	1685.884802	1685.886038	K	F	172	186
PSM	RALIVLAHSER	487	sp|P15559|NQO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	1-UNIMOD:267,11-UNIMOD:267	ms_run[1]:scan=3393	23.741283333333335	2	1283.757970	1283.757692	R	T	5	16
PSM	LLLHLEELQMEHDIR	488	sp|Q9HCE1|MOV10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	15-UNIMOD:267	ms_run[1]:scan=8564	57.04826333333333	2	1899.007298	1897.995937	R	H	342	357
PSM	YVLENHPGTNSNYQMHLLKK	489	sp|Q5SSJ5|HP1B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=5035	34.09429166666667	3	2385.192513	2385.189950	K	T	367	387
PSM	KAHQDIHTQLQDVK	490	sp|O00461|GOLI4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	1-UNIMOD:188,14-UNIMOD:188	ms_run[1]:scan=2111	15.62365	2	1671.906180	1671.909526	R	Q	187	201
PSM	RLEAFEHPNVVR	491	sp|P11802|CDK4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=4320	29.570216666666667	2	1465.778802	1465.778996	R	L	62	74
PSM	TAFHQEQGHQLLKK	492	sp|P51580|TPMT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=2004	14.950028333333332	2	1663.877962	1663.879438	K	H	38	52
PSM	KFFGSLPDSWASGHSVPVVTVVR	493	sp|Q9BUP3|HTAI2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=9426	62.976958333333336	3	2471.288466	2471.296130	R	A	186	209
PSM	HGKEYCLGPTHEEAITALIASQK	494	sp|Q7L3T8|SYPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	6-UNIMOD:4	ms_run[1]:scan=6894	45.97126333333333	3	2554.3312	2552.2692	R	K	148	171
PSM	SCGSSSHENRPLDLLHK	495	sp|Q7Z6Z7|HUWE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	2-UNIMOD:4	ms_run[1]:scan=3828	26.465923333333333	2	1935.922806	1935.922108	K	M	3258	3275
PSM	MREIVHIQAGQCGNQIGAK	496	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	12-UNIMOD:4	ms_run[1]:scan=4530	30.89727166666667	3	2109.054428	2109.057162	-	F	1	20
PSM	SSALQWLTPEQTSGKEHPYLFSQCQAIHCR	497	sp|P09960|LKHA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	24-UNIMOD:4,29-UNIMOD:4	ms_run[1]:scan=8489	56.55229	4	3558.679922	3558.677257	K	A	113	143
PSM	VILHLKEDQTEYLEER	498	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	6-UNIMOD:188,16-UNIMOD:267	ms_run[1]:scan=5925	39.74697833333333	3	2030.068783	2030.065519	K	R	160	176
PSM	SKPHSEAGTAFIQTQQLHAAMADTFLEHMCR	499	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:1,21-UNIMOD:35,29-UNIMOD:35,30-UNIMOD:4	ms_run[1]:scan=7506	49.97929666666667	4	3586.6402	3586.6386	M	L	2	33
PSM	SKPHSEAGTAFIQTQQLHAAMADTFLEHMCR	500	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:1,21-UNIMOD:35,29-UNIMOD:35,30-UNIMOD:4	ms_run[1]:scan=7483	49.82897	3	3586.6348	3586.6386	M	L	2	33
PSM	SKPHSEAGTAFIQTQQLHAAMADTFLEHMCR	501	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:1,2-UNIMOD:188,21-UNIMOD:35,30-UNIMOD:4,31-UNIMOD:267	ms_run[1]:scan=8843	58.998034999999994	4	3586.6762	3586.6721	M	L	2	33
PSM	IISKIENHEGVR	502	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	4-UNIMOD:188,12-UNIMOD:267	ms_run[1]:scan=2101	15.561611666666668	2	1409.795027	1409.796161	K	R	267	279
PSM	HRAFEDEMSGR	503	sp|Q01082|SPTB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=2353	17.123935	2	1333.588110	1333.583333	K	S	680	691
PSM	LTVNEAVKEGVVGPELHHK	504	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=5452	36.71682333333333	2	2055.110353	2055.111289	R	L	2885	2904
PSM	HHLQPENPGPGGAAPSLEQNR	505	sp|Q14684|RRP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=3410	23.85096	3	2205.067336	2205.067527	K	G	407	428
PSM	HLEINPDHPIVETLR	506	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	15-UNIMOD:267	ms_run[1]:scan=6171	41.31460833333333	3	1791.951636	1791.950702	K	Q	625	640
PSM	YHTINGHNAEVRK	507	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	12-UNIMOD:267,13-UNIMOD:188	ms_run[1]:scan=968	8.580431666666666	2	1553.810159	1553.803371	K	A	174	187
PSM	CHAIIDEQPLIFKNDPYHPDHFNCANCGK	508	sp|P48059|LIMS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:385,1-UNIMOD:4,24-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=8118	54.045775	4	3492.5473	3492.5433	K	E	138	167
PSM	KHPEVDVLINFASLR	509	sp|P53396|ACLY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=9325	62.254081666666664	3	1736.960669	1736.957354	R	S	562	577
PSM	VCHKDHEISYAK	510	sp|Q5T4S7|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	2-UNIMOD:4	ms_run[1]:scan=898	8.156623333333334	2	1485.710174	1485.703448	K	Y	1697	1709
PSM	IMYTVFEHTFHVR	511	sp|P41250|GARS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=8059	53.649725	2	1678.831050	1678.828983	R	E	584	597
PSM	HHPSNKEEEGLANGSAAEPAMPNTYGVEPLPQEVLK	512	sp|P49736|MCM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=7616	50.710453333333334	3	3839.842095	3839.842468	R	K	686	722
PSM	YHTVNGHNCEVRK	513	sp|P09651|ROA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	9-UNIMOD:4,12-UNIMOD:267,13-UNIMOD:188	ms_run[1]:scan=707	7.0484816666666665	2	1628.782434	1628.781256	K	A	167	180
PSM	PPSAFFLFCSEYRPK	514	sp|P09429|HMGB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	9-UNIMOD:4	ms_run[1]:scan=10015	67.26740666666666	3	1844.887560	1844.891977	R	I	98	113
PSM	IKGEHPGLSIGDVAK	515	sp|B2RPK0|HGB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=4198	28.804076666666667	3	1519.833980	1519.835842	K	K	113	128
PSM	IKGEHPGLSIGDVAK	516	sp|B2RPK0|HGB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	2-UNIMOD:188,15-UNIMOD:188	ms_run[1]:scan=4200	28.815036666666664	3	1531.874189	1531.876100	K	K	113	128
PSM	GKHYYEVSCHDQGLCR	517	sp|Q92499|DDX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	2-UNIMOD:188,9-UNIMOD:4,15-UNIMOD:4,16-UNIMOD:267	ms_run[1]:scan=2637	18.901798333333335	3	2023.899347	2023.896362	K	V	131	147
PSM	AFGFSHLEALLDDSKELQR	518	sp|Q96FW1|OTUB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	15-UNIMOD:188,19-UNIMOD:267	ms_run[1]:scan=10548	71.17905666666667	2	2192.122404	2191.124431	R	F	95	114
PSM	ESKFFEHFIEGGR	519	sp|Q96FW1|OTUB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=7261	48.38904166666667	2	1581.759905	1581.757592	R	T	186	199
PSM	TGTITTFEHAHNMR	520	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	14-UNIMOD:267	ms_run[1]:scan=3716	25.762916666666666	2	1624.766527	1624.765543	K	V	482	496
PSM	RGHVFEESQVAGTPMFVVK	521	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:267,19-UNIMOD:188	ms_run[1]:scan=6794	45.309955	3	2133.103202	2133.101193	K	A	767	786
PSM	LWLDNTENDLNQGDDHGFSPLHWACR	522	sp|Q13418|ILK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	25-UNIMOD:4	ms_run[1]:scan=10166	68.37054	3	3109.365676	3109.373681	R	E	18	44
PSM	VALEGLRPTIPPGISPHVCK	523	sp|Q13418|ILK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	7-UNIMOD:267,19-UNIMOD:4,20-UNIMOD:188	ms_run[1]:scan=7432	49.50174666666667	2	2156.215337	2156.211078	K	L	404	424
PSM	IGTQGNVNFGGRPQLPGSHPASSPAQGNR	524	sp|P43405-2|KSYK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=4978	33.73901	3	2900.438813	2900.438999	K	Q	262	291
PSM	LKLEPHEGLLLR	525	sp|P08195|4F2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=5947	39.87936333333334	3	1416.845422	1416.845285	R	F	614	626
PSM	LVPGRHDIAFVEFENDGQAGAAR	526	sp|P08579|RU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	5-UNIMOD:267,23-UNIMOD:267	ms_run[1]:scan=6864	45.77177666666667	2	2488.236518	2488.236208	R	D	182	205
PSM	HYNGEAYEDDEHHPR	527	sp|P31689|DNJA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	15-UNIMOD:267	ms_run[1]:scan=1474	11.62851	3	1878.740182	1877.759272	R	G	375	390
PSM	VGAVDADKHHSLGGQYGVQGFPTIK	528	sp|Q15084|PDIA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=6163	41.26524833333333	3	2580.309229	2580.308485	K	I	78	103
PSM	RGDFIHVMDNSDPNWWK	529	sp|P62993|GRB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=8835	58.94332166666667	2	2115.961462	2115.958493	R	G	179	196
PSM	EQSHKVYVQHLLK	530	sp|P16435|NCPR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=3006	21.281523333333332	2	1607.879308	1607.878376	R	Q	598	611
PSM	TGISHGHTVYVVHDGFEGLAK	531	sp|P17858|PFKAL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=5332	35.94767	3	2223.108630	2223.107266	R	G	424	445
PSM	HKITSADGHIESSALLK	532	sp|Q8N573|OXR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	2-UNIMOD:188,17-UNIMOD:188	ms_run[1]:scan=3703	25.683278333333334	3	1818.002545	1818.003820	K	E	532	549
PSM	SFFHQHYLGGQEPTPSNIR	533	sp|P46379|BAG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	19-UNIMOD:267	ms_run[1]:scan=5799	38.954755	3	2224.067119	2224.068919	R	M	787	806
PSM	CMQLTDFILKFPHSAHQK	534	sp|P50914|RL14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:35,10-UNIMOD:188,18-UNIMOD:188	ms_run[1]:scan=10572	71.34860666666667	2	2211.0938	2211.1002	K	Y	54	72
PSM	LEGHGDPLHLEEVKR	535	sp|P08034|CXB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=4310	29.506759999999996	2	1727.894401	1727.895482	R	H	108	123
PSM	ASITPGTILIILTGR	536	sp|Q02878|RL6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	15-UNIMOD:267	ms_run[1]:scan=12368	91.43581166666667	2	1534.930648	1534.932198	R	H	142	157
PSM	RLEGTNVTVNVLHPGIVR	537	sp|Q9HBH5|RDH14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=6465	43.233805	3	1973.116220	1973.117043	R	T	234	252
PSM	MNSGHSFSQTPSASFHGAGGGWGRPR	538	sp|Q9C075|K1C23_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:1	ms_run[1]:scan=6002	40.23406666666667	2	2714.212385	2714.215665	-	S	1	27
PSM	HHGDVMDLQFFDQER	539	sp|Q8NFH3|NUP43_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	15-UNIMOD:267	ms_run[1]:scan=8083	53.807894999999995	3	1882.832085	1882.829600	R	I	73	88
PSM	HLHPIQTSFQEATASK	540	sp|Q8TEM1|PO210_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	16-UNIMOD:188	ms_run[1]:scan=4281	29.322205	3	1799.923304	1799.926176	R	V	1561	1577
PSM	HKIPVMALVGNDAGWTQISR	541	sp|A1L0T0|ILVBL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=8707	58.08882333333333	3	2192.156471	2192.152442	R	E	537	557
PSM	LKHYGPGWVSMANAGK	542	sp|P23284|PPIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	2-UNIMOD:188,16-UNIMOD:188	ms_run[1]:scan=5001	33.88306	3	1726.900334	1726.901603	K	D	130	146
PSM	DTRDQFLDTLQAHGHDVNSFVR	543	sp|Q15021|CND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:267,22-UNIMOD:267	ms_run[1]:scan=8259	54.980398333333326	3	2591.249410	2590.242750	R	S	360	382
PSM	DTRDQFLDTLQAHGHDVNSFVR	544	sp|Q15021|CND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:267,22-UNIMOD:267	ms_run[1]:scan=8260	54.986573333333325	4	2590.246643	2590.242750	R	S	360	382
PSM	AKEMDLVGLGLHPLFSSR	545	sp|Q8TDD1|DDX54_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=9747	65.20717333333333	3	1970.046772	1969.045517	R	F	534	552
PSM	SPLLAGGSPPQPVVPAHKDK	546	sp|Q8NFH5|NUP35_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=4708	32.013958333333335	2	1994.093789	1994.094911	R	S	66	86
PSM	HADIVTTTTHKTLR	547	sp|P34897|GLYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	11-UNIMOD:188,14-UNIMOD:267	ms_run[1]:scan=2313	16.877375	3	1608.891607	1608.891852	K	G	270	284
PSM	RPTPNDDTLDEGVGLVHSNIATEHIPSPAK	548	sp|Q01581|HMCS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:267,30-UNIMOD:188	ms_run[1]:scan=7518	50.054903333333336	4	3195.615164	3195.613118	R	K	469	499
PSM	IEHLYKNPQAHIEGNMK	549	sp|O60547|GMDS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	6-UNIMOD:188,17-UNIMOD:188	ms_run[1]:scan=3379	23.650185	3	2033.055195	2033.055538	R	L	65	82
PSM	HSVDLIGRPFGSK	550	sp|Q96FX7|TRM61_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	8-UNIMOD:267,13-UNIMOD:188	ms_run[1]:scan=5101	34.50828166666666	2	1427.786445	1427.785596	R	V	45	58
PSM	YHTINGHNCEVKK	551	sp|P51991|ROA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	9-UNIMOD:4,12-UNIMOD:188,13-UNIMOD:188	ms_run[1]:scan=1043	9.020171666666666	2	1611.7922	1610.8022	K	A	188	201
PSM	YHTINGHNCEVKK	552	sp|P51991|ROA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	9-UNIMOD:4	ms_run[1]:scan=1036	8.975315	2	1599.7532	1598.7622	K	A	188	201
PSM	AHIVFDFHQAADGIQEQQRQEQAGK	553	sp|P30520|PURA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	19-UNIMOD:267,25-UNIMOD:188	ms_run[1]:scan=6664	44.479258333333334	3	2866.407583	2866.408151	R	N	133	158
PSM	KGHAVGDIPGVR	554	sp|P62266|RS23_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:188,12-UNIMOD:267	ms_run[1]:scan=2629	18.85140666666667	2	1220.698708	1220.696053	R	F	108	120
PSM	SAATLITHPFHVITLR	555	sp|Q9Y6C9|MTCH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=8234	54.81371166666667	3	1776.006729	1776.004639	R	S	132	148
PSM	TQHHVEALVEHQNGK	556	sp|Q9H0U6|RM18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1477	11.650961666666667	3	1725.848918	1725.854680	R	V	86	101
PSM	RAEQEAQAPHWWR	557	sp|Q96DV4|RM38_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:267,13-UNIMOD:267	ms_run[1]:scan=4767	32.39573	3	1683.810103	1683.813309	R	T	60	73
PSM	SDPYLEFHKQTSDGNWLMVHR	558	sp|O75131|CPNE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=7581	50.47033	2	2559.196839	2559.196492	K	T	159	180
PSM	AILIFNNHGKPR	559	sp|Q92572|AP3S1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=4237	29.040488333333336	2	1378.782696	1378.783353	K	L	4	16
PSM	LKLEQIDGHIAEHNSK	560	sp|Q9NTJ3|SMC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	2-UNIMOD:188,16-UNIMOD:188	ms_run[1]:scan=4258	29.176626666666667	3	1842.996831	1842.999069	K	I	1016	1032
PSM	ILHQHLGAPEER	561	sp|Q9NZM1|MYOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	12-UNIMOD:267	ms_run[1]:scan=2262	16.557415	2	1408.745451	1408.745066	K	L	1715	1727
PSM	ILHQHLGAPEER	562	sp|Q9NZM1|MYOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=2269	16.601036666666666	2	1398.736878	1398.736797	K	L	1715	1727
PSM	SHSAHFFEFLTK	563	sp|A6NHG4|DDTL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=7120	47.470218333333335	2	1449.706472	1449.704100	R	E	76	88
PSM	LLGHWEEAAHDLALACK	564	sp|P50502|F10A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	16-UNIMOD:4,17-UNIMOD:188	ms_run[1]:scan=8179	54.448053333333334	3	1939.961006	1938.971746	R	L	194	211
PSM	HHCPNTPIILVGTK	565	sp|P63000|RAC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:4,14-UNIMOD:188	ms_run[1]:scan=4379	29.942895	2	1591.857993	1591.860011	R	L	103	117
PSM	INFDKYHPGYFGK	566	sp|P46776|RL27A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=5861	39.3495	2	1584.772924	1584.772514	R	V	43	56
PSM	LNKPQPQPSPLLSTHHTQEEDISSK	567	sp|Q2NKX8|ERC6L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=4007	27.57726666666667	4	2810.422115	2810.419886	K	M	747	772
PSM	RQFHLTDDDLLR	568	sp|Q04446|GLGB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=6039	40.47994	2	1527.782980	1527.779390	R	Y	565	577
PSM	MIKPFFHSLSEK	569	sp|P10599|THIO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:35,3-UNIMOD:188,12-UNIMOD:188	ms_run[1]:scan=5273	35.585786666666664	2	1490.798437	1490.799430	K	Y	37	49
PSM	IRSFPDFPTPGVVFR	570	sp|P07741|APT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=9766	65.36494166666667	2	1733.923750	1733.925326	R	D	13	28
PSM	TAFHQEQGHQLLKK	571	sp|P51580|TPMT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	13-UNIMOD:188,14-UNIMOD:188	ms_run[1]:scan=2002	14.938976666666667	2	1675.916579	1675.919696	K	H	38	52
PSM	NVPTDVLSFPFHEHLK	572	sp|P58557|YBEY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	16-UNIMOD:188	ms_run[1]:scan=9022	60.216265	2	1884.984830	1884.982963	R	A	58	74
PSM	LIGHHGAEDATDAFR	573	sp|Q9Y5Q0|FADS3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=3784	26.186125	2	1608.766237	1608.764468	R	A	61	76
PSM	RPGANHEGSASR	574	sp|Q9NY26|S39A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=402	5.290111666666667	2	1237.590619	1237.591195	R	Q	54	66
PSM	HPGSFDVVHVK	575	sp|P62701|RS4X_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	11-UNIMOD:188	ms_run[1]:scan=3595	24.992983333333335	2	1226.650127	1226.650335	R	D	201	212
PSM	LTVNEAVKEGVVGPELHHK	576	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=5440	36.63086833333333	2	2055.110353	2055.111289	R	L	2885	2904
PSM	MREIVHIQAGQCGNQIGAK	577	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	2-UNIMOD:267,12-UNIMOD:4,19-UNIMOD:188	ms_run[1]:scan=4529	30.890790000000003	3	2125.082252	2125.085560	-	F	1	20
PSM	MREIVHIQAGQCGNQIGAK	578	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:35,2-UNIMOD:267,12-UNIMOD:4,19-UNIMOD:188	ms_run[1]:scan=3763	26.056983333333335	3	2141.079602	2141.080475	-	F	1	20