MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000067 -- main
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20200410\20200410165636316375^127.0.0.1^jpost@jpost.jpost\Psearch.ProteinPilotExecV5\Data1108010_PC12_D12_2100V_120min_10.pilotFin.txt
MTD	software[1]	[MS, MS:1000663, ProteinPilot, 5.0.0.0, 4767]
MTD	software[1]-setting	FASTA=uniprot_rat_20200406.fasta
MTD	software[1]-setting	PARAGON_VERSION=5.0.0.0, 4767
MTD	software[1]-setting	UI_SAMPLE_TYPE=iTRAQ 8plex (Peptide Labeled)
MTD	software[1]-setting	UI_CYS_ALKYLATION=MMTS
MTD	software[1]-setting	UI_DIGESTION=Trypsin
MTD	software[1]-setting	UI_INSTRUMENT=QSTAR Elite ESI
MTD	software[1]-setting	UI_SEARCH_EFFORT=Thorough
MTD	software[1]-setting	UI_ID_FOCUS=Biological modifications
MTD	software[1]-setting	UI_QUANT_TYPE=iTRAQ8PLEX
MTD	software[1]-setting	UI_MIN_UNUSED_PROTSCORE=0.0458
MTD	software[1]-setting	MSTOLERANCE=0.2
MTD	software[1]-setting	MSTOLERANCE_U=Daltons
MTD	software[1]-setting	MSMSTOLERANCE=0.2
MTD	software[1]-setting	MSMSTOLERANCE_U=Daltons
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.uniprot_rat_20200406
MTD	software[2]-setting	CLE=[RK]|{P}
MTD	software[2]-setting	MODS=iTRAQ8plex (K),iTRAQ8plex (N-term),Methylthio (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M)
MTD	software[2]-setting	TOL(-)=50
MTD	software[2]-setting	TOL(+)=50
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=250
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=1
MTD	software[3]	[MS, MS:1002251, Comet, 2015.02 rev. 0]
MTD	software[3]-setting	Taxon=userFasta.uniprot_rat_20200406
MTD	software[3]-setting	search_enzyme_number=1
MTD	software[3]-setting	FixMod=iTRAQ8plex (K),iTRAQ8plex (N-term),Methylthio (C)
MTD	software[3]-setting	VarMod=Oxidation (M)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=1
MTD	software[3]-setting	peptide_mass_tolerance=50
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:730, iTRAQ8plex,]
MTD	fixed_mod[1]-site	K
MTD	fixed_mod[1]-position	Anywhere
MTD	fixed_mod[2]	[UNIMOD, UNIMOD:730, iTRAQ8plex,]
MTD	fixed_mod[2]-site	N-term
MTD	fixed_mod[2]-position	Any N-term
MTD	fixed_mod[3]	[UNIMOD, UNIMOD:39, Methylthio,]
MTD	fixed_mod[3]-site	C
MTD	fixed_mod[3]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[1]-site	M
MTD	variable_mod[1]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P63039|CH60_RAT	60 kDa heat shock protein, mitochondrial OS=Rattus norvegicus (Rat) OX=10116 GN=Hspd1 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	49.0	null	97-UNIMOD:730	0.05	49.0	3	1	0
PRT	sp|B2RYG6|OTUB1_RAT	Ubiquitin thioesterase OTUB1 OS=Rattus norvegicus (Rat) OX=10116 GN=Otub1 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	47.0	null	11-UNIMOD:730,23-UNIMOD:39,31-UNIMOD:35	0.10	47.0	2	1	0
PRT	tr|Q642B5|Q642B5_RAT	Arm_2 domain-containing protein OS=Rattus norvegicus (Rat) OX=10116 GN=Armcx2 PE=2 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	46.0	null	161-UNIMOD:730,264-UNIMOD:730	0.06	46.0	2	2	2
PRT	sp|A8WCF8|TPRGL_RAT	Tumor protein p63-regulated gene 1-like protein OS=Rattus norvegicus (Rat) OX=10116 GN=Tprg1l PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	45.0	null	6-UNIMOD:730	0.09	45.0	1	1	1
PRT	sp|Q68A21|PURB_RAT	Transcriptional activator protein Pur-beta OS=Rattus norvegicus (Rat) OX=10116 GN=Purb PE=1 SV=3	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	45.0	null	156-UNIMOD:730	0.10	45.0	1	1	1
PRT	tr|G3V6H5|G3V6H5_RAT	Isoform of P97700, Mitochondrial 2-oxoglutarate/malate carrier protein OS=Rattus norvegicus (Rat) OX=10116 GN=Slc25a11 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	44.0	null	123-UNIMOD:730,127-UNIMOD:35	0.08	44.0	2	1	0
PRT	sp|F1M4A4|KIF1A_RAT	Kinesin-like protein KIF1A OS=Rattus norvegicus (Rat) OX=10116 GN=Kif1a PE=1 SV=3	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	43.0	null	325-UNIMOD:730	0.01	43.0	1	1	1
PRT	sp|Q5M7A4|UBA5_RAT	Ubiquitin-like modifier-activating enzyme 5 OS=Rattus norvegicus (Rat) OX=10116 GN=Uba5 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	43.0	null	378-UNIMOD:730	0.06	43.0	2	1	0
PRT	sp|Q3KRD8|IF6_RAT	Eukaryotic translation initiation factor 6 OS=Rattus norvegicus (Rat) OX=10116 GN=Eif6 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	42.0	null	165-UNIMOD:730	0.10	42.0	1	1	1
PRT	tr|D3ZLC1|D3ZLC1_RAT	Lamin B2 OS=Rattus norvegicus (Rat) OX=10116 GN=Lmnb2 PE=1 SV=2	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	42.0	null	460-UNIMOD:730	0.04	42.0	1	1	1
PRT	sp|Q66X93|SND1_RAT	Staphylococcal nuclease domain-containing protein 1 OS=Rattus norvegicus (Rat) OX=10116 GN=Snd1 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	42.0	null	787-UNIMOD:730	0.03	42.0	2	1	0
PRT	tr|M0RDR2|M0RDR2_RAT	Uncharacterized protein OS=Rattus norvegicus (Rat) OX=10116 GN=ENSRNOG00000053620 PE=4 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	42.0	null	375-UNIMOD:730	0.05	42.0	1	1	1
PRT	sp|Q5PPG7|EIF2D_RAT	Eukaryotic translation initiation factor 2D OS=Rattus norvegicus (Rat) OX=10116 GN=Eif2d PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	42.0	null	339-UNIMOD:730	0.04	42.0	1	1	1
PRT	tr|F1M403|F1M403_RAT	UBIQUITIN_CONJUGAT_2 domain-containing protein OS=Rattus norvegicus (Rat) OX=10116 GN=Ube2o PE=1 SV=2	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	42.0	null	157-UNIMOD:730,159-UNIMOD:39	0.02	42.0	1	1	1
PRT	tr|A0A0G2K916|A0A0G2K916_RAT	ANK_REP_REGION domain-containing protein OS=Rattus norvegicus (Rat) OX=10116 GN=Ankhd1 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	41.0	null	2101-UNIMOD:730	0.01	41.0	1	1	1
PRT	tr|F1M1D5|F1M1D5_RAT	TFCD_C domain-containing protein OS=Rattus norvegicus (Rat) OX=10116 GN=Tbcd PE=1 SV=3	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1001476, X!Tandem, ]	41.0	null	2-UNIMOD:730	0.02	41.0	1	1	1
PRT	tr|Q6AYR1|Q6AYR1_RAT	PB1 domain-containing protein OS=Rattus norvegicus (Rat) OX=10116 GN=Tfg PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	41.0	null	181-UNIMOD:730,183-UNIMOD:35	0.06	41.0	3	1	0
PRT	sp|P16638|ACLY_RAT	ATP-citrate synthase OS=Rattus norvegicus (Rat) OX=10116 GN=Acly PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	41.0	null	807-UNIMOD:730,822-UNIMOD:35	0.02	41.0	3	1	0
PRT	tr|C0JPT7|C0JPT7_RAT	Filamin A OS=Rattus norvegicus (Rat) OX=10116 GN=Flna PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	40.0	null	1247-UNIMOD:730,1260-UNIMOD:39,1492-UNIMOD:730	0.02	40.0	2	2	2
PRT	sp|Q4G061|EIF3B_RAT	Eukaryotic translation initiation factor 3 subunit B OS=Rattus norvegicus (Rat) OX=10116 GN=Eif3b PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	40.0	null	22-UNIMOD:730	0.03	40.0	1	1	1
PRT	sp|Q794F9|4F2_RAT	4F2 cell-surface antigen heavy chain OS=Rattus norvegicus (Rat) OX=10116 GN=Slc3a2 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	40.0	null	472-UNIMOD:730	0.05	40.0	2	1	0
PRT	tr|E9PTX9|E9PTX9_RAT	Solute carrier family 12 member 2 OS=Rattus norvegicus (Rat) OX=10116 GN=Slc12a2 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	40.0	null	18-UNIMOD:730	0.02	40.0	1	1	1
PRT	tr|B1WC70|B1WC70_RAT	FHA domain-containing protein OS=Rattus norvegicus (Rat) OX=10116 GN=Ppp1r8 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	40.0	null	201-UNIMOD:730	0.06	40.0	1	1	1
PRT	tr|A0A0G2K226|A0A0G2K226_RAT	Nudc_N domain-containing protein OS=Rattus norvegicus (Rat) OX=10116 GN=Nudcd3 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	39.0	null	118-UNIMOD:730	0.13	39.0	2	1	0
PRT	sp|P86182|CCD22_RAT	Coiled-coil domain-containing protein 22 OS=Rattus norvegicus (Rat) OX=10116 GN=Ccdc22 PE=1 SV=2	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	38.0	null	182-UNIMOD:730,108-UNIMOD:730	0.07	38.0	3	2	1
PRT	sp|F1LNJ2|U520_RAT	U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Rattus norvegicus (Rat) OX=10116 GN=Snrnp200 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	38.0	null	387-UNIMOD:730,1298-UNIMOD:730	0.02	38.0	3	2	1
PRT	tr|F1MAQ7|F1MAQ7_RAT	Son DNA-binding protein OS=Rattus norvegicus (Rat) OX=10116 GN=Son PE=1 SV=2	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	38.0	null	29-UNIMOD:730	0.01	38.0	1	1	1
PRT	sp|Q5BJY9|K1C18_RAT	Keratin, type I cytoskeletal 18 OS=Rattus norvegicus (Rat) OX=10116 GN=Krt18 PE=1 SV=3	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	38.0	null	376-UNIMOD:730,395-UNIMOD:35	0.06	38.0	4	1	0
PRT	tr|D3ZEA0|D3ZEA0_RAT	Fibronectin type III domain containing 3a (Predicted), isoform CRA_a OS=Rattus norvegicus (Rat) OX=10116 GN=Fndc3a PE=1 SV=2	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	38.0	null	354-UNIMOD:730,367-UNIMOD:39	0.02	38.0	1	1	1
PRT	tr|M0R3M4|M0R3M4_RAT	RAN-binding protein 2 OS=Rattus norvegicus (Rat) OX=10116 GN=Ranbp2 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	38.0	null	399-UNIMOD:730	0.01	38.0	1	1	1
PRT	sp|P62815|VATB2_RAT	V-type proton ATPase subunit B, brain isoform OS=Rattus norvegicus (Rat) OX=10116 GN=Atp6v1b2 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	37.0	null	164-UNIMOD:730,169-UNIMOD:35,8-UNIMOD:730,180-UNIMOD:35,25-UNIMOD:35	0.09	37.0	10	2	0
PRT	tr|A0A0G2JXT8|A0A0G2JXT8_RAT	Filamin B OS=Rattus norvegicus (Rat) OX=10116 GN=Flnb PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	37.0	null	2476-UNIMOD:730,1520-UNIMOD:730	0.02	37.0	2	2	2
PRT	sp|Q5XIM9|TCPB_RAT	T-complex protein 1 subunit beta OS=Rattus norvegicus (Rat) OX=10116 GN=Cct2 PE=1 SV=3	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	37.0	null	90-UNIMOD:730,445-UNIMOD:730,445-UNIMOD:35	0.09	37.0	5	2	0
PRT	sp|Q9R080|GPSM1_RAT	G-protein-signaling modulator 1 OS=Rattus norvegicus (Rat) OX=10116 GN=Gpsm1 PE=1 SV=2	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	37.0	null	513-UNIMOD:730,513-UNIMOD:39,535-UNIMOD:730	0.07	37.0	2	2	2
PRT	sp|Q9QXU9|PCS1N_RAT	ProSAAS OS=Rattus norvegicus (Rat) OX=10116 GN=Pcsk1n PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	37.0	null	118-UNIMOD:730	0.08	37.0	2	1	0
PRT	sp|Q62871|DC1I2_RAT	Cytoplasmic dynein 1 intermediate chain 2 OS=Rattus norvegicus (Rat) OX=10116 GN=Dync1i2 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	37.0	null	584-UNIMOD:730	0.04	37.0	1	1	1
PRT	sp|Q64350|EI2BE_RAT	Translation initiation factor eIF-2B subunit epsilon OS=Rattus norvegicus (Rat) OX=10116 GN=Eif2b5 PE=1 SV=2	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	37.0	null	19-UNIMOD:730	0.04	37.0	1	1	1
PRT	sp|P50137|TKT_RAT	Transketolase OS=Rattus norvegicus (Rat) OX=10116 GN=Tkt PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	37.0	null	284-UNIMOD:730	0.03	37.0	3	1	0
PRT	sp|Q6AYK8|EIF3D_RAT	Eukaryotic translation initiation factor 3 subunit D OS=Rattus norvegicus (Rat) OX=10116 GN=Eif3d PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	37.0	null	282-UNIMOD:730	0.05	37.0	1	1	1
PRT	sp|Q05695|L1CAM_RAT	Neural cell adhesion molecule L1 OS=Rattus norvegicus (Rat) OX=10116 GN=L1cam PE=1 SV=3	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	36.0	null	383-UNIMOD:730,403-UNIMOD:39,449-UNIMOD:730	0.04	36.0	2	2	2
PRT	tr|F1LZI1|F1LZI1_RAT	Similar to heat shock protein 8 OS=Rattus norvegicus (Rat) OX=10116 GN=LOC680121 PE=3 SV=2	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	36.0	null	138-UNIMOD:730,424-UNIMOD:28	0.07	36.0	8	2	0
PRT	sp|Q9QUR2|DCTN4_RAT	Dynactin subunit 4 OS=Rattus norvegicus (Rat) OX=10116 GN=Dctn4 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	36.0	null	378-UNIMOD:730	0.06	36.0	1	1	1
PRT	sp|P23565|AINX_RAT	Alpha-internexin OS=Rattus norvegicus (Rat) OX=10116 GN=Ina PE=1 SV=2	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	36.0	null	407-UNIMOD:730	0.05	36.0	1	1	1
PRT	tr|Q5PPJ6|Q5PPJ6_RAT	Leucyl-tRNA synthetase OS=Rattus norvegicus (Rat) OX=10116 GN=Lars PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	36.0	null	387-UNIMOD:730	0.02	36.0	1	1	1
PRT	sp|P05065|ALDOA_RAT	Fructose-bisphosphate aldolase A OS=Rattus norvegicus (Rat) OX=10116 GN=Aldoa PE=1 SV=2	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	36.0	null	112-UNIMOD:730	0.07	36.0	2	1	0
PRT	sp|P39069|KAD1_RAT	Adenylate kinase isoenzyme 1 OS=Rattus norvegicus (Rat) OX=10116 GN=Ak1 PE=1 SV=3	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	36.0	null	109-UNIMOD:730	0.11	36.0	1	1	1
PRT	sp|Q01205|ODO2_RAT	Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial OS=Rattus norvegicus (Rat) OX=10116 GN=Dlst PE=1 SV=2	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	36.0	null	69-UNIMOD:730	0.05	36.0	1	1	1
PRT	tr|G3V7U4|G3V7U4_RAT	Isoform of P70615, Lamin-B1 OS=Rattus norvegicus (Rat) OX=10116 GN=Lmnb1 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	36.0	null	548-UNIMOD:730	0.04	36.0	2	1	0
PRT	sp|P11442|CLH1_RAT	Clathrin heavy chain 1 OS=Rattus norvegicus (Rat) OX=10116 GN=Cltc PE=1 SV=3	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	35.0	null	44-UNIMOD:730,55-UNIMOD:35,1462-UNIMOD:730	0.03	35.0	3	2	1
PRT	tr|A0A0G2K1U9|A0A0G2K1U9_RAT	IRG-type G domain-containing protein OS=Rattus norvegicus (Rat) OX=10116 GN=Irgq PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	35.0	null	409-UNIMOD:730,178-UNIMOD:730	0.07	35.0	2	2	2
PRT	sp|Q63347|PRS7_RAT	26S proteasome regulatory subunit 7 OS=Rattus norvegicus (Rat) OX=10116 GN=Psmc2 PE=1 SV=3	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	35.0	null	121-UNIMOD:730,138-UNIMOD:35	0.05	35.0	2	1	0
PRT	tr|F7ES73|F7ES73_RAT	Negative regulator of ubiquitin-like proteins 1 OS=Rattus norvegicus (Rat) OX=10116 GN=Nub1 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	35.0	null	200-UNIMOD:730	0.04	35.0	1	1	1
PRT	tr|D3ZGY2|D3ZGY2_RAT	OTU domain-containing protein OS=Rattus norvegicus (Rat) OX=10116 GN=Otud6b PE=1 SV=3	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	35.0	null	240-UNIMOD:730	0.08	35.0	1	1	1
PRT	sp|O88339|EPN1_RAT	Epsin-1 OS=Rattus norvegicus (Rat) OX=10116 GN=Epn1 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	35.0	null	411-UNIMOD:730	0.04	35.0	1	1	1
PRT	tr|F1LRI5|F1LRI5_RAT	TOG domain-containing protein OS=Rattus norvegicus (Rat) OX=10116 GN=Gcn1 PE=1 SV=3	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	35.0	null	713-UNIMOD:730	0.01	35.0	1	1	1
PRT	sp|D4ABP9|FBX3_RAT	F-box only protein 3 OS=Rattus norvegicus (Rat) OX=10116 GN=Fbxo3 PE=3 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	35.0	null	338-UNIMOD:730	0.05	35.0	1	1	1
PRT	sp|P16086|SPTN1_RAT	Spectrin alpha chain, non-erythrocytic 1 OS=Rattus norvegicus (Rat) OX=10116 GN=Sptan1 PE=1 SV=2	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	35.0	null	382-UNIMOD:730	0.01	35.0	1	1	1
PRT	sp|Q5XIJ6|BABA1_RAT	BRISC and BRCA1-A complex member 1 OS=Rattus norvegicus (Rat) OX=10116 GN=Babam1 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	35.0	null	199-UNIMOD:730	0.06	35.0	1	1	1
PRT	sp|Q7TT49|MRCKB_RAT	Serine/threonine-protein kinase MRCK beta OS=Rattus norvegicus (Rat) OX=10116 GN=Cdc42bpb PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	35.0	null	981-UNIMOD:730	0.01	35.0	1	1	1
PRT	tr|D4ACZ5|D4ACZ5_RAT	N-myc downstream regulated gene 3 OS=Rattus norvegicus (Rat) OX=10116 GN=LOC679863 PE=1 SV=3	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	35.0	null	317-UNIMOD:730,330-UNIMOD:39	0.07	35.0	1	1	1
PRT	tr|G3V852|G3V852_RAT	RCG55135, isoform CRA_b OS=Rattus norvegicus (Rat) OX=10116 GN=Tln1 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	35.0	null	722-UNIMOD:730,732-UNIMOD:39	0.01	35.0	1	1	1
PRT	sp|Q91XU8|CDS2_RAT	Phosphatidate cytidylyltransferase 2 OS=Rattus norvegicus (Rat) OX=10116 GN=Cds2 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	35.0	null	38-UNIMOD:730	0.05	35.0	1	1	1
PRT	tr|D3ZTE2|D3ZTE2_RAT	DUF2451 domain-containing protein OS=Rattus norvegicus (Rat) OX=10116 GN=LOC100911994 PE=4 SV=2	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	35.0	null	58-UNIMOD:730	0.07	35.0	1	1	1
PRT	tr|A0A0G2K6F9|A0A0G2K6F9_RAT	RRM domain-containing protein OS=Rattus norvegicus (Rat) OX=10116 GN=Cstf2 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	34.0	null	474-UNIMOD:730	0.04	34.0	1	1	1
PRT	sp|Q9Z1X1|ESYT1_RAT	Extended synaptotagmin-1 OS=Rattus norvegicus (Rat) OX=10116 GN=Esyt1 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	34.0	null	27-UNIMOD:730	0.02	34.0	1	1	1
PRT	sp|Q62940|NEDD4_RAT	E3 ubiquitin-protein ligase NEDD4 OS=Rattus norvegicus (Rat) OX=10116 GN=Nedd4 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	34.0	null	156-UNIMOD:730	0.02	34.0	1	1	1
PRT	sp|Q6MG61|CLIC1_RAT	Chloride intracellular channel protein 1 OS=Rattus norvegicus (Rat) OX=10116 GN=Clic1 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	34.0	null	217-UNIMOD:730,223-UNIMOD:39	0.10	34.0	1	1	1
PRT	tr|A0A0G2K2Z0|A0A0G2K2Z0_RAT	EMAP-like 4 OS=Rattus norvegicus (Rat) OX=10116 GN=Eml4 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	34.0	null	840-UNIMOD:730,841-UNIMOD:39	0.02	34.0	2	1	0
PRT	tr|A0A0G2K8Z9|A0A0G2K8Z9_RAT	Kinesin family member 13B OS=Rattus norvegicus (Rat) OX=10116 GN=Kif13b PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	34.0	null	324-UNIMOD:730	0.01	34.0	1	1	1
PRT	sp|P63036|DNJA1_RAT	DnaJ homolog subfamily A member 1 OS=Rattus norvegicus (Rat) OX=10116 GN=Dnaja1 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	34.0	null	351-UNIMOD:730,358-UNIMOD:35	0.06	34.0	1	1	1
PRT	sp|Q03555|GEPH_RAT	Gephyrin OS=Rattus norvegicus (Rat) OX=10116 GN=Gphn PE=1 SV=3	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	34.0	null	420-UNIMOD:730,436-UNIMOD:35	0.03	34.0	2	1	0
PRT	tr|F1LN59|F1LN59_RAT	Eukaryotic translation initiation factor 4, gamma 2 OS=Rattus norvegicus (Rat) OX=10116 GN=Eif4g2 PE=1 SV=2	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	33.0	null	546-UNIMOD:730,489-UNIMOD:730	0.05	33.0	2	2	2
PRT	tr|A0A0G2JVI3|A0A0G2JVI3_RAT	Uncharacterized protein OS=Rattus norvegicus (Rat) OX=10116 GN=ENSRNOG00000061099 PE=3 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	33.0	null	344-UNIMOD:730	0.04	33.0	1	1	0
PRT	sp|Q0PGW2|DEN11_RAT	DENN domain-containing protein 11 OS=Rattus norvegicus (Rat) OX=10116 GN=Dennd11 PE=2 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	33.0	null	51-UNIMOD:730	0.04	33.0	1	1	1
PRT	sp|P11348|DHPR_RAT	Dihydropteridine reductase OS=Rattus norvegicus (Rat) OX=10116 GN=Qdpr PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	33.0	null	165-UNIMOD:730,168-UNIMOD:35,186-UNIMOD:35	0.10	33.0	4	1	0
PRT	sp|Q4V7C6|GUAA_RAT	GMP synthase [glutamine-hydrolyzing] OS=Rattus norvegicus (Rat) OX=10116 GN=Gmps PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	33.0	null	570-UNIMOD:730	0.03	33.0	2	1	0
PRT	tr|D3ZW38|D3ZW38_RAT	RNase_PH domain-containing protein OS=Rattus norvegicus (Rat) OX=10116 GN=Exosc6 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	33.0	null	10-UNIMOD:730	0.08	33.0	1	1	1
PRT	sp|P13084|NPM_RAT	Nucleophosmin OS=Rattus norvegicus (Rat) OX=10116 GN=Npm1 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	33.0	null	81-UNIMOD:730,81-UNIMOD:35	0.08	33.0	5	1	0
PRT	tr|D4A5A6|D4A5A6_RAT	DNA-directed RNA polymerase subunit OS=Rattus norvegicus (Rat) OX=10116 GN=Polr2a PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	33.0	null	365-UNIMOD:730	0.01	33.0	1	1	1
PRT	sp|Q5HZY0|UBXN4_RAT	UBX domain-containing protein 4 OS=Rattus norvegicus (Rat) OX=10116 GN=Ubxn4 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	33.0	null	126-UNIMOD:730,143-UNIMOD:39,324-UNIMOD:730	0.09	33.0	2	2	2
PRT	tr|G3V918|G3V918_RAT	Trifunctional purine biosynthetic protein adenosine-3 OS=Rattus norvegicus (Rat) OX=10116 GN=Gart PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	33.0	null	634-UNIMOD:730,646-UNIMOD:39	0.03	33.0	1	1	1
PRT	sp|Q5XFW8|SEC13_RAT	Protein SEC13 homolog OS=Rattus norvegicus (Rat) OX=10116 GN=Sec13 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	33.0	null	217-UNIMOD:730,234-UNIMOD:39	0.07	33.0	1	1	1
PRT	sp|P85972|VINC_RAT	Vinculin OS=Rattus norvegicus (Rat) OX=10116 GN=Vcl PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	32.0	null	36-UNIMOD:730,833-UNIMOD:730	0.04	32.0	4	2	1
PRT	sp|Q00438|PTBP1_RAT	Polypyrimidine tract-binding protein 1 OS=Rattus norvegicus (Rat) OX=10116 GN=Ptbp1 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	32.0	null	350-UNIMOD:730	0.04	32.0	1	1	1
PRT	tr|A0A0G2QC02|A0A0G2QC02_RAT	Ski2-like RNA helicase OS=Rattus norvegicus (Rat) OX=10116 GN=Skiv2l PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	32.0	null	214-UNIMOD:730	0.02	32.0	1	1	1
PRT	sp|D3ZHA0|FLNC_RAT	Filamin-C OS=Rattus norvegicus (Rat) OX=10116 GN=Flnc PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	32.0	null	1476-UNIMOD:730	0.01	32.0	1	1	1
PRT	tr|Q6MG66|Q6MG66_RAT	U6 snRNA-associated Sm-like protein LSm2 OS=Rattus norvegicus (Rat) OX=10116 GN=Lsm2 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	32.0	null	105-UNIMOD:730	0.15	32.0	1	1	1
PRT	sp|P06685|AT1A1_RAT	Sodium/potassium-transporting ATPase subunit alpha-1 OS=Rattus norvegicus (Rat) OX=10116 GN=Atp1a1 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	32.0	null	630-UNIMOD:730	0.02	32.0	1	1	1
PRT	sp|Q6IMX7|HPBP1_RAT	Hsp70-binding protein 1 OS=Rattus norvegicus (Rat) OX=10116 GN=Hspbp1 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	32.0	null	97-UNIMOD:730	0.06	32.0	1	1	1
PRT	sp|Q66H61|SYQ_RAT	Glutamine--tRNA ligase OS=Rattus norvegicus (Rat) OX=10116 GN=Qars1 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	32.0	null	206-UNIMOD:730	0.03	32.0	1	1	1
PRT	tr|D4A2B0|D4A2B0_RAT	RRM domain-containing protein OS=Rattus norvegicus (Rat) OX=10116 GN=Poldip3 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	32.0	null	381-UNIMOD:730	0.05	32.0	1	1	1
PRT	tr|Q6DGG9|Q6DGG9_RAT	Calcium signal-modulating cyclophilin ligand OS=Rattus norvegicus (Rat) OX=10116 GN=Camlg PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	32.0	null	83-UNIMOD:730	0.08	32.0	1	1	1
PRT	tr|A0A0G2JTN4|A0A0G2JTN4_RAT	Glutamine amidotransferase type-1 domain-containing protein OS=Rattus norvegicus (Rat) OX=10116 GN=Pfas PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	31.0	null	459-UNIMOD:730,991-UNIMOD:730	0.04	31.0	2	2	2
PRT	sp|P10719|ATPB_RAT	ATP synthase subunit beta, mitochondrial OS=Rattus norvegicus (Rat) OX=10116 GN=Atp5f1b PE=1 SV=2	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	31.0	null	388-UNIMOD:730,325-UNIMOD:730,342-UNIMOD:35,339-UNIMOD:35	0.08	31.0	7	2	0
PRT	tr|B2RZB6|B2RZB6_RAT	U6 snRNA-associated Sm-like protein LSm8 OS=Rattus norvegicus (Rat) OX=10116 GN=Lsm8 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	31.0	null	64-UNIMOD:730	0.26	31.0	1	1	1
PRT	tr|D3ZXL5|D3ZXL5_RAT	Nuclear cap-binding subunit 3 OS=Rattus norvegicus (Rat) OX=10116 GN=Ncbp3 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	31.0	null	13-UNIMOD:730	0.04	31.0	1	1	1
PRT	sp|Q5PQL7|ITM2C_RAT	Integral membrane protein 2C OS=Rattus norvegicus (Rat) OX=10116 GN=Itm2c PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	31.0	null	21-UNIMOD:730	0.09	31.0	1	1	1
PRT	sp|P04177|TY3H_RAT	Tyrosine 3-monooxygenase OS=Rattus norvegicus (Rat) OX=10116 GN=Th PE=1 SV=3	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1001476, X!Tandem, ]	31.0	null	50-UNIMOD:27	0.06	31.0	1	1	1
PRT	tr|F1LQJ7|F1LQJ7_RAT	Phosphoenolpyruvate carboxykinase 2 (mitochondrial) OS=Rattus norvegicus (Rat) OX=10116 GN=Pck2 PE=1 SV=2	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	31.0	null	118-UNIMOD:730	0.04	31.0	2	1	0
PRT	tr|A0A0G2JVQ2|A0A0G2JVQ2_RAT	LID domain-containing protein OS=Rattus norvegicus (Rat) OX=10116 GN=Ldb1 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	31.0	null	41-UNIMOD:730	0.05	31.0	1	1	1
PRT	tr|D3ZQ25|D3ZQ25_RAT	Fibulin-1 OS=Rattus norvegicus (Rat) OX=10116 GN=Fbln1 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	31.0	null	622-UNIMOD:730	0.03	31.0	1	1	1
PRT	sp|Q4V896|SNX15_RAT	Sorting nexin-15 OS=Rattus norvegicus (Rat) OX=10116 GN=Snx15 PE=2 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	31.0	null	138-UNIMOD:730	0.06	31.0	1	1	1
PRT	sp|P60711|ACTB_RAT	Actin, cytoplasmic 1 OS=Rattus norvegicus (Rat) OX=10116 GN=Actb PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	31.0	null	292-UNIMOD:730,305-UNIMOD:35	0.06	31.0	4	1	0
PRT	sp|P09951|SYN1_RAT	Synapsin-1 OS=Rattus norvegicus (Rat) OX=10116 GN=Syn1 PE=1 SV=3	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	31.0	null	506-UNIMOD:730	0.04	31.0	1	1	1
PRT	tr|D3ZE59|D3ZE59_RAT	Transmembrane protein 115 OS=Rattus norvegicus (Rat) OX=10116 GN=Tmem115 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	31.0	null	260-UNIMOD:730	0.07	31.0	1	1	1
PRT	sp|P14173|DDC_RAT	Aromatic-L-amino-acid decarboxylase OS=Rattus norvegicus (Rat) OX=10116 GN=Ddc PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	31.0	null	40-UNIMOD:730	0.04	31.0	2	1	0
PRT	sp|Q4KLG9|ZFN2B_RAT	AN1-type zinc finger protein 2B OS=Rattus norvegicus (Rat) OX=10116 GN=Zfand2b PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	31.0	null	185-UNIMOD:730	0.08	31.0	1	1	1
PRT	sp|P97586|CGRE1_RAT	Cell growth regulator with EF hand domain protein 1 OS=Rattus norvegicus (Rat) OX=10116 GN=Cgref1 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	31.0	null	30-UNIMOD:730	0.08	31.0	1	1	1
PRT	tr|D3ZY44|D3ZY44_RAT	Mitochondrial ribosomal protein S2 OS=Rattus norvegicus (Rat) OX=10116 GN=Mrps2 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	30.0	null	38-UNIMOD:730	0.08	30.0	1	1	1
PRT	tr|A0A0G2K0X1|A0A0G2K0X1_RAT	PCM1_C domain-containing protein OS=Rattus norvegicus (Rat) OX=10116 GN=Pcm1 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	30.0	null	2004-UNIMOD:730,2008-UNIMOD:35	0.01	30.0	2	1	0
PRT	sp|Q6MG49|BAG6_RAT	Large proline-rich protein BAG6 OS=Rattus norvegicus (Rat) OX=10116 GN=Bag6 PE=1 SV=2	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	30.0	null	957-UNIMOD:730	0.02	30.0	1	1	1
PRT	sp|Q9JHW1|CBPD_RAT	Carboxypeptidase D OS=Rattus norvegicus (Rat) OX=10116 GN=Cpd PE=1 SV=2	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	30.0	null	219-UNIMOD:730	0.02	30.0	2	1	0
PRT	sp|P38650|DYHC1_RAT	Cytoplasmic dynein 1 heavy chain 1 OS=Rattus norvegicus (Rat) OX=10116 GN=Dync1h1 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	30.0	null	3627-UNIMOD:730,4573-UNIMOD:730	0.01	30.0	2	2	2
PRT	tr|D3ZTR5|D3ZTR5_RAT	DUF4371 domain-containing protein OS=Rattus norvegicus (Rat) OX=10116 GN=Zbed5 PE=4 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	30.0	null	29-UNIMOD:730	0.03	30.0	1	1	1
PRT	sp|P09117|ALDOC_RAT	Fructose-bisphosphate aldolase C OS=Rattus norvegicus (Rat) OX=10116 GN=Aldoc PE=1 SV=3	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	30.0	null	112-UNIMOD:730	0.07	30.0	1	1	1
PRT	sp|P07335|KCRB_RAT	Creatine kinase B-type OS=Rattus norvegicus (Rat) OX=10116 GN=Ckb PE=1 SV=2	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	30.0	null	108-UNIMOD:730,321-UNIMOD:730	0.12	30.0	2	2	2
PRT	sp|Q5U2U2|CRKL_RAT	Crk-like protein OS=Rattus norvegicus (Rat) OX=10116 GN=Crkl PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	30.0	null	105-UNIMOD:730	0.09	30.0	1	1	1
PRT	sp|Q75Q39|TOM70_RAT	Mitochondrial import receptor subunit TOM70 OS=Rattus norvegicus (Rat) OX=10116 GN=Tomm70 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	30.0	null	93-UNIMOD:730	0.04	30.0	1	1	1
PRT	tr|M0R930|M0R930_RAT	t-SNARE coiled-coil homology domain-containing protein OS=Rattus norvegicus (Rat) OX=10116 GN=LOC100910446 PE=3 SV=2	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	30.0	null	132-UNIMOD:730	0.11	30.0	1	1	1
PRT	sp|P97521|MCAT_RAT	Mitochondrial carnitine/acylcarnitine carrier protein OS=Rattus norvegicus (Rat) OX=10116 GN=Slc25a20 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	30.0	null	38-UNIMOD:730,58-UNIMOD:39,51-UNIMOD:35	0.08	30.0	2	1	0
PRT	tr|F1LT58|F1LT58_RAT	Importin subunit alpha OS=Rattus norvegicus (Rat) OX=10116 GN=Kpna6 PE=1 SV=3	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	30.0	null	116-UNIMOD:730	0.04	30.0	1	1	1
PRT	sp|Q2TL32|UBR4_RAT	E3 ubiquitin-protein ligase UBR4 OS=Rattus norvegicus (Rat) OX=10116 GN=Ubr4 PE=1 SV=2	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	29.0	null	606-UNIMOD:730	0.00	29.0	1	1	1
PRT	tr|D4AEP0|D4AEP0_RAT	Adenylosuccinate synthetase isozyme 2 OS=Rattus norvegicus (Rat) OX=10116 GN=Adss PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	29.0	null	304-UNIMOD:730	0.05	29.0	1	1	1
PRT	tr|M0RB11|M0RB11_RAT	MFS domain-containing protein OS=Rattus norvegicus (Rat) OX=10116 GN=Flvcr1 PE=4 SV=2	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	29.0	null	54-UNIMOD:730	0.04	29.0	1	1	1
PRT	tr|D3ZUK4|D3ZUK4_RAT	Tripartite motif-containing 33 OS=Rattus norvegicus (Rat) OX=10116 GN=Trim33 PE=1 SV=3	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	29.0	null	178-UNIMOD:730	0.02	29.0	1	1	1
PRT	sp|Q4V888|PP4P2_RAT	Type 2 phosphatidylinositol 4,5-bisphosphate 4-phosphatase OS=Rattus norvegicus (Rat) OX=10116 GN=Pip4p2 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	29.0	null	36-UNIMOD:730,58-UNIMOD:39	0.10	29.0	1	1	1
PRT	tr|M0R597|M0R597_RAT	Ferritin OS=Rattus norvegicus (Rat) OX=10116 GN=LOC100362384 PE=3 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	29.0	null	156-UNIMOD:730	0.13	29.0	1	1	1
PRT	sp|P86252|PURA_RAT	Transcriptional activator protein Pur-alpha OS=Rattus norvegicus (Rat) OX=10116 GN=Pura PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	29.0	null	65-UNIMOD:730	0.17	29.0	2	1	0
PRT	sp|P56558|OGT1_RAT	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Rattus norvegicus (Rat) OX=10116 GN=Ogt PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	29.0	null	868-UNIMOD:730	0.02	29.0	1	1	1
PRT	sp|P08461|ODP2_RAT	Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Rattus norvegicus (Rat) OX=10116 GN=Dlat PE=1 SV=3	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	28.0	null	85-UNIMOD:730,397-UNIMOD:730	0.06	28.0	2	2	2
PRT	tr|D3ZJ32|D3ZJ32_RAT	Extended synaptotagmin 2 OS=Rattus norvegicus (Rat) OX=10116 GN=Esyt2 PE=1 SV=3	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	28.0	null	675-UNIMOD:730,20-UNIMOD:730	0.05	28.0	2	2	2
PRT	tr|A0A0G2K6I4|A0A0G2K6I4_RAT	WH1 domain-containing protein OS=Rattus norvegicus (Rat) OX=10116 GN=Enah PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	28.0	null	510-UNIMOD:730,123-UNIMOD:730	0.08	28.0	2	2	2
PRT	sp|P43244|MATR3_RAT	Matrin-3 OS=Rattus norvegicus (Rat) OX=10116 GN=Matr3 PE=1 SV=2	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	28.0	null	20-UNIMOD:730,38-UNIMOD:35	0.03	28.0	5	1	0
PRT	sp|F1LNI5|PPM1G_RAT	Protein phosphatase 1G OS=Rattus norvegicus (Rat) OX=10116 GN=Ppm1g PE=1 SV=2	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	28.0	null	173-UNIMOD:730	0.05	28.0	1	1	1
PRT	tr|D3ZMR9|D3ZMR9_RAT	Mitochondrial ribosomal protein L21 OS=Rattus norvegicus (Rat) OX=10116 GN=Mrpl21 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	28.0	null	58-UNIMOD:730	0.11	28.0	1	1	1
PRT	sp|P52873|PYC_RAT	Pyruvate carboxylase, mitochondrial OS=Rattus norvegicus (Rat) OX=10116 GN=Pc PE=1 SV=2	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	28.0	null	520-UNIMOD:730	0.02	28.0	1	1	1
PRT	tr|D3ZJ86|D3ZJ86_RAT	Sodium/hydrogen exchanger OS=Rattus norvegicus (Rat) OX=10116 GN=Slc9a6 PE=1 SV=2	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	28.0	null	699-UNIMOD:730	0.03	28.0	1	1	1
PRT	tr|D4AAM0|D4AAM0_RAT	Xpo1 domain-containing protein OS=Rattus norvegicus (Rat) OX=10116 GN=Tnpo3 PE=1 SV=2	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	28.0	null	595-UNIMOD:730	0.02	28.0	1	1	1
PRT	sp|P20651|PP2BB_RAT	Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform OS=Rattus norvegicus (Rat) OX=10116 GN=Ppp3cb PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	27.0	null	9-UNIMOD:730	0.03	27.0	1	1	1
PRT	sp|P15651|ACADS_RAT	Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Rattus norvegicus (Rat) OX=10116 GN=Acads PE=1 SV=2	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	27.0	null	149-UNIMOD:730,151-UNIMOD:39	0.06	27.0	1	1	1
PRT	sp|Q08851|STX5_RAT	Syntaxin-5 OS=Rattus norvegicus (Rat) OX=10116 GN=Stx5 PE=1 SV=2	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	27.0	null	214-UNIMOD:730	0.07	27.0	1	1	1
PRT	sp|Q63433|PKN1_RAT	Serine/threonine-protein kinase N1 OS=Rattus norvegicus (Rat) OX=10116 GN=Pkn1 PE=1 SV=2	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	27.0	null	338-UNIMOD:730	0.03	27.0	1	1	1
PRT	sp|P62944|AP2B1_RAT	AP-2 complex subunit beta OS=Rattus norvegicus (Rat) OX=10116 GN=Ap2b1 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	26.0	null	284-UNIMOD:730	0.02	26.0	3	1	0
PRT	sp|O35889|AFAD_RAT	Afadin OS=Rattus norvegicus (Rat) OX=10116 GN=Afdn PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	26.0	null	1352-UNIMOD:730	0.01	26.0	1	1	1
PRT	tr|Q6AY48|Q6AY48_RAT	Poly(rC)-binding protein 3 OS=Rattus norvegicus (Rat) OX=10116 GN=Pcbp3 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	26.0	null	125-UNIMOD:730,137-UNIMOD:35	0.07	26.0	3	1	0
PRT	tr|E9PT22|E9PT22_RAT	Uncharacterized protein OS=Rattus norvegicus (Rat) OX=10116 GN=Inf2 PE=1 SV=3	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	26.0	null	18-UNIMOD:730,38-UNIMOD:39	0.02	26.0	1	1	1
PRT	tr|M0R7I0|M0R7I0_RAT	Importin subunit alpha OS=Rattus norvegicus (Rat) OX=10116 GN=LOC100359600 PE=3 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	26.0	null	241-UNIMOD:730	0.04	26.0	1	1	1
PRT	tr|D3ZGN0|D3ZGN0_RAT	TBC1 domain family, member 4 OS=Rattus norvegicus (Rat) OX=10116 GN=Tbc1d4 PE=1 SV=3	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	26.0	null	281-UNIMOD:730	0.02	26.0	1	1	1
PRT	sp|P48721|GRP75_RAT	Stress-70 protein, mitochondrial OS=Rattus norvegicus (Rat) OX=10116 GN=Hspa9 PE=1 SV=3	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	26.0	null	266-UNIMOD:730	0.03	26.0	1	1	1
PRT	sp|Q9QXJ0|TTL_RAT	Tubulin--tyrosine ligase OS=Rattus norvegicus (Rat) OX=10116 GN=Ttl PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	26.0	null	107-UNIMOD:730	0.05	26.0	1	1	1
PRT	sp|Q9EPY0|CARD9_RAT	Caspase recruitment domain-containing protein 9 OS=Rattus norvegicus (Rat) OX=10116 GN=Card9 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	26.0	null	39-UNIMOD:730	0.04	26.0	1	1	1
PRT	sp|Q62764|YBOX3_RAT	Y-box-binding protein 3 OS=Rattus norvegicus (Rat) OX=10116 GN=Ybx3 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	26.0	null	33-UNIMOD:730,76-UNIMOD:730	0.12	26.0	3	1	0
PRT	tr|A0A0G2K8W9|A0A0G2K8W9_RAT	Spectrin beta chain OS=Rattus norvegicus (Rat) OX=10116 GN=Sptbn1 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	26.0	null	977-UNIMOD:730	0.01	26.0	2	1	0
PRT	sp|O54924|EXOC8_RAT	Exocyst complex component 8 OS=Rattus norvegicus (Rat) OX=10116 GN=Exoc8 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	26.0	null	92-UNIMOD:730	0.04	26.0	2	1	0
PRT	sp|O35331|PDXK_RAT	Pyridoxal kinase OS=Rattus norvegicus (Rat) OX=10116 GN=Pdxk PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	26.0	null	140-UNIMOD:730	0.07	26.0	1	1	1
PRT	sp|Q66H28|PACC1_RAT	Proton-activated chloride channel OS=Rattus norvegicus (Rat) OX=10116 GN=Pacc1 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	25.0	null	33-UNIMOD:730	0.07	25.0	1	1	1
PRT	sp|P23514|COPB_RAT	Coatomer subunit beta OS=Rattus norvegicus (Rat) OX=10116 GN=Copb1 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	25.0	null	791-UNIMOD:730	0.03	25.0	1	1	1
PRT	sp|Q9Z1A5|ULA1_RAT	NEDD8-activating enzyme E1 regulatory subunit OS=Rattus norvegicus (Rat) OX=10116 GN=Nae1 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	25.0	null	271-UNIMOD:730	0.04	25.0	1	1	1
PRT	sp|Q5U1Z0|RBGPR_RAT	Rab3 GTPase-activating protein non-catalytic subunit OS=Rattus norvegicus (Rat) OX=10116 GN=Rab3gap2 PE=1 SV=2	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	25.0	null	976-UNIMOD:730	0.02	25.0	1	1	1
PRT	sp|P83953|IMA5_RAT	Importin subunit alpha-5 OS=Rattus norvegicus (Rat) OX=10116 GN=Kpna1 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	25.0	null	113-UNIMOD:730	0.04	25.0	1	1	1
PRT	tr|Q6MGC3|Q6MGC3_RAT	WD_REPEATS_REGION domain-containing protein OS=Rattus norvegicus (Rat) OX=10116 GN=Wdr46 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	25.0	null	89-UNIMOD:730	0.04	25.0	1	1	1
PRT	sp|Q6P502|TCPG_RAT	T-complex protein 1 subunit gamma OS=Rattus norvegicus (Rat) OX=10116 GN=Cct3 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	25.0	null	49-UNIMOD:730,59-UNIMOD:35,49-UNIMOD:35,54-UNIMOD:35	0.04	25.0	4	1	0
PRT	tr|A0A0G2JXP3|A0A0G2JXP3_RAT	NEDD4-like E3 ubiquitin protein ligase OS=Rattus norvegicus (Rat) OX=10116 GN=Nedd4l PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	25.0	null	301-UNIMOD:730	0.02	25.0	1	1	1
PRT	sp|Q9WVR3|SHIP2_RAT	Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2 OS=Rattus norvegicus (Rat) OX=10116 GN=Inppl1 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	25.0	null	71-UNIMOD:730	0.02	25.0	1	1	1
PRT	sp|P34926|MAP1A_RAT	Microtubule-associated protein 1A OS=Rattus norvegicus (Rat) OX=10116 GN=Map1a PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	25.0	null	1776-UNIMOD:730,1757-UNIMOD:730	0.01	25.0	2	2	2
PRT	tr|A0A0G2JVW5|A0A0G2JVW5_RAT	Isoform of P51593, E3 ubiquitin-protein ligase HUWE1 OS=Rattus norvegicus (Rat) OX=10116 GN=Huwe1 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	25.0	null	2580-UNIMOD:730	0.01	25.0	1	1	1
PRT	tr|M0R7A6|M0R7A6_RAT	Intersectin 2 OS=Rattus norvegicus (Rat) OX=10116 GN=Itsn2 PE=1 SV=2	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	24.0	null	315-UNIMOD:730	0.01	24.0	1	1	1
PRT	tr|A0A0U1RRV5|A0A0U1RRV5_RAT	Clustered mitochondria protein homolog OS=Rattus norvegicus (Rat) OX=10116 GN=Cluh PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	24.0	null	214-UNIMOD:730,222-UNIMOD:39	0.02	24.0	1	1	1
PRT	tr|A0A0G2QC22|A0A0G2QC22_RAT	PAXX, non-homologous end joining factor OS=Rattus norvegicus (Rat) OX=10116 GN=Paxx PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1001476, X!Tandem, ]	24.0	null	2-UNIMOD:730,11-UNIMOD:39	0.10	24.0	1	1	1
PRT	sp|P54319|PLAP_RAT	Phospholipase A-2-activating protein OS=Rattus norvegicus (Rat) OX=10116 GN=Plaa PE=1 SV=3	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	24.0	null	477-UNIMOD:730	0.03	24.0	1	1	1
PRT	tr|B5DEG8|B5DEG8_RAT	LOC685144 protein OS=Rattus norvegicus (Rat) OX=10116 GN=Sec24c PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	24.0	null	322-UNIMOD:730	0.02	24.0	1	1	1
PRT	tr|D4A1G8|D4A1G8_RAT	FHA domain-containing protein OS=Rattus norvegicus (Rat) OX=10116 GN=Cep170b PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	24.0	null	977-UNIMOD:730	0.01	24.0	1	1	1
PRT	tr|F1LW07|F1LW07_RAT	Protein phosphatase 1, regulatory subunit 13-like OS=Rattus norvegicus (Rat) OX=10116 GN=Ppp1r13l PE=1 SV=2	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	24.0	null	490-UNIMOD:730	0.03	24.0	1	1	1
PRT	sp|Q5XI28|RAVR1_RAT	Ribonucleoprotein PTB-binding 1 OS=Rattus norvegicus (Rat) OX=10116 GN=Raver1 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	24.0	null	583-UNIMOD:730	0.03	24.0	1	1	1
PRT	sp|Q5PQN9|RM38_RAT	39S ribosomal protein L38, mitochondrial OS=Rattus norvegicus (Rat) OX=10116 GN=Mrpl38 PE=2 SV=2	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	24.0	null	29-UNIMOD:730	0.05	24.0	1	1	1
PRT	sp|Q9Z1I6|ARHG1_RAT	Rho guanine nucleotide exchange factor 1 OS=Rattus norvegicus (Rat) OX=10116 GN=Arhgef1 PE=2 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	24.0	null	780-UNIMOD:730	0.03	24.0	1	1	1
PRT	sp|G3V7W1|PDCD6_RAT	Programmed cell death protein 6 OS=Rattus norvegicus (Rat) OX=10116 GN=Pdcd6 PE=2 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	24.0	null	40-UNIMOD:730	0.15	24.0	1	1	1
PRT	sp|Q4KLH4|PSPC1_RAT	Paraspeckle component 1 OS=Rattus norvegicus (Rat) OX=10116 GN=Pspc1 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	23.0	null	482-UNIMOD:730	0.05	23.0	1	1	1
PRT	tr|B5DF65|B5DF65_RAT	NAD(P)-bd_dom domain-containing protein OS=Rattus norvegicus (Rat) OX=10116 GN=Blvrb PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	23.0	null	64-UNIMOD:730	0.15	23.0	1	1	1
PRT	tr|D4A8H5|D4A8H5_RAT	Protein phosphatase 4, regulatory subunit 2 OS=Rattus norvegicus (Rat) OX=10116 GN=Ppp4r2 PE=1 SV=2	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	23.0	null	182-UNIMOD:730	0.05	23.0	1	1	1
PRT	sp|P48500|TPIS_RAT	Triosephosphate isomerase OS=Rattus norvegicus (Rat) OX=10116 GN=Tpi1 PE=1 SV=2	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	23.0	null	34-UNIMOD:730,42-UNIMOD:39	0.08	23.0	1	1	1
PRT	tr|D3ZU13|D3ZU13_RAT	Eukaryotic translation initiation factor 4 gamma, 1 OS=Rattus norvegicus (Rat) OX=10116 GN=Eif4g1 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1001476, X!Tandem, ]	23.0	null	538-UNIMOD:730,579-UNIMOD:730	0.03	23.0	3	1	0
PRT	sp|A2RUW1|TOLIP_RAT	Toll-interacting protein OS=Rattus norvegicus (Rat) OX=10116 GN=Tollip PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1001476, X!Tandem, ]	23.0	null	24-UNIMOD:730	0.12	23.0	1	1	1
PRT	sp|Q91V33|KHDR1_RAT	KH domain-containing, RNA-binding, signal transduction-associated protein 1 OS=Rattus norvegicus (Rat) OX=10116 GN=Khdrbs1 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	23.0	null	57-UNIMOD:730,96-UNIMOD:730	0.09	23.0	5	1	0
PRT	sp|P35571|GPDM_RAT	Glycerol-3-phosphate dehydrogenase, mitochondrial OS=Rattus norvegicus (Rat) OX=10116 GN=Gpd2 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	22.0	null	609-UNIMOD:730	0.03	22.0	2	1	0
PRT	sp|Q80WF4|T132A_RAT	Transmembrane protein 132A OS=Rattus norvegicus (Rat) OX=10116 GN=Tmem132a PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	22.0	null	510-UNIMOD:730	0.02	22.0	1	1	1
PRT	tr|M0R3Z8|M0R3Z8_RAT	RCG28930, isoform CRA_b OS=Rattus norvegicus (Rat) OX=10116 GN=Rbm15 PE=1 SV=2	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	22.0	null	852-UNIMOD:730	0.02	22.0	1	1	1
PRT	tr|F1LSC3|F1LSC3_RAT	CCHC-type domain-containing protein OS=Rattus norvegicus (Rat) OX=10116 GN=Sf1 PE=1 SV=2	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	21.0	null	31-UNIMOD:730	0.03	21.0	1	1	1
PRT	tr|B1WBV1|B1WBV1_RAT	Axin interactor, dorsalization-associated OS=Rattus norvegicus (Rat) OX=10116 GN=Aida PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	21.0	null	194-UNIMOD:730	0.06	21.0	1	1	1
PRT	sp|Q5U300|UBA1_RAT	Ubiquitin-like modifier-activating enzyme 1 OS=Rattus norvegicus (Rat) OX=10116 GN=Uba1 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	21.0	null	351-UNIMOD:730	0.02	21.0	1	1	1
PRT	tr|B1WC34|B1WC34_RAT	EF-hand domain-containing protein OS=Rattus norvegicus (Rat) OX=10116 GN=Prkcsh PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	21.0	null	353-UNIMOD:730,353-UNIMOD:35	0.04	21.0	2	1	0
PRT	tr|A0A0G2JTK6|A0A0G2JTK6_RAT	Metastasis-associated 1 family, member 3 OS=Rattus norvegicus (Rat) OX=10116 GN=Mta3 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	21.0	null	346-UNIMOD:730	0.04	21.0	1	1	1
PRT	tr|D3ZVW3|D3ZVW3_RAT	Zinc finger CCCH-type-containing 4 OS=Rattus norvegicus (Rat) OX=10116 GN=Zc3h4 PE=1 SV=2	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	21.0	null	867-UNIMOD:730	0.02	21.0	1	1	1
PRT	sp|Q8VD52|PLPP_RAT	Pyridoxal phosphate phosphatase OS=Rattus norvegicus (Rat) OX=10116 GN=Pdxp PE=1 SV=2	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	20.0	null	100-UNIMOD:730	0.07	20.0	1	1	1
PRT	tr|D3ZA84|D3ZA84_RAT	Talin 2 OS=Rattus norvegicus (Rat) OX=10116 GN=Tln2 PE=1 SV=3	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	20.0	null	38-UNIMOD:730	0.01	20.0	1	1	1
PRT	sp|P0C865|MK07_RAT	Mitogen-activated protein kinase 7 OS=Rattus norvegicus (Rat) OX=10116 GN=Mapk7 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	20.0	null	544-UNIMOD:730	0.03	20.0	1	1	1
PRT	tr|D3ZWS6|D3ZWS6_RAT	N-acetyltransferase domain-containing protein OS=Rattus norvegicus (Rat) OX=10116 GN=Naa30 PE=1 SV=2	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	19.0	null	72-UNIMOD:730,72-UNIMOD:39	0.06	19.0	1	1	1
PRT	sp|Q63921|PGH1_RAT	Prostaglandin G/H synthase 1 OS=Rattus norvegicus (Rat) OX=10116 GN=Ptgs1 PE=2 SV=2	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	19.0	null	584-UNIMOD:730	0.03	19.0	1	1	1
PRT	tr|A0A0G2KAD4|A0A0G2KAD4_RAT	Protein LBH OS=Rattus norvegicus (Rat) OX=10116 GN=Lbh PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1001476, X!Tandem, ]	19.0	null	60-UNIMOD:730	0.19	19.0	1	1	1
PRT	tr|M0RD40|M0RD40_RAT	SIK family kinase 3 OS=Rattus norvegicus (Rat) OX=10116 GN=Sik3 PE=1 SV=2	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	18.0	null	470-UNIMOD:730	0.02	18.0	1	1	1
PRT	sp|Q80U96|XPO1_RAT	Exportin-1 OS=Rattus norvegicus (Rat) OX=10116 GN=Xpo1 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	18.0	null	1052-UNIMOD:730,1070-UNIMOD:39,1069-UNIMOD:35	0.02	18.0	2	1	0
PRT	tr|Q3ZAU5|Q3ZAU5_RAT	DDHD domain-containing protein OS=Rattus norvegicus (Rat) OX=10116 GN=Ddhd1 PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	18.0	null	224-UNIMOD:730,241-UNIMOD:39	0.02	18.0	1	1	1
PRT	sp|Q4V890|FEM1A_RAT	Protein fem-1 homolog A OS=Rattus norvegicus (Rat) OX=10116 GN=Fem1a PE=2 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	18.0	null	338-UNIMOD:730	0.03	18.0	1	1	1
PRT	sp|Q10758|K2C8_RAT	Keratin, type II cytoskeletal 8 OS=Rattus norvegicus (Rat) OX=10116 GN=Krt8 PE=1 SV=3	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	18.0	null	234-UNIMOD:730,248-UNIMOD:35	0.04	18.0	2	1	0
PRT	sp|P85968|6PGD_RAT	6-phosphogluconate dehydrogenase, decarboxylating OS=Rattus norvegicus (Rat) OX=10116 GN=Pgd PE=1 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	18.0	null	88-UNIMOD:730	0.04	18.0	1	1	1
PRT	sp|Q64566|AT2C1_RAT	Calcium-transporting ATPase type 2C member 1 OS=Rattus norvegicus (Rat) OX=10116 GN=Atp2c1 PE=2 SV=1	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	16.0	null	198-UNIMOD:730	0.02	16.0	1	1	1
PRT	sp|Q9JIH7|WNK1_RAT	Serine/threonine-protein kinase WNK1 OS=Rattus norvegicus (Rat) OX=10116 GN=Wnk1 PE=1 SV=2	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	15.0	null	1852-UNIMOD:730	0.01	15.0	1	1	1
PRT	tr|F1LQP9|F1LQP9_RAT	Importin N-terminal domain-containing protein OS=Rattus norvegicus (Rat) OX=10116 GN=Tnpo1 PE=1 SV=3	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	15.0	null	884-UNIMOD:730	0.01	15.0	1	1	1
PRT	tr|D3ZCQ0|D3ZCQ0_RAT	LAM_G_DOMAIN domain-containing protein OS=Rattus norvegicus (Rat) OX=10116 GN=Col19a1 PE=4 SV=3	null	null	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	15.0	null	179-UNIMOD:730,184-UNIMOD:35,186-UNIMOD:39	0.02	15.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	LVQDVANNTNEEAGDGTTTATVLAR	1	sp|P63039|CH60_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	49	1-UNIMOD:730	ms_run[1]:scan=1.1.2115.4	43.88227	3	2863.338971	2863.446613	K	S	97	122
PSM	QEPLGSDSEGVNCLAYDEAIMAQQDR	2	sp|B2RYG6|OTUB1_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	47	1-UNIMOD:730,13-UNIMOD:39	ms_run[1]:scan=1.1.2317.2	60.45035	3	3188.336171	3188.436719	K	I	11	37
PSM	VVETSSTTEASAAVASLGPAVSPR	3	tr|Q642B5|Q642B5_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	46	1-UNIMOD:730	ms_run[1]:scan=1.1.2153.4	46.90405	3	2590.280471	2590.375680	K	V	161	185
PSM	DTVDSAGTSPTAVLAAGEDAGAGR	4	sp|A8WCF8|TPRGL_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	45	1-UNIMOD:730	ms_run[1]:scan=1.1.1999.2	36.39392	3	2492.145671	2492.229744	R	Q	6	30
PSM	GGGGFGGGPGPGGLQSGQTIALPAQGLIEFR	5	sp|Q68A21|PURB_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	45	1-UNIMOD:730	ms_run[1]:scan=1.1.2363.2	65.17892	3	3156.545171	3156.662300	R	D	156	187
PSM	ALIGMTAGATGAFVGTPAEVALIR	6	tr|G3V6H5|G3V6H5_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	44	1-UNIMOD:730	ms_run[1]:scan=1.1.2427.4	72.2237	3	2590.367171	2590.445949	K	M	123	147
PSM	TAMVAALSPADINYDETLSTLR	7	sp|F1M4A4|KIF1A_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	43	1-UNIMOD:730	ms_run[1]:scan=1.1.2382.2	67.25163	3	2655.289571	2655.373237	R	Y	325	347
PSM	EDSVSEVTVEDSGESLEDLMAR	8	sp|Q5M7A4|UBA5_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	43	1-UNIMOD:730	ms_run[1]:scan=1.1.2297.2	58.54833	3	2700.186371	2700.259055	R	M	378	400
PSM	TSIEDQDELSSLLQVPLVAGTVNR	9	sp|Q3KRD8|IF6_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	42	1-UNIMOD:730	ms_run[1]:scan=1.1.2448.3	74.4897	3	2887.444871	2887.544536	K	G	165	189
PSM	LVQDVANNTNEEAGDGTTTATVLAR	10	sp|P63039|CH60_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	42	1-UNIMOD:730	ms_run[1]:scan=1.1.2143.4	46.02745	3	2864.341571	2863.446613	K	S	97	122
PSM	LAQQAGATGVVNIDEVDLEGR	11	tr|D3ZLC1|D3ZLC1_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	42	1-UNIMOD:730	ms_run[1]:scan=1.1.2187.4	49.36257	3	2458.226471	2458.297036	R	F	460	481
PSM	VLPAQATEYAFAFIQVPQDEDAR	12	sp|Q66X93|SND1_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	42	1-UNIMOD:730	ms_run[1]:scan=1.1.2480.2	76.62763	3	2882.390771	2882.475728	R	T	787	810
PSM	GGGEDEVGEEDEEAAEAEAEAEEAER	13	tr|M0RDR2|M0RDR2_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	42	1-UNIMOD:730	ms_run[1]:scan=1.1.2015.3	37.3626	3	3010.136171	3010.258991	R	A	375	401
PSM	ITSFIVPEPSLASQTVQEGSR	14	sp|Q5PPG7|EIF2D_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	42	1-UNIMOD:730	ms_run[1]:scan=1.1.2306.3	59.5046	3	2549.262371	2549.364387	R	E	339	360
PSM	SFCPGGTDSVSPPPSVIAQENLGR	15	tr|F1M403|F1M403_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	42	1-UNIMOD:730,3-UNIMOD:39	ms_run[1]:scan=1.1.2216.3	51.66558	3	2764.265471	2764.346705	K	V	157	181
PSM	LVAADNQDTGSLPQLAVPAPR	16	tr|A0A0G2K916|A0A0G2K916_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	41	1-UNIMOD:730	ms_run[1]:scan=1.1.2194.4	49.82553	3	2436.249671	2436.327942	R	V	2101	2122
PSM	VLSNEPAASAAEEEVEDDALVR	17	tr|F1M1D5|F1M1D5_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1001476, X!Tandem, ]	41	1-UNIMOD:730	ms_run[1]:scan=1.1.2232.2	52.97653	3	2617.2272	2617.3022	M	A	2	24
PSM	NVMSAFGLTDDQVSGPPSAPTEDR	18	tr|Q6AYR1|Q6AYR1_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	41	1-UNIMOD:730	ms_run[1]:scan=1.1.2225.4	52.44153	3	2794.251371	2794.338643	K	S	181	205
PSM	GAIVPAQEVPPPTVPMDYSWAR	19	sp|P16638|ACLY_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	41	1-UNIMOD:730	ms_run[1]:scan=1.1.2272.2	56.53573	3	2684.304071	2684.393913	K	E	807	829
PSM	LQVEPAVDTSGVQCYGPGIEGQGVFR	20	tr|C0JPT7|C0JPT7_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	40	1-UNIMOD:730,14-UNIMOD:39	ms_run[1]:scan=1.1.2312.2	60.08737	3	3055.415171	3055.504997	K	E	1247	1273
PSM	QQPVSESPPTDEAAGSGGSEVGR	21	sp|Q4G061|EIF3B_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	40	1-UNIMOD:730	ms_run[1]:scan=1.1.1727.2	18.66538	3	2545.139171	2545.219908	R	T	22	45
PSM	VGASNLPAGISLPASANLLLSTDSTR	22	sp|Q794F9|4F2_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	40	1-UNIMOD:730	ms_run[1]:scan=1.1.2384.2	67.46803	3	2828.445671	2828.555041	R	L	472	498
PSM	DGDAPLTAAGVDLPGTAVLSGR	23	tr|E9PTX9|E9PTX9_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	40	1-UNIMOD:730	ms_run[1]:scan=1.1.2251.3	54.65908	3	2356.182971	2356.254108	R	E	18	40
PSM	VTFSDDDEIINPEDVDPSVGR	24	tr|B1WC70|B1WC70_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	40	1-UNIMOD:730	ms_run[1]:scan=1.1.2228.2	52.67385	3	2622.189971	2622.260375	R	F	201	222
PSM	EAVPVPVQEVEIDATTALSGPR	25	tr|A0A0G2K226|A0A0G2K226_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	39	1-UNIMOD:730	ms_run[1]:scan=1.1.2386.2	67.69131	3	2581.299371	2581.390602	K	E	118	140
PSM	EFQASPLLLPAPSQVPQLLGR	26	sp|P86182|CCD22_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	38	1-UNIMOD:730	ms_run[1]:scan=1.1.2413.2	70.66198	3	2564.368271	2564.463313	R	A	182	203
PSM	MDTDLETMDLDQGGEALAPR	27	sp|F1LNJ2|U520_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	38	1-UNIMOD:730	ms_run[1]:scan=1.1.2205.3	50.69387	3	2481.117071	2481.167009	R	Q	387	407
PSM	SEGQLNGETNAPIEGNQAGDTAASAR	28	tr|F1MAQ7|F1MAQ7_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	38	1-UNIMOD:730	ms_run[1]:scan=1.1.1765.3	21.14542	3	2862.249071	2861.369425	R	S	29	55
PSM	LLEDGDDFSLNDALDSSNSMQTVQR	29	sp|Q5BJY9|K1C18_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	38	1-UNIMOD:730	ms_run[1]:scan=1.1.2326.4	61.43272	3	3073.334171	3073.445293	R	T	376	401
PSM	GIPSEAESFTTLSCEPDTPNAPR	30	tr|D3ZEA0|D3ZEA0_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	38	1-UNIMOD:730,14-UNIMOD:39	ms_run[1]:scan=1.1.2241.3	53.7607	3	2768.226071	2768.294001	K	I	354	377
PSM	SFLGNDDIGNLDGQVPDLDDLAR	31	tr|M0R3M4|M0R3M4_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	38	1-UNIMOD:730	ms_run[1]:scan=1.1.2373.2	66.26002	3	2762.274971	2762.366572	R	Y	399	422
PSM	IYPEEMIQTGISAIDGMNSIAR	32	sp|P62815|VATB2_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	37	1-UNIMOD:730,6-UNIMOD:35	ms_run[1]:scan=1.1.2366.4	65.56113	3	2728.284671	2728.371857	R	G	164	186
PSM	LVTPGSANETSSILVESVTR	33	tr|A0A0G2JXT8|A0A0G2JXT8_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	37	1-UNIMOD:730	ms_run[1]:scan=1.1.2239.2	53.5547	3	2363.212871	2363.285074	R	S	2476	2496
PSM	VQDDEVGDGTTSVTVLAAELLR	34	sp|Q5XIM9|TCPB_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	37	1-UNIMOD:730	ms_run[1]:scan=1.1.2453.2	74.99502	3	2591.287571	2591.359696	R	E	90	112
PSM	CPLEEGQAGAAEATAAPTLEER	35	sp|Q9R080|GPSM1_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	37	1-UNIMOD:730,1-UNIMOD:39	ms_run[1]:scan=1.1.2123.3	44.50072	3	2563.142771	2563.220108	R	A	513	535
PSM	ASDPPLAPDDDPDAPAAQLAR	36	sp|Q9QXU9|PCS1N_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	37	1-UNIMOD:730	ms_run[1]:scan=1.1.1946.3	32.99105	3	2406.115571	2406.196987	R	A	118	139
PSM	EIAVGDSEGQIVIYDVGEQIAVPR	37	sp|Q62871|DC1I2_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	37	1-UNIMOD:730	ms_run[1]:scan=1.1.2377.4	66.77597	3	2860.398371	2860.512508	R	N	584	608
PSM	GGGSGGGGTQGAEEEPPPPLQAVLVADSFDR	38	sp|Q64350|EI2BE_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	37	1-UNIMOD:730	ms_run[1]:scan=1.1.2346.4	63.49585	3	3255.470171	3255.595068	R	R	19	50
PSM	ILATPPQEDAPSVDIANIR	39	sp|P50137|TKT_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	37	1-UNIMOD:730	ms_run[1]:scan=1.1.2229.2	52.73728	3	2323.173371	2323.269030	K	M	284	303
PSM	DNSDFDLLTVSETANEPPQDEGNSFNSPR	40	sp|Q6AYK8|EIF3D_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	37	1-UNIMOD:730	ms_run[1]:scan=1.1.2217.4	51.79485	3	3498.425171	3498.596585	R	N	282	311
PSM	IEQGSLILSNVQPSDTMVTQCEAR	41	sp|Q05695|L1CAM_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	36	1-UNIMOD:730,21-UNIMOD:39	ms_run[1]:scan=1.1.2331.3	61.89788	3	2968.368071	2968.461083	R	N	383	407
PSM	TVTNAVVTVPAYFNDSQR	42	tr|F1LZI1|F1LZI1_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	36	1-UNIMOD:730	ms_run[1]:scan=1.1.2155.3	47.03712	3	2286.111971	2285.195865	K	Q	138	156
PSM	DAAAEYDELAEPQDFQDDPDIVAFR	43	sp|Q9QUR2|DCTN4_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	36	1-UNIMOD:730	ms_run[1]:scan=1.1.2321.4	60.91083	3	3143.336171	3143.451424	K	K	378	403
PSM	FSTSGLSISGLNPLPNPSYLLPPR	44	sp|P23565|AINX_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	36	1-UNIMOD:730	ms_run[1]:scan=1.1.2453.4	75.06523	3	2830.458671	2830.553585	R	I	407	431
PSM	GTGVVTSVPSDSPDDFAALR	45	tr|Q5PPJ6|Q5PPJ6_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	36	1-UNIMOD:730	ms_run[1]:scan=1.1.2111.3	43.5905	3	2294.104871	2294.169710	K	D	387	407
PSM	GVVPLAGTNGETTTQGLDGLSER	46	sp|P05065|ALDOA_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	36	1-UNIMOD:730	ms_run[1]:scan=1.1.2094.2	42.16908	3	2575.252571	2575.339629	K	C	112	135
PSM	IAQPTLLLYVDAGPETMTQR	47	sp|P39069|KAD1_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	36	1-UNIMOD:730	ms_run[1]:scan=1.1.2371.3	66.08338	3	2520.258671	2520.356465	K	L	109	129
PSM	NDVITVQTPAFAESVTEGDVR	48	sp|Q01205|ODO2_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	36	1-UNIMOD:730	ms_run[1]:scan=1.1.2197.4	50.03848	3	2551.236971	2551.307266	K	W	69	90
PSM	TTIPEEEEEEEEEPIGVAIEEER	49	tr|G3V7U4|G3V7U4_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	36	1-UNIMOD:730	ms_run[1]:scan=1.1.2149.2	46.48603	3	2989.299671	2989.408222	K	F	548	571
PSM	VTASGPGLSAYGVPASLPVEFAIDAR	50	tr|A0A0G2JXT8|A0A0G2JXT8_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	35	1-UNIMOD:730	ms_run[1]:scan=1.1.2420.2	71.38768	3	2848.418471	2848.527764	K	D	1520	1546
PSM	VGEQAQVVIIDMNDPSNPIR	51	sp|P11442|CLH1_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	35	1-UNIMOD:730	ms_run[1]:scan=1.1.2254.3	54.94147	3	2498.228771	2498.310577	K	R	44	64
PSM	ALPTAQAGALLLALPPASPR	52	tr|A0A0G2K1U9|A0A0G2K1U9_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	35	1-UNIMOD:730	ms_run[1]:scan=1.1.2362.3	65.10778	3	2231.265971	2231.330842	R	A	409	429
PSM	FVVDLSDQVAPTDIEEGMR	53	sp|Q63347|PRS7_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	35	1-UNIMOD:730	ms_run[1]:scan=1.1.2336.3	62.37363	3	2424.146471	2424.214946	K	V	121	140
PSM	AEMVVDPETMPYLDIANQTGR	54	tr|F7ES73|F7ES73_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	35	1-UNIMOD:730	ms_run[1]:scan=1.1.2335.3	62.29605	3	2653.219571	2653.303443	R	S	200	221
PSM	TPIEILQADAPPIIVGEEYPR	55	tr|D3ZGY2|D3ZGY2_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	35	1-UNIMOD:730	ms_run[1]:scan=1.1.2423.4	71.79068	3	2624.326271	2624.436824	K	N	240	261
PSM	TALPTSGSSTGELELLAGEVPAR	56	sp|O88339|EPN1_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	35	1-UNIMOD:730	ms_run[1]:scan=1.1.2263.2	55.77273	3	2559.287171	2559.369866	R	S	411	434
PSM	ITTQSPLNQSSMNAMGSLSILSPDR	57	tr|F1LRI5|F1LRI5_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	35	1-UNIMOD:730	ms_run[1]:scan=1.1.2340.2	62.77258	3	2951.393471	2951.499911	R	V	713	738
PSM	GDVEEVQGPGVVGEFPIISPGR	58	sp|D4ABP9|FBX3_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	35	1-UNIMOD:730	ms_run[1]:scan=1.1.2269.3	56.29118	3	2541.235571	2541.338172	K	I	338	360
PSM	LLEDGDDFSLNDALDSSNSMQTVQR	59	sp|Q5BJY9|K1C18_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	35	1-UNIMOD:730,20-UNIMOD:35	ms_run[1]:scan=1.1.2281.4	57.4145	3	3089.336171	3089.440208	R	T	376	401
PSM	ALINADELANDVAGAEALLDR	60	sp|P16086|SPTN1_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	35	1-UNIMOD:730	ms_run[1]:scan=1.1.2349.2	63.74473	3	2458.209071	2457.301787	K	H	382	403
PSM	TELPVTENVQTIPPPYVVR	61	sp|Q5XIJ6|BABA1_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	35	1-UNIMOD:730	ms_run[1]:scan=1.1.2195.3	49.86517	3	2455.281071	2455.362930	K	T	199	218
PSM	LDLSPSVSVATSTEQQEDAAR	62	sp|Q7TT49|MRCKB_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	35	1-UNIMOD:730	ms_run[1]:scan=1.1.2048.4	39.25962	3	2507.183771	2507.265795	K	S	981	1002
PSM	SVTSNQSDGTQESCESPDVLDR	63	tr|D4ACZ5|D4ACZ5_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	35	1-UNIMOD:730,14-UNIMOD:39	ms_run[1]:scan=1.1.1892.4	29.66197	3	2703.098771	2703.190658	R	H	317	339
PSM	VVAPTISSPVCQEQLVEAGR	64	tr|G3V852|G3V852_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	35	1-UNIMOD:730,11-UNIMOD:39	ms_run[1]:scan=1.1.2235.4	53.25062	3	2432.196071	2432.271021	K	L	722	742
PSM	AETAPPPTSIDDTPEVLNR	65	sp|Q91XU8|CDS2_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	35	1-UNIMOD:730	ms_run[1]:scan=1.1.1956.2	33.68805	3	2326.133471	2326.195925	R	A	38	57
PSM	IQESLIDLEGSADPTATLTAAEER	66	tr|D3ZTE2|D3ZTE2_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	35	1-UNIMOD:730	ms_run[1]:scan=1.1.2372.2	66.16296	3	2833.334471	2833.449967	R	K	58	82
PSM	GIVNGAAPELPVPTGGPMAGAR	67	sp|P62815|VATB2_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	34	1-UNIMOD:730	ms_run[1]:scan=1.1.2160.4	47.50758	3	2335.164071	2335.262505	R	E	8	30
PSM	EFQASPLLLPAPSQVPQLLGR	68	sp|P86182|CCD22_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	34	1-UNIMOD:730	ms_run[1]:scan=1.1.2412.4	70.61843	3	2564.368271	2564.463313	R	A	182	203
PSM	GLVEPVDVVDNADGTQTVNYVPSR	69	tr|C0JPT7|C0JPT7_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	34	1-UNIMOD:730	ms_run[1]:scan=1.1.2164.3	47.84238	3	2847.358571	2847.455721	K	E	1492	1516
PSM	AFGAPVPSVQWLDEEGTTVLQDER	70	sp|Q05695|L1CAM_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	34	1-UNIMOD:730	ms_run[1]:scan=1.1.2437.2	73.24947	3	2947.390571	2947.487021	K	F	449	473
PSM	GPIPSGIQGPNPMNMGAVVPQGSR	71	tr|A0A0G2K6F9|A0A0G2K6F9_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	34	1-UNIMOD:730	ms_run[1]:scan=1.1.2184.2	49.09173	3	2664.293171	2664.378280	R	Q	474	498
PSM	DGGSGVPPAGPGAASEALAVLTSFGR	72	sp|Q9Z1X1|ESYT1_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	34	1-UNIMOD:730	ms_run[1]:scan=1.1.2487.3	77.25242	3	2644.293971	2644.376349	R	R	27	53
PSM	DDFLGQVDVPLYPLPTENPR	73	sp|Q62940|NEDD4_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	34	1-UNIMOD:730	ms_run[1]:scan=1.1.2380.2	67.0226	3	2588.256071	2588.342923	R	M	156	176
PSM	EEFASTCPDDEEIELAYEQVAR	74	sp|Q6MG61|CLIC1_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	34	1-UNIMOD:730,7-UNIMOD:39	ms_run[1]:scan=1.1.2379.2	66.91752	3	2893.195571	2893.294060	R	A	217	239
PSM	QEPLGSDSEGVNCLAYDEAIMAQQDR	75	sp|B2RYG6|OTUB1_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	34	1-UNIMOD:730,13-UNIMOD:39,21-UNIMOD:35	ms_run[1]:scan=1.1.2247.2	54.30822	3	3204.335171	3204.431634	K	I	11	37
PSM	LCNAPQPPSQPLPGTAEEESR	76	tr|A0A0G2K2Z0|A0A0G2K2Z0_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	34	1-UNIMOD:730,2-UNIMOD:39	ms_run[1]:scan=1.1.2067.4	40.41722	3	2570.157371	2570.241177	R	V	840	861
PSM	TAMVATVSPAADNYDETLSTLR	77	tr|A0A0G2K8Z9|A0A0G2K8Z9_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	34	1-UNIMOD:730	ms_run[1]:scan=1.1.2223.3	52.34207	3	2629.238771	2629.321202	K	Y	324	346
PSM	EVEETDEMDQVELVDFDPNQER	78	sp|P63036|DNJA1_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	34	1-UNIMOD:730,8-UNIMOD:35	ms_run[1]:scan=1.1.2141.3	45.87645	3	2985.234071	2985.334011	K	R	351	373
PSM	FIIGESQAGEQPTQTVMPGQVMR	79	sp|Q03555|GEPH_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	34	1-UNIMOD:730,17-UNIMOD:35	ms_run[1]:scan=1.1.2133.4	45.33853	3	2823.326171	2823.420205	R	V	420	443
PSM	LTEAVVTEYLNSGNANDAVSGVR	80	tr|F1LN59|F1LN59_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	33	1-UNIMOD:730	ms_run[1]:scan=1.1.2295.3	58.40995	3	2683.284371	2682.376743	K	E	546	569
PSM	MLPTIIADNAGYDSADLVAQLR	81	sp|Q5XIM9|TCPB_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	33	1-UNIMOD:730,1-UNIMOD:35	ms_run[1]:scan=1.1.2455.4	75.28965	3	2666.333171	2666.389222	R	A	445	467
PSM	QTQTFTTYSDNQPGVLIQVYEGER	82	tr|A0A0G2JVI3|A0A0G2JVI3_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	33	1-UNIMOD:730	ms_run[1]:scan=1.1.2247.4	54.36472	3	3077.426171	3077.524864	K	A	344	368
PSM	EPEEPAPPEVLLQPGR	83	sp|Q0PGW2|DEN11_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	33	1-UNIMOD:730	ms_run[1]:scan=1.1.2057.4	39.77792	3	2061.047471	2061.104925	R	L	51	67
PSM	NSGMPSGAAAIAVLPVTLDTPMNR	84	sp|P11348|DHPR_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	33	1-UNIMOD:730	ms_run[1]:scan=1.1.2346.2	63.42582	3	2686.318571	2686.408911	K	K	165	189
PSM	EPPTDVTPTFLTTGVLSTLR	85	sp|Q4V7C6|GUAA_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	33	1-UNIMOD:730	ms_run[1]:scan=1.1.2403.3	69.6288	3	2448.256271	2448.341861	K	Q	570	590
PSM	GPEESQPPQLYAAEEDETPAAR	86	tr|D3ZW38|D3ZW38_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	33	1-UNIMOD:730	ms_run[1]:scan=1.1.1899.4	30.01977	3	2688.196871	2688.282174	R	D	10	32
PSM	MSVQPTVSLGGFEITPPVVLR	87	sp|P13084|NPM_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	33	1-UNIMOD:730	ms_run[1]:scan=1.1.2424.3	71.85867	3	2530.327571	2530.413586	K	L	81	102
PSM	TVITPDPNLSIDQVGVPR	88	tr|D4A5A6|D4A5A6_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	33	1-UNIMOD:730	ms_run[1]:scan=1.1.2179.3	48.76213	3	2224.165271	2224.237002	R	S	365	383
PSM	QSESSVSTPSASFEPDICESAESR	89	sp|Q5HZY0|UBXN4_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	33	1-UNIMOD:730,18-UNIMOD:39	ms_run[1]:scan=1.1.2151.3	46.69488	3	2879.200571	2879.274388	K	N	126	150
PSM	SSLQYSSPAPGGCGDQTLGDLLLTPTR	90	tr|G3V918|G3V918_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	33	1-UNIMOD:730,13-UNIMOD:39	ms_run[1]:scan=1.1.2363.3	65.20284	3	3083.411171	3083.521041	R	I	634	661
PSM	DVAWAPSIGLPTSTIASCSQDGR	91	sp|Q5XFW8|SEC13_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	33	1-UNIMOD:730,18-UNIMOD:39	ms_run[1]:scan=1.1.2350.2	63.83373	3	2681.226971	2681.309591	R	V	217	240
PSM	AIPDLTAPVAAVQAAVSNLVR	92	sp|P85972|VINC_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	32	1-UNIMOD:730	ms_run[1]:scan=1.1.3542.2	91.97275	3	2379.285071	2379.379249	K	V	36	57
PSM	IYPEEMIQTGISAIDGMNSIAR	93	sp|P62815|VATB2_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	32	1-UNIMOD:730,6-UNIMOD:35	ms_run[1]:scan=1.1.2356.3	64.43932	3	2728.282271	2728.371857	R	G	164	186
PSM	IAIPGLAGAGNSVLLVSNLNPER	94	sp|Q00438|PTBP1_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	32	1-UNIMOD:730	ms_run[1]:scan=1.1.2415.2	70.85732	3	2578.381571	2578.474941	R	V	350	373
PSM	ALIGMTAGATGAFVGTPAEVALIR	95	tr|G3V6H5|G3V6H5_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	32	1-UNIMOD:730,5-UNIMOD:35	ms_run[1]:scan=1.1.2343.2	63.11323	3	2606.343971	2606.440864	K	M	123	147
PSM	LLEPLDLSGGDEGEGEAAGGPR	96	tr|A0A0G2QC02|A0A0G2QC02_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	32	1-UNIMOD:730	ms_run[1]:scan=1.1.2244.3	54.03183	3	2442.174371	2442.218117	R	G	214	236
PSM	APLQVAVLGPTGVAEPVEVR	97	sp|D3ZHA0|FLNC_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	32	1-UNIMOD:730	ms_run[1]:scan=1.1.2250.3	54.56313	3	2305.262171	2305.331236	R	D	1476	1496
PSM	YVQLPADEVDTQLLQDAAR	98	tr|Q6MG66|Q6MG66_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	32	1-UNIMOD:730	ms_run[1]:scan=1.1.2290.3	58.07117	3	2448.194171	2448.280323	R	K	105	124
PSM	GVGIISEGNETVEDIAAR	99	sp|P06685|AT1A1_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	32	1-UNIMOD:730	ms_run[1]:scan=1.1.2099.3	42.5924	3	2134.044971	2133.122031	K	L	630	648
PSM	VLSQATPPTAGEAELATDQQER	100	sp|Q6IMX7|HPBP1_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	32	1-UNIMOD:730	ms_run[1]:scan=1.1.1994.3	36.12458	3	2615.253071	2615.334543	R	E	97	119
PSM	DVVENGEVAGQTLSLMEQLR	101	sp|Q66H61|SYQ_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	32	1-UNIMOD:730	ms_run[1]:scan=1.1.2368.2	65.72037	3	2492.195471	2491.289508	K	G	206	226
PSM	GNPVSSNPPAEVDPDTILR	102	tr|D4A2B0|D4A2B0_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	32	1-UNIMOD:730	ms_run[1]:scan=1.1.2062.4	40.11422	3	2281.118471	2281.185694	R	A	381	400
PSM	VVLGDSVDGGVTDYQPSGGADIR	103	tr|Q6DGG9|Q6DGG9_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	32	1-UNIMOD:730	ms_run[1]:scan=1.1.2098.2	42.47223	3	2580.216371	2580.297430	R	G	83	106
PSM	EAFQPQEPDFPPPPPDLEQLR	104	sp|P85972|VINC_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	31	1-UNIMOD:730	ms_run[1]:scan=1.1.2282.3	57.46992	3	2750.292671	2750.385851	R	L	833	854
PSM	IGVGGGAASSVQVQGDNTSDLDFGAVQR	105	tr|A0A0G2JTN4|A0A0G2JTN4_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	31	1-UNIMOD:730	ms_run[1]:scan=1.1.2125.3	44.64002	4	3008.442894	3008.510610	R	G	459	487
PSM	VQDDEVGDGTTSVTVLAAELLR	106	sp|Q5XIM9|TCPB_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	31	1-UNIMOD:730	ms_run[1]:scan=1.1.2465.2	76.11015	3	2591.287571	2591.359696	R	E	90	112
PSM	MLPTIIADNAGYDSADLVAQLR	107	sp|Q5XIM9|TCPB_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	31	1-UNIMOD:730	ms_run[1]:scan=1.1.2454.2	75.10503	3	2650.309271	2650.394307	R	A	445	467
PSM	AIAELGIYPAVDPLDSTSR	108	sp|P10719|ATPB_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	31	1-UNIMOD:730	ms_run[1]:scan=1.1.2356.2	64.40825	3	2291.162171	2291.231582	R	I	388	407
PSM	GDNVAVIGEIDEETDSALDLGNIR	109	tr|B2RZB6|B2RZB6_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	31	1-UNIMOD:730	ms_run[1]:scan=1.1.2392.3	68.39633	3	2818.332671	2818.413916	R	A	64	88
PSM	AEAPAGPALGLPSPEVESGLER	110	tr|D3ZXL5|D3ZXL5_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	31	1-UNIMOD:730	ms_run[1]:scan=1.1.2156.4	47.17542	3	2450.222471	2450.295973	K	G	13	35
PSM	AAASGPASASAPAAEILLTPAR	111	sp|Q5PQL7|ITM2C_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	31	1-UNIMOD:730	ms_run[1]:scan=1.1.2152.2	46.76725	3	2296.193471	2296.269364	K	E	21	43
PSM	EAAAAAAAAAVASSEPGNPLEAVVFEER	112	sp|P04177|TY3H_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1001476, X!Tandem, ]	31	1-UNIMOD:27	ms_run[1]:scan=1.1.2442.3	73.82085	4	2983.4552	2983.5192	R	D	50	78
PSM	DTVPLLAGGASGQLGNWMSPDEFQR	113	tr|F1LQJ7|F1LQJ7_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	31	1-UNIMOD:730	ms_run[1]:scan=1.1.2388.4	67.9844	3	2949.357671	2949.459761	R	A	118	143
PSM	DVGPTPMYPPTYLEPGIGR	114	tr|A0A0G2JVQ2|A0A0G2JVQ2_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	31	1-UNIMOD:730	ms_run[1]:scan=1.1.2214.3	51.4483	3	2363.149571	2363.213823	R	H	41	60
PSM	AVTPLYPANQADIIFDITEGNLR	115	tr|D3ZQ25|D3ZQ25_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	31	1-UNIMOD:730	ms_run[1]:scan=1.1.2496.2	78.17585	3	2834.407571	2834.512114	R	D	622	645
PSM	DLQILPPPLIPTPPSDEAR	116	sp|Q4V896|SNX15_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	31	1-UNIMOD:730	ms_run[1]:scan=1.1.2334.3	62.21368	3	2372.253671	2372.325817	R	L	138	157
PSM	LLEDGDDFSLNDALDSSNSMQTVQR	117	sp|Q5BJY9|K1C18_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	31	1-UNIMOD:730,20-UNIMOD:35	ms_run[1]:scan=1.1.2329.4	61.73075	3	3090.353171	3089.440208	R	T	376	401
PSM	DLYANTVLSGGTTMYPGIADR	118	sp|P60711|ACTB_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	31	1-UNIMOD:730	ms_run[1]:scan=1.1.2211.3	51.20343	3	2519.166671	2518.268044	K	M	292	313
PSM	LPSPTAAPQQSASQATPMTQGQGR	119	sp|P09951|SYN1_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	31	1-UNIMOD:730	ms_run[1]:scan=1.1.1852.3	26.56238	3	2713.272671	2713.376031	R	Q	506	530
PSM	YDVGAPSSITISLPGTDPQDAER	120	tr|D3ZE59|D3ZE59_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	31	1-UNIMOD:730	ms_run[1]:scan=1.1.2219.3	51.98043	3	2692.262771	2692.349859	R	R	260	283
PSM	ALIPTTAPQEPETYEDIIR	121	sp|P14173|DDC_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	31	1-UNIMOD:730	ms_run[1]:scan=1.1.2231.3	52.93768	3	2460.228371	2460.305475	R	D	40	59
PSM	ILATPPQEDAPSVDIANIR	122	sp|P50137|TKT_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	31	1-UNIMOD:730	ms_run[1]:scan=1.1.2242.3	53.86442	3	2323.173371	2323.269030	K	M	284	303
PSM	TTSPVIALQNGLSEDEALQR	123	sp|Q4KLG9|ZFN2B_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	31	1-UNIMOD:730	ms_run[1]:scan=1.1.2141.4	45.91148	3	2446.208171	2445.301787	R	A	185	205
PSM	LDPEAQQQLTTNPFQPGPEQLR	124	sp|P97586|CGRE1_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	31	1-UNIMOD:730	ms_run[1]:scan=1.1.2194.3	49.79048	3	2810.358971	2810.450576	R	R	30	52
PSM	EAFQPQEPDFPPPPPDLEQLR	125	sp|P85972|VINC_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	30	1-UNIMOD:730	ms_run[1]:scan=1.1.2270.2	56.35157	3	2750.292671	2750.385851	R	L	833	854
PSM	GIVNGAAPELPVPTGGPMAGAR	126	sp|P62815|VATB2_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	30	1-UNIMOD:730	ms_run[1]:scan=1.1.2165.2	47.88847	3	2336.155571	2335.262505	R	E	8	30
PSM	ITQSPGTVIPPLPPPSSVLPR	127	tr|Q642B5|Q642B5_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	30	1-UNIMOD:730	ms_run[1]:scan=1.1.2308.3	59.73405	3	2456.315771	2456.430950	R	G	264	285
PSM	IPSAVGYQPTLATDMGTMQER	128	sp|P10719|ATPB_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	30	1-UNIMOD:730	ms_run[1]:scan=1.1.2189.2	49.47357	3	2569.178171	2569.282314	R	I	325	346
PSM	VTGAPVPAVSEPQDGDDFQSR	129	tr|D3ZY44|D3ZY44_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	30	1-UNIMOD:730	ms_run[1]:scan=1.1.1944.3	32.85212	3	2475.135971	2475.218451	K	I	38	59
PSM	QPDPMPLPLTASETLVPR	130	tr|A0A0G2K0X1|A0A0G2K0X1_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	30	1-UNIMOD:730	ms_run[1]:scan=1.1.2294.4	58.33735	3	2265.162671	2265.234559	K	V	2004	2022
PSM	NVMSAFGLTDDQVSGPPSAPTEDR	131	tr|Q6AYR1|Q6AYR1_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	30	1-UNIMOD:730,3-UNIMOD:35	ms_run[1]:scan=1.1.2227.4	52.64177	3	2811.267971	2810.333558	K	S	181	205
PSM	NVMSAFGLTDDQVSGPPSAPTEDR	132	tr|Q6AYR1|Q6AYR1_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	30	1-UNIMOD:730,3-UNIMOD:35	ms_run[1]:scan=1.1.2066.3	40.32728	3	2810.246171	2810.333558	K	S	181	205
PSM	DLYANTVLSGGTTMYPGIADR	133	sp|P60711|ACTB_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	30	1-UNIMOD:730	ms_run[1]:scan=1.1.2236.3	53.30537	3	2519.199971	2518.268044	K	M	292	313
PSM	IGDPPQALPEEPMEVQGAER	134	sp|Q6MG49|BAG6_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	30	1-UNIMOD:730	ms_run[1]:scan=1.1.2064.4	40.22989	3	2466.153671	2466.236744	R	T	957	977
PSM	SFPDQFSTGEPPSLDEVPEVR	135	sp|Q9JHW1|CBPD_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	30	1-UNIMOD:730	ms_run[1]:scan=1.1.2232.3	53.00903	3	2636.212271	2636.291282	R	A	219	240
PSM	FGNPLLVQDVESYDPVLNPVLNR	136	sp|P38650|DYHC1_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	30	1-UNIMOD:730	ms_run[1]:scan=1.1.2492.3	77.7536	3	2901.440471	2901.554313	R	E	3627	3650
PSM	APAAQPPATAAAPSAVGSPAAAPR	137	tr|D3ZTR5|D3ZTR5_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	30	1-UNIMOD:730	ms_run[1]:scan=1.1.1797.2	23.17268	3	2401.225271	2401.302061	R	Q	29	53
PSM	GVVPLAGTDGETTTQGLDGLLER	138	sp|P09117|ALDOC_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	30	1-UNIMOD:730	ms_run[1]:scan=1.1.2287.2	57.835	3	2602.296671	2602.375680	K	C	112	135
PSM	TDLNPDNLQGGDDLDPNYVLSSR	139	sp|P07335|KCRB_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	30	1-UNIMOD:730	ms_run[1]:scan=1.1.2193.3	49.72032	3	2821.266671	2821.367300	K	V	108	131
PSM	YPNPPMGSVSAPNLSTAEENLEYVR	140	sp|Q5U2U2|CRKL_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	30	1-UNIMOD:730	ms_run[1]:scan=1.1.2260.3	55.50163	3	3038.399171	3038.496206	R	T	105	130
PSM	ASPALGSGPDGSGDSLEMSSLDR	141	sp|Q75Q39|TOM70_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	30	1-UNIMOD:730	ms_run[1]:scan=1.1.2014.4	37.33363	3	2509.116671	2509.190916	R	A	93	116
PSM	NFVSWESQTQPQVQVQDEEITEDDLR	142	tr|M0R930|M0R930_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	30	1-UNIMOD:730	ms_run[1]:scan=1.1.2240.3	53.67608	4	3423.544894	3423.637327	K	L	132	158
PSM	LQTQPPSLPGQPPMYSGTIDCFR	143	sp|P97521|MCAT_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	30	1-UNIMOD:730,21-UNIMOD:39	ms_run[1]:scan=1.1.2347.2	63.53282	3	2882.300771	2882.407197	R	K	38	61
PSM	EPSPPIDEVINTPGVVDR	144	tr|F1LT58|F1LT58_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	30	1-UNIMOD:730	ms_run[1]:scan=1.1.2134.3	45.3927	3	2237.117471	2237.184632	K	F	116	134
PSM	EAFQPQEPDFPPPPPDLEQLR	145	sp|P85972|VINC_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	29	1-UNIMOD:730	ms_run[1]:scan=1.1.2258.3	55.32113	3	2750.292671	2750.385851	R	L	833	854
PSM	LLPPAQDGFEVLGAAELEAVR	146	tr|A0A0G2K1U9|A0A0G2K1U9_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	29	1-UNIMOD:730	ms_run[1]:scan=1.1.2457.2	75.44815	3	2498.269271	2498.368744	R	E	178	199
PSM	AAQPSVTASPQTEEFFDLIASSQSR	147	sp|Q9R080|GPSM1_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	29	1-UNIMOD:730	ms_run[1]:scan=1.1.2376.3	66.63905	3	2970.403271	2970.487750	R	R	535	560
PSM	AAPPPPPPPPPLESSPR	148	sp|Q2TL32|UBR4_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	29	1-UNIMOD:730	ms_run[1]:scan=1.1.1865.4	27.62393	3	2007.049871	2007.109616	K	V	606	623
PSM	VGIGAFPTEQDNEIGELLQTR	149	tr|D4AEP0|D4AEP0_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	29	1-UNIMOD:730	ms_run[1]:scan=1.1.2369.2	65.81935	3	2590.271171	2590.354551	R	G	304	325
PSM	LVGGAPEGPQTLLAAEEETQAR	150	tr|M0RB11|M0RB11_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	29	1-UNIMOD:730	ms_run[1]:scan=1.1.2220.4	52.11227	3	2540.258471	2540.338901	R	L	54	76
PSM	EDSVSEVTVEDSGESLEDLMAR	151	sp|Q5M7A4|UBA5_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	29	1-UNIMOD:730	ms_run[1]:scan=1.1.2296.3	58.49077	3	2701.223771	2700.259055	R	M	378	400
PSM	QLSVPIPGGSNGDVQQVGVIR	152	tr|D3ZUK4|D3ZUK4_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	29	1-UNIMOD:730	ms_run[1]:scan=1.1.2175.3	48.50965	3	2424.239771	2423.343926	R	C	178	199
PSM	NSGMPSGAAAIAVLPVTLDTPMNR	153	sp|P11348|DHPR_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	29	1-UNIMOD:730,4-UNIMOD:35	ms_run[1]:scan=1.1.2348.2	63.63748	3	2703.336671	2702.403826	K	K	165	189
PSM	MSVQPTVSLGGFEITPPVVLR	154	sp|P13084|NPM_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	29	1-UNIMOD:730,1-UNIMOD:35	ms_run[1]:scan=1.1.2396.2	68.81872	3	2546.315771	2546.408501	K	L	81	102
PSM	LPDGSSFTNQFPSDAPLEEAR	155	sp|Q5HZY0|UBXN4_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	29	1-UNIMOD:730	ms_run[1]:scan=1.1.2208.2	50.92485	3	2581.180871	2581.260316	R	Q	324	345
PSM	AELPPPYTAIASPGTSGIPVINCR	156	sp|Q4V888|PP4P2_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	29	1-UNIMOD:730,23-UNIMOD:39	ms_run[1]:scan=1.1.2361.3	64.99303	3	2773.349771	2773.444963	R	V	36	60
PSM	FIIGESQAGEQPTQTVMPGQVMR	157	sp|Q03555|GEPH_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	29	1-UNIMOD:730	ms_run[1]:scan=1.1.2211.4	51.2136	3	2807.328371	2807.425290	R	V	420	443
PSM	VAGPQPAQTGVAQASLGEYLFER	158	tr|M0R597|M0R597_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	29	1-UNIMOD:730	ms_run[1]:scan=1.1.2272.4	56.57115	3	2692.323371	2692.412734	R	L	156	179
PSM	GPGLGSTQGQTIALPAQGLIEFR	159	sp|P86252|PURA_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	29	1-UNIMOD:730	ms_run[1]:scan=1.1.2324.2	61.14687	3	2614.353071	2614.438555	R	L	65	88
PSM	FPAVGEPNIQQYAQNMGLPQNR	160	sp|P56558|OGT1_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	29	1-UNIMOD:730	ms_run[1]:scan=1.1.2293.4	58.28375	3	2775.301571	2775.406937	R	I	868	890
PSM	LPTDASEDADQPAGDSAIFLR	161	sp|P86182|CCD22_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	28	1-UNIMOD:730	ms_run[1]:scan=1.1.2164.4	47.86463	3	2492.160671	2492.233767	R	A	108	129
PSM	VPLPSLSPTMQAGTIAR	162	sp|P08461|ODP2_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	28	1-UNIMOD:730	ms_run[1]:scan=1.1.2202.2	50.40657	3	2042.093171	2042.150101	K	W	85	102
PSM	EPTPSIASDISLPIATQELR	163	tr|D3ZJ32|D3ZJ32_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	28	1-UNIMOD:730	ms_run[1]:scan=1.1.2309.2	59.80128	3	2441.256671	2441.332024	K	Q	675	695
PSM	STPSSQPSANGVQTEGLDYDR	164	tr|A0A0G2K6I4|A0A0G2K6I4_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	28	1-UNIMOD:730	ms_run[1]:scan=1.1.1795.3	23.07485	3	2513.102471	2512.198444	K	L	510	531
PSM	DLSAAGIGLLAAATQSLSMPASLGR	165	sp|P43244|MATR3_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	28	1-UNIMOD:730,19-UNIMOD:35	ms_run[1]:scan=1.1.2722.2	83.0519	3	2690.388671	2690.457970	R	M	20	45
PSM	QPDPMPLPLTASETLVPR	166	tr|A0A0G2K0X1|A0A0G2K0X1_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	28	1-UNIMOD:730,5-UNIMOD:35	ms_run[1]:scan=1.1.2187.2	49.31435	3	2281.173971	2281.229474	K	V	2004	2022
PSM	SGTGIGDEPEPQGLNGEAGPEDPSR	167	sp|F1LNI5|PPM1G_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	28	1-UNIMOD:730	ms_run[1]:scan=1.1.1858.4	27.06832	3	2770.173371	2769.299615	K	E	173	198
PSM	TSLSSPPWQEVVLPDPAEETR	168	tr|D3ZMR9|D3ZMR9_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	28	1-UNIMOD:730	ms_run[1]:scan=1.1.2301.4	58.99605	3	2641.271771	2641.354216	K	H	58	79
PSM	VSPSPVDPIVPVVPIGPPPAGFR	169	sp|P52873|PYC_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	28	1-UNIMOD:730	ms_run[1]:scan=1.1.2372.3	66.19805	3	2597.388071	2597.488800	K	D	520	543
PSM	MSVQPTVSLGGFEITPPVVLR	170	sp|P13084|NPM_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	28	1-UNIMOD:730,1-UNIMOD:35	ms_run[1]:scan=1.1.2387.4	67.86987	3	2546.315771	2546.408501	K	L	81	102
PSM	LVLPMDDSEPALNSLDDTR	171	tr|D3ZJ86|D3ZJ86_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	28	1-UNIMOD:730	ms_run[1]:scan=1.1.2292.3	58.18943	3	2404.138571	2404.209860	R	H	699	718
PSM	LLSQEPSNGISSDPTVFLDR	172	tr|D4AAM0|D4AAM0_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	28	1-UNIMOD:730	ms_run[1]:scan=1.1.2299.4	58.77333	3	2479.201871	2478.290888	K	L	595	615
PSM	GIVNGAAPELPVPTGGPMAGAR	173	sp|P62815|VATB2_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	27	1-UNIMOD:730	ms_run[1]:scan=1.1.2184.4	49.12798	3	2336.174171	2335.262505	R	E	8	30
PSM	IYPEEMIQTGISAIDGMNSIAR	174	sp|P62815|VATB2_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	27	1-UNIMOD:730,17-UNIMOD:35	ms_run[1]:scan=1.1.2451.2	74.78123	3	2728.289471	2728.371857	R	G	164	186
PSM	SEPEAPGSALSVDLPGLLGQLAR	175	tr|D3ZJ32|D3ZJ32_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	27	1-UNIMOD:730	ms_run[1]:scan=1.1.2488.4	77.36668	3	2580.300371	2580.406586	R	S	20	43
PSM	AAPPPPPPPPPPLGADR	176	sp|P20651|PP2BB_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	27	1-UNIMOD:730	ms_run[1]:scan=1.1.1883.3	28.91667	3	1947.035771	1947.088487	R	V	9	26
PSM	IGCFALSEPGNGSDAGAASTTAR	177	sp|P15651|ACADS_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	27	1-UNIMOD:730,3-UNIMOD:39	ms_run[1]:scan=1.1.2264.4	55.94477	3	2502.154571	2502.178577	K	E	149	172
PSM	NSGMPSGAAAIAVLPVTLDTPMNR	178	sp|P11348|DHPR_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	27	1-UNIMOD:730,22-UNIMOD:35	ms_run[1]:scan=1.1.2291.4	58.13817	3	2702.303171	2702.403826	K	K	165	189
PSM	MSVQPTVSLGGFEITPPVVLR	179	sp|P13084|NPM_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	27	1-UNIMOD:730,1-UNIMOD:35	ms_run[1]:scan=1.1.2428.4	72.33812	3	2546.323271	2546.408501	K	L	81	102
PSM	APVSALPLAPNNLGGGPIVLGGESR	180	sp|Q08851|STX5_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	27	1-UNIMOD:730	ms_run[1]:scan=1.1.2318.3	60.57212	3	2659.386671	2659.496404	R	A	214	239
PSM	NLPETIPWSPPPSVGASGTPDSR	181	sp|Q63433|PKN1_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	27	1-UNIMOD:730	ms_run[1]:scan=1.1.2188.3	49.42907	3	2665.275071	2665.365450	K	T	338	361
PSM	VSVNGTVVVEEPVGQLR	182	tr|A0A0G2JTN4|A0A0G2JTN4_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	26	1-UNIMOD:730	ms_run[1]:scan=1.1.2111.2	43.56992	3	2086.102871	2085.173673	R	A	991	1008
PSM	LAPPLVTLLSGEPEVQYVALR	183	sp|P62944|AP2B1_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	26	1-UNIMOD:730	ms_run[1]:scan=1.1.2701.2	82.6559	3	2568.393671	2568.483380	K	N	284	305
PSM	TPAAVLPTPVAVSQPIR	184	sp|O35889|AFAD_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	26	1-UNIMOD:730	ms_run[1]:scan=1.1.2128.3	44.89743	3	2020.140971	2020.198766	K	T	1352	1369
PSM	ESTGAQVQVAGDMLPNSTER	185	tr|Q6AY48|Q6AY48_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	26	1-UNIMOD:730,13-UNIMOD:35	ms_run[1]:scan=1.1.1823.2	24.83445	3	2410.089671	2409.174872	R	A	125	145
PSM	LGPQDSDPTEANLESAEPELCIR	186	tr|E9PT22|E9PT22_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	26	1-UNIMOD:730,21-UNIMOD:39	ms_run[1]:scan=1.1.2258.4	55.34521	3	2833.248371	2833.341679	K	L	18	41
PSM	NPAPPLDAVEQILPTLVR	187	tr|M0R7I0|M0R7I0_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	26	1-UNIMOD:730	ms_run[1]:scan=1.1.2495.4	78.13168	3	2246.226971	2246.294123	K	L	241	259
PSM	ALPSLASLPALASQPALASSR	188	tr|D3ZGN0|D3ZGN0_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	26	1-UNIMOD:730	ms_run[1]:scan=1.1.2360.2	64.84337	3	2324.233571	2324.337050	R	V	281	302
PSM	STNGDTFLGGEDFDQALLR	189	sp|P48721|GRP75_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	26	1-UNIMOD:730	ms_run[1]:scan=1.1.2309.3	59.82193	3	2360.069171	2359.159873	K	H	266	285
PSM	TPVAPAQNGIQLPVSNSR	190	sp|Q9QXJ0|TTL_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	26	1-UNIMOD:730	ms_run[1]:scan=1.1.1974.3	34.9682	3	2153.108171	2152.190720	K	T	107	125
PSM	VLNPDDEEQVLSDPNLVIR	191	sp|Q9EPY0|CARD9_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	26	1-UNIMOD:730	ms_run[1]:scan=1.1.2285.4	57.7379	3	2468.215571	2468.306538	K	K	39	58
PSM	TTIPEEEEEEEEEPIGVAIEEER	192	tr|G3V7U4|G3V7U4_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	26	1-UNIMOD:730	ms_run[1]:scan=1.1.2148.2	46.41303	3	2989.299671	2989.408222	K	F	548	571
PSM	SPAASGAPQAPAPAALLAGSPGGDAAPGPAPASSAPAGSEDAEK	193	sp|Q62764|YBOX3_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	26	1-UNIMOD:730,44-UNIMOD:730	ms_run[1]:scan=1.1.2093.2	42.1004	4	4400.102894	4400.234561	K	K	33	77
PSM	VIESTQDLGNDLAGVMALQR	194	tr|A0A0G2K8W9|A0A0G2K8W9_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	26	1-UNIMOD:730	ms_run[1]:scan=1.1.2310.3	59.90985	3	2435.179571	2433.284028	K	K	977	997
PSM	SSLESIPLALLPAAAAGASTGEDTAGAGPR	195	sp|O54924|EXOC8_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	26	1-UNIMOD:730	ms_run[1]:scan=1.1.2402.4	69.556	4	3053.536494	3054.614013	K	E	92	122
PSM	VVPMADIITPNQFEAELLSGR	196	sp|O35331|PDXK_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	26	1-UNIMOD:730	ms_run[1]:scan=1.1.2543.2	79.50737	3	2603.318771	2603.393579	K	K	140	161
PSM	QNSQLPAQVQNGPSQEEMEIQR	197	tr|A0A0G2K6I4|A0A0G2K6I4_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	25	1-UNIMOD:730	ms_run[1]:scan=1.1.1881.3	28.76142	3	2815.278971	2814.387324	R	R	123	145
PSM	ELVQVQGPGVVPGVDNESASSSIR	198	sp|Q66H28|PACC1_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	25	1-UNIMOD:730	ms_run[1]:scan=1.1.2103.4	42.94378	3	2727.328271	2727.434592	K	F	33	57
PSM	LVQDVANNTNEEAGDGTTTATVLAR	199	sp|P63039|CH60_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	25	1-UNIMOD:730	ms_run[1]:scan=1.1.2144.4	46.09237	4	2864.377694	2863.446613	K	S	97	122
PSM	DLSAAGIGLLAAATQSLSMPASLGR	200	sp|P43244|MATR3_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	25	1-UNIMOD:730,19-UNIMOD:35	ms_run[1]:scan=1.1.2725.2	83.11356	4	2690.420494	2690.457970	R	M	20	45
PSM	DLSAAGIGLLAAATQSLSMPASLGR	201	sp|P43244|MATR3_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	25	1-UNIMOD:730,19-UNIMOD:35	ms_run[1]:scan=1.1.3158.2	88.27489	3	2690.356571	2690.457970	R	M	20	45
PSM	VASTENGIIFGNIVYDVSGAASDR	202	sp|P23514|COPB_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	25	1-UNIMOD:730	ms_run[1]:scan=1.1.2415.4	70.92744	3	2759.290571	2758.408043	K	N	791	815
PSM	NVNTALNTTQIPSSIEDIFNDDR	203	sp|Q9Z1A5|ULA1_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	25	1-UNIMOD:730	ms_run[1]:scan=1.1.2393.4	68.54623	3	2880.359471	2880.440800	K	C	271	294
PSM	SPPEVSEVETDLGAVPDLLR	204	sp|Q5U1Z0|RBGPR_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	25	1-UNIMOD:730	ms_run[1]:scan=1.1.2400.2	69.259	3	2426.201771	2426.284740	R	L	976	996
PSM	LLEDGDDFSLNDALDSSNSMQTVQR	205	sp|Q5BJY9|K1C18_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	25	1-UNIMOD:730	ms_run[1]:scan=1.1.2342.4	63.07193	3	3074.348171	3073.445293	R	T	376	401
PSM	EPNPPIDEVINTPGVVAR	206	sp|P83953|IMA5_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	25	1-UNIMOD:730	ms_run[1]:scan=1.1.2133.2	45.28971	3	2220.141971	2220.205701	K	F	113	131
PSM	TLSGAQDPFPGPVPAPLEVAR	207	tr|Q6MGC3|Q6MGC3_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	25	1-UNIMOD:730	ms_run[1]:scan=1.1.2269.4	56.32618	3	2422.221071	2422.316315	R	K	89	110
PSM	MLLDPMGGIVMTNDGNAILR	208	sp|Q6P502|TCPG_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	25	1-UNIMOD:730	ms_run[1]:scan=1.1.2436.2	73.13496	3	2435.181371	2434.268912	K	E	49	69
PSM	LQITPDSNGEQFSALIQR	209	tr|A0A0G2JXP3|A0A0G2JXP3_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	25	1-UNIMOD:730	ms_run[1]:scan=1.1.2262.2	55.673	3	2321.149571	2320.232979	R	E	301	319
PSM	ILPDGEDFLAVQTSQGVPVR	210	sp|Q9WVR3|SHIP2_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	25	1-UNIMOD:730	ms_run[1]:scan=1.1.2321.2	60.84067	3	2444.226971	2444.321794	R	R	71	91
PSM	LQTQPPSLPGQPPMYSGTIDCFR	211	sp|P97521|MCAT_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	25	1-UNIMOD:730,14-UNIMOD:35,21-UNIMOD:39	ms_run[1]:scan=1.1.2297.4	58.6143	3	2898.306671	2898.402112	R	K	38	61
PSM	VPSAPGQESPVPDTESTAPMR	212	sp|P34926|MAP1A_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	25	1-UNIMOD:730	ms_run[1]:scan=1.1.1878.4	28.55067	3	2456.143871	2456.216008	R	N	1776	1797
PSM	LLGPSAAADILQLSSSLPLQSR	213	tr|A0A0G2JVW5|A0A0G2JVW5_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	25	1-UNIMOD:730	ms_run[1]:scan=1.1.2680.2	82.22456	3	2540.363471	2540.448057	R	G	2580	2602
PSM	VAPTPAGVFIDIPISNIR	214	sp|P08461|ODP2_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	24	1-UNIMOD:730	ms_run[1]:scan=1.1.2383.4	67.43632	3	2183.174771	2183.262094	R	R	397	415
PSM	TVTNAVVTVPAYFNDSQR	215	tr|F1LZI1|F1LZI1_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	24	1-UNIMOD:730	ms_run[1]:scan=1.1.2131.2	45.08802	3	2286.100271	2285.195865	K	Q	138	156
PSM	IPSAVGYQPTLATDMGTMQER	216	sp|P10719|ATPB_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	24	1-UNIMOD:730,18-UNIMOD:35	ms_run[1]:scan=1.1.2117.3	43.99685	3	2585.191271	2585.277229	R	I	325	346
PSM	AGQPLPLTLPPELVPPSFR	217	tr|M0R7A6|M0R7A6_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	24	1-UNIMOD:730	ms_run[1]:scan=1.1.2437.3	73.28455	3	2332.245671	2332.346158	K	G	315	334
PSM	GLEMDPIDCTPPEYILPGSR	218	tr|A0A0U1RRV5|A0A0U1RRV5_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	24	1-UNIMOD:730,9-UNIMOD:39	ms_run[1]:scan=1.1.2396.4	68.88892	3	2552.175671	2552.226773	K	E	214	234
PSM	APPPLSLPLCILPPGSGSPR	219	tr|A0A0G2QC22|A0A0G2QC22_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:730,10-UNIMOD:39	ms_run[1]:scan=1.1.2451.3	74.81631	3	2318.2182	2318.2792	M	L	2	22
PSM	ESTGAQVQVAGDMLPNSTER	220	tr|Q6AY48|Q6AY48_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	24	1-UNIMOD:730,13-UNIMOD:35	ms_run[1]:scan=1.1.1822.3	24.77655	3	2410.089671	2409.174872	R	A	125	145
PSM	ESTGAQVQVAGDMLPNSTER	221	tr|Q6AY48|Q6AY48_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	24	1-UNIMOD:730	ms_run[1]:scan=1.1.1947.3	33.05863	3	2394.091571	2393.179957	R	A	125	145
PSM	YVPGTSGPSNTVQTADPFTGAGR	222	sp|P54319|PLAP_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	24	1-UNIMOD:730	ms_run[1]:scan=1.1.2042.3	38.91745	3	2583.205571	2583.287199	R	Y	477	500
PSM	MLLDPMGGIVMTNDGNAILR	223	sp|Q6P502|TCPG_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	24	1-UNIMOD:730,11-UNIMOD:35	ms_run[1]:scan=1.1.2397.4	68.98558	3	2451.182771	2450.263827	K	E	49	69
PSM	LDPDAIPSPIQVIEDDR	224	tr|B5DEG8|B5DEG8_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	24	1-UNIMOD:730	ms_run[1]:scan=1.1.2373.4	66.33005	3	2196.092171	2196.158083	R	N	322	339
PSM	ESLLSPPAVPDPGVMTPGSAR	225	tr|D4A1G8|D4A1G8_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	24	1-UNIMOD:730	ms_run[1]:scan=1.1.2213.4	51.38963	3	2381.175971	2381.256751	K	E	977	998
PSM	LQPALPPEAQTVPELEEVAR	226	tr|F1LW07|F1LW07_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	24	1-UNIMOD:730	ms_run[1]:scan=1.1.2263.4	55.83633	3	2490.275471	2490.363659	R	V	490	510
PSM	LPPEPGLPDSYSFDYPTDVGPR	227	sp|Q5XI28|RAVR1_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	24	1-UNIMOD:730	ms_run[1]:scan=1.1.2277.4	57.01693	3	2722.253771	2722.343317	R	R	583	605
PSM	GPGLGSTQGQTIALPAQGLIEFR	228	sp|P86252|PURA_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	24	1-UNIMOD:730	ms_run[1]:scan=1.1.2328.2	61.56353	3	2615.358371	2614.438555	R	L	65	88
PSM	TPPLGPMPNEDIDVSNLER	229	sp|Q5PQN9|RM38_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	24	1-UNIMOD:730	ms_run[1]:scan=1.1.2180.3	48.82735	3	2397.153371	2397.215280	R	L	29	48
PSM	EPLLSSSENGTGGTEAAPADAR	230	sp|Q9Z1I6|ARHG1_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	24	1-UNIMOD:730	ms_run[1]:scan=1.1.1843.3	25.9168	3	2434.089971	2433.192630	R	T	780	802
PSM	SGVISDNELQQALSNGTWTPFNPVTVR	231	sp|G3V7W1|PDCD6_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	24	1-UNIMOD:730	ms_run[1]:scan=1.1.2412.2	70.5611	3	3234.509171	3233.662360	R	S	40	67
PSM	VGEQAQVVIIDMNDPSNPIR	232	sp|P11442|CLH1_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	23	1-UNIMOD:730,12-UNIMOD:35	ms_run[1]:scan=1.1.2096.2	42.30458	3	2514.222371	2514.305492	K	R	44	64
PSM	VQDDEVGDGTTSVTVLAAELLR	233	sp|Q5XIM9|TCPB_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	23	1-UNIMOD:730	ms_run[1]:scan=1.1.2479.4	76.58717	3	2591.287571	2591.359696	R	E	90	112
PSM	TVTNAVVTVPAYFNDSQR	234	tr|F1LZI1|F1LZI1_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	23	1-UNIMOD:730	ms_run[1]:scan=1.1.2185.4	49.20835	3	2286.095771	2285.195865	K	Q	138	156
PSM	IPSAVGYQPTLATDMGTMQER	235	sp|P10719|ATPB_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	23	1-UNIMOD:730,15-UNIMOD:35	ms_run[1]:scan=1.1.2192.4	49.69115	3	2586.219371	2585.277229	R	I	325	346
PSM	TGSETPQAPMSAVGPVSGGPGGFGR	236	sp|Q4KLH4|PSPC1_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	23	1-UNIMOD:730	ms_run[1]:scan=1.1.2020.4	37.65688	3	2604.222371	2604.290904	R	G	482	507
PSM	MSVQPTVSLGGFEITPPVVLR	237	sp|P13084|NPM_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	23	1-UNIMOD:730	ms_run[1]:scan=1.1.2435.2	73.02045	3	2530.327571	2530.413586	K	L	81	102
PSM	ALIPTTAPQEPETYEDIIR	238	sp|P14173|DDC_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	23	1-UNIMOD:730	ms_run[1]:scan=1.1.2234.2	53.14562	4	2460.252494	2460.305475	R	D	40	59
PSM	TVAGQDAVIVLLGTGNDLSPTTVMSEGTR	239	tr|B5DF65|B5DF65_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	23	1-UNIMOD:730	ms_run[1]:scan=1.1.2447.2	74.34232	4	3205.627694	3205.680712	K	N	64	93
PSM	LSLSAPLTTNGLPESTDSR	240	tr|D4A8H5|D4A8H5_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	23	1-UNIMOD:730	ms_run[1]:scan=1.1.2160.3	47.47242	3	2263.121171	2262.201010	K	D	182	201
PSM	LPADTEVVCAPPTAYIDFAR	241	sp|P48500|TPIS_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	23	1-UNIMOD:730,9-UNIMOD:39	ms_run[1]:scan=1.1.2418.4	71.23811	3	2498.167271	2498.249223	K	Q	34	54
PSM	EVDPAVPEVENQPPTGSNPSPESEGSAALPQPEEAEETWDSK	242	tr|D3ZU13|D3ZU13_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:730,42-UNIMOD:730	ms_run[1]:scan=1.1.2189.4	49.50525	4	5038.2062	5038.3932	K	E	538	580
PSM	ITPTQQQQQIQLDAQAAQQLQYGGAVGTVGR	243	sp|A2RUW1|TOLIP_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:730	ms_run[1]:scan=1.1.2207.3	50.87658	4	3599.7782	3599.8962	R	L	24	55
PSM	ASPATQPPPLLPPSNPGPDATVVGSAPTPLLPPSATAAAK	244	sp|Q91V33|KHDR1_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	23	1-UNIMOD:730,40-UNIMOD:730	ms_run[1]:scan=1.1.2291.3	58.12033	4	4361.266894	4361.409612	R	M	57	97
PSM	SVNESLNNLFITEEDYQALR	245	sp|P11442|CLH1_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	22	1-UNIMOD:730	ms_run[1]:scan=1.1.2345.3	63.3686	3	2659.263671	2658.344380	K	T	1462	1482
PSM	TEQLTDSTEISLLPPDIDR	246	sp|P35571|GPDM_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	22	1-UNIMOD:730	ms_run[1]:scan=1.1.2278.4	57.10993	3	2446.205771	2446.274569	R	Y	609	628
PSM	DLSAAGIGLLAAATQSLSMPASLGR	247	sp|P43244|MATR3_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	22	1-UNIMOD:730,19-UNIMOD:35	ms_run[1]:scan=1.1.2721.2	83.0079	3	2690.388671	2690.457970	R	M	20	45
PSM	VPGPAEGQLEPEAAAEEVER	248	sp|Q80WF4|T132A_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	22	1-UNIMOD:730	ms_run[1]:scan=1.1.2023.3	37.85365	3	2381.114171	2381.201738	R	R	510	530
PSM	VAGPNGYAILLAVPGSSDSR	249	tr|M0R3Z8|M0R3Z8_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	22	1-UNIMOD:730	ms_run[1]:scan=1.1.2298.3	58.67064	3	2248.143671	2247.216600	K	S	852	872
PSM	TEQLTDSTEISLLPPDIDR	250	sp|P35571|GPDM_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	21	1-UNIMOD:730	ms_run[1]:scan=1.1.2281.3	57.38568	3	2446.205771	2446.274569	R	Y	609	628
PSM	TVIPGMPTVIPPGLTR	251	tr|F1LSC3|F1LSC3_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	21	1-UNIMOD:730	ms_run[1]:scan=1.1.2302.3	59.06447	3	1952.079971	1952.143559	K	E	31	47
PSM	DLNGIDLTPVQDTPVASR	252	tr|B1WBV1|B1WBV1_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	21	1-UNIMOD:730	ms_run[1]:scan=1.1.2127.4	44.84815	3	2215.101971	2214.179881	K	K	194	212
PSM	VLPAQATEYAFAFIQVPQDEDAR	253	sp|Q66X93|SND1_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	21	1-UNIMOD:730	ms_run[1]:scan=1.1.2484.2	76.9095	4	2882.401294	2882.475728	R	T	787	810
PSM	NEEDATELVTLAQAVNAR	254	sp|Q5U300|UBA1_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	21	1-UNIMOD:730	ms_run[1]:scan=1.1.2316.4	60.41515	3	2248.101671	2247.164959	R	S	351	369
PSM	SFPDQFSTGEPPSLDEVPEVR	255	sp|Q9JHW1|CBPD_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	21	1-UNIMOD:730	ms_run[1]:scan=1.1.2228.3	52.68977	3	2638.197671	2636.291282	R	A	219	240
PSM	MPPYDEETQAIIDAAQEAR	256	tr|B1WC34|B1WC34_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	21	1-UNIMOD:730	ms_run[1]:scan=1.1.2296.2	58.47167	3	2451.111071	2451.189459	K	N	353	372
PSM	GTGGVDTAAVGGVFDVSNADR	257	sp|P07335|KCRB_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	21	1-UNIMOD:730	ms_run[1]:scan=1.1.2098.3	42.4994	3	2269.049471	2268.128908	R	L	321	342
PSM	AGTVNGAVGTPFQPQSALLGR	258	tr|A0A0G2JTK6|A0A0G2JTK6_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	21	1-UNIMOD:730	ms_run[1]:scan=1.1.2157.4	47.26342	3	2345.183171	2344.280598	K	A	346	367
PSM	EVDPAVPEVENQPPTGSNPSPESEGSAALPQPEEAEETWDSK	259	tr|D3ZU13|D3ZU13_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:730,42-UNIMOD:730	ms_run[1]:scan=1.1.2191.2	49.59381	4	5038.2062	5038.3932	K	E	538	580
PSM	QDVPPVPAALQSLPALDPR	260	tr|D3ZVW3|D3ZVW3_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	21	1-UNIMOD:730	ms_run[1]:scan=1.1.2323.3	61.09212	3	2287.192571	2287.284286	K	L	867	886
PSM	ASPATQPPPLLPPSNPGPDATVVGSAPTPLLPPSATAAAK	261	sp|Q91V33|KHDR1_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	21	1-UNIMOD:730,40-UNIMOD:730	ms_run[1]:scan=1.1.2289.2	57.967	6	4361.328141	4361.409612	R	M	57	97
PSM	FVVDLSDQVAPTDIEEGMR	262	sp|Q63347|PRS7_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	20	1-UNIMOD:730,18-UNIMOD:35	ms_run[1]:scan=1.1.2268.3	56.19007	3	2440.133471	2440.209861	K	V	121	140
PSM	DTVPLLAGGASGQLGNWMSPDEFQR	263	tr|F1LQJ7|F1LQJ7_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	20	1-UNIMOD:730	ms_run[1]:scan=1.1.2389.4	68.09882	3	2949.357671	2949.459761	R	A	118	143
PSM	VGASNLPAGISLPASANLLLSTDSTR	264	sp|Q794F9|4F2_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	20	1-UNIMOD:730	ms_run[1]:scan=1.1.2386.3	67.72632	4	2828.476894	2828.555041	R	L	472	498
PSM	GVVPLAGTNGETTTQGLDGLSER	265	sp|P05065|ALDOA_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	20	1-UNIMOD:730	ms_run[1]:scan=1.1.2218.4	51.90763	3	2576.251571	2575.339629	K	C	112	135
PSM	LPGPPDAPGAVFVLGGEGLR	266	sp|Q8VD52|PLPP_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	20	1-UNIMOD:730	ms_run[1]:scan=1.1.2348.3	63.67252	3	2222.167271	2222.236608	R	A	100	120
PSM	MLLDPMGGIVMTNDGNAILR	267	sp|Q6P502|TCPG_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	20	1-UNIMOD:730,1-UNIMOD:35	ms_run[1]:scan=1.1.2369.4	65.88955	3	2451.179171	2450.263827	K	E	49	69
PSM	GAIVPAQEVPPPTVPMDYSWAR	268	sp|P16638|ACLY_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	20	1-UNIMOD:730,16-UNIMOD:35	ms_run[1]:scan=1.1.2276.4	56.9152	3	2700.258071	2700.388828	K	E	807	829
PSM	NSGMPSGAAAIAVLPVTLDTPMNR	269	sp|P11348|DHPR_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	20	1-UNIMOD:730,22-UNIMOD:35	ms_run[1]:scan=1.1.2347.3	63.56398	3	2702.331971	2702.403826	K	K	165	189
PSM	EVDPAVPEVENQPPTGSNPSPESEGSAALPQPEEAEETWDSK	270	tr|D3ZU13|D3ZU13_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:730,42-UNIMOD:730	ms_run[1]:scan=1.1.2191.3	49.60823	6	5038.3002	5038.3932	K	E	538	580
PSM	VPEAQTGQASDYGLFLSDEDPR	271	tr|D3ZA84|D3ZA84_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	20	1-UNIMOD:730	ms_run[1]:scan=1.1.2176.3	48.5683	3	2698.229471	2698.302909	R	K	38	60
PSM	GAGTLGGPSTDPLAGLVLSDNDR	272	sp|P0C865|MK07_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	20	1-UNIMOD:730	ms_run[1]:scan=1.1.2288.3	57.92308	3	2486.224271	2486.291950	R	S	544	567
PSM	YPPPTELLDLQPLPVSALR	273	sp|F1LNJ2|U520_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	19	1-UNIMOD:730	ms_run[1]:scan=1.1.2429.2	72.38247	3	2422.289171	2422.377852	K	N	1298	1317
PSM	QTQTFTTYSDNQPGVLIQVYEGER	274	tr|F1LZI1|F1LZI1_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:28	ms_run[1]:scan=1.1.2255.4	55.06238	3	3060.4072	3060.4982	K	A	424	448
PSM	IPSAVGYQPTLATDMGTMQER	275	sp|P10719|ATPB_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	19	1-UNIMOD:730,15-UNIMOD:35,18-UNIMOD:35	ms_run[1]:scan=1.1.2004.2	36.77642	3	2601.195371	2601.272144	R	I	325	346
PSM	DLYANTVLSGGTTMYPGIADR	276	sp|P60711|ACTB_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	19	1-UNIMOD:730,14-UNIMOD:35	ms_run[1]:scan=1.1.2131.3	45.1141	3	2535.161171	2534.262959	K	M	292	313
PSM	DLYANTVLSGGTTMYPGIADR	277	sp|P60711|ACTB_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	19	1-UNIMOD:730,14-UNIMOD:35	ms_run[1]:scan=1.1.2212.4	51.2861	3	2536.199471	2534.262959	K	M	292	313
PSM	MLLDPMGGIVMTNDGNAILR	278	sp|Q6P502|TCPG_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	19	1-UNIMOD:730,6-UNIMOD:35	ms_run[1]:scan=1.1.2338.4	62.63385	3	2451.183971	2450.263827	K	E	49	69
PSM	LCNAPQPPSQPLPGTAEEESR	279	tr|A0A0G2K2Z0|A0A0G2K2Z0_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	19	1-UNIMOD:730,2-UNIMOD:39	ms_run[1]:scan=1.1.2068.3	40.45713	3	2570.157371	2570.241177	R	V	840	861
PSM	CPQLPQEQQQQLNGLIGPELR	280	tr|D3ZWS6|D3ZWS6_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	19	1-UNIMOD:730,1-UNIMOD:39	ms_run[1]:scan=1.1.2260.4	55.53668	3	2739.300071	2738.415059	R	H	72	93
PSM	VPDYPGDDGSVFVRPSTEL	281	sp|Q63921|PGH1_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	19	1-UNIMOD:730	ms_run[1]:scan=1.1.2210.2	51.11438	3	2353.122371	2353.174461	R	-	584	603
PSM	LPSIVVEPTEGEVESGELR	282	tr|A0A0G2KAD4|A0A0G2KAD4_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:730	ms_run[1]:scan=1.1.2227.3	52.61307	3	2344.1522	2343.2472	R	W	60	79
PSM	GIVNGAAPELPVPTGGPMAGAR	283	sp|P62815|VATB2_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:730,18-UNIMOD:35	ms_run[1]:scan=1.1.2101.4	42.763	3	2352.163571	2351.257420	R	E	8	30
PSM	MPPYDEETQAIIDAAQEAR	284	tr|B1WC34|B1WC34_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:730,1-UNIMOD:35	ms_run[1]:scan=1.1.2229.4	52.80155	3	2467.131671	2467.184374	K	N	353	372
PSM	EQSLLQPPTLQLLNGMGPLGR	285	tr|M0RD40|M0RD40_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:730	ms_run[1]:scan=1.1.2421.4	71.57243	3	2566.311671	2565.425547	K	R	470	491
PSM	LQMSVPGILNPHEIPEEMCD	286	sp|Q80U96|XPO1_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:730,19-UNIMOD:39	ms_run[1]:scan=1.1.2432.3	72.727	3	2601.127871	2601.225393	K	-	1052	1072
PSM	AVGPEPEMEELVTIEPVCVR	287	tr|Q3ZAU5|Q3ZAU5_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:730,18-UNIMOD:39	ms_run[1]:scan=1.1.2408.4	70.18069	3	2546.171771	2546.273723	R	G	224	244
PSM	ASPATQPPPLLPPSNPGPDATVVGSAPTPLLPPSATAAAK	288	sp|Q91V33|KHDR1_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:730,40-UNIMOD:730	ms_run[1]:scan=1.1.2294.2	58.30893	5	4361.322118	4361.409612	R	M	57	97
PSM	EVSTPQELEALITDPDEMR	289	sp|Q4V890|FEM1A_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:730	ms_run[1]:scan=1.1.2368.4	65.78912	3	2477.270771	2476.230990	R	M	338	357
PSM	ELQSQISDTSVVLSMDNSR	290	sp|Q10758|K2C8_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:730,15-UNIMOD:35	ms_run[1]:scan=1.1.2084.4	41.50302	3	2429.118971	2428.205838	R	S	234	253
PSM	ASPATQPPPLLPPSNPGPDATVVGSAPTPLLPPSATAAAK	291	sp|Q91V33|KHDR1_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:730,40-UNIMOD:730	ms_run[1]:scan=1.1.2290.4	58.08385	6	4361.328141	4361.409612	R	M	57	97
PSM	LVPLLDTGDIIIDGGNSEYR	292	sp|P85968|6PGD_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:730	ms_run[1]:scan=1.1.2489.2	77.41068	3	2464.200371	2463.316374	K	D	88	108
PSM	GIVNGAAPELPVPTGGPMAGAR	293	sp|P62815|VATB2_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	17	1-UNIMOD:730,18-UNIMOD:35	ms_run[1]:scan=1.1.2168.2	48.08833	3	2353.181771	2351.257420	R	E	8	30
PSM	IYPEEMIQTGISAIDGMNSIAR	294	sp|P62815|VATB2_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	17	1-UNIMOD:730,17-UNIMOD:35	ms_run[1]:scan=1.1.2465.3	76.14542	3	2729.281871	2728.371857	R	G	164	186
PSM	LQPQITMIPPSAQPPR	295	tr|F1LN59|F1LN59_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	17	1-UNIMOD:730	ms_run[1]:scan=1.1.2109.2	43.38803	3	2077.107371	2077.166085	K	T	489	505
PSM	TVTNAVVTVPAYFNDSQR	296	tr|F1LZI1|F1LZI1_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	17	1-UNIMOD:730	ms_run[1]:scan=1.1.2167.2	48.0008	3	2286.095771	2285.195865	K	Q	138	156
PSM	TVTNAVVTVPAYFNDSQR	297	tr|F1LZI1|F1LZI1_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	17	1-UNIMOD:730	ms_run[1]:scan=1.1.2137.4	45.6309	4	2286.138894	2285.195865	K	Q	138	156
PSM	IPSAVGYQPTLATDMGTMQER	298	sp|P10719|ATPB_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	17	1-UNIMOD:730,15-UNIMOD:35	ms_run[1]:scan=1.1.2071.2	40.62589	3	2585.191271	2585.277229	R	I	325	346
PSM	DLSAAGIGLLAAATQSLSMPASLGR	299	sp|P43244|MATR3_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	17	1-UNIMOD:730,19-UNIMOD:35	ms_run[1]:scan=1.1.2733.2	83.28975	4	2690.420494	2690.457970	R	M	20	45
PSM	ASDPPLAPDDDPDAPAAQLAR	300	sp|Q9QXU9|PCS1N_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	17	1-UNIMOD:730	ms_run[1]:scan=1.1.1949.3	33.20122	4	2406.144894	2406.196987	R	A	118	139
PSM	TVTNAVVTVPAYFNDSQR	301	tr|F1LZI1|F1LZI1_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	17	1-UNIMOD:730	ms_run[1]:scan=1.1.2203.3	50.50286	3	2287.103471	2285.195865	K	Q	138	156
PSM	SPFEIISPPASPPEMTGQR	302	sp|P34926|MAP1A_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	17	1-UNIMOD:730	ms_run[1]:scan=1.1.2227.3	52.61307	3	2344.152371	2344.203987	R	V	1757	1776
PSM	AIAELGIYPAVDPLDSTSR	303	sp|P10719|ATPB_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	17	1-UNIMOD:730	ms_run[1]:scan=1.1.2366.3	65.52586	3	2290.141271	2291.231582	R	I	388	407
PSM	LSLSNAISTVLPLTQLR	304	sp|P38650|DYHC1_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	17	1-UNIMOD:730	ms_run[1]:scan=1.1.2452.3	74.93207	3	2130.185171	2129.272659	K	W	4573	4590
PSM	GIVNGAAPELPVPTGGPMAGAR	305	sp|P62815|VATB2_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:730,18-UNIMOD:35	ms_run[1]:scan=1.1.2081.2	41.25846	3	2352.166871	2351.257420	R	E	8	30
PSM	LAPPLVTLLSGEPEVQYVALR	306	sp|P62944|AP2B1_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:730	ms_run[1]:scan=1.1.2716.2	82.92858	4	2568.408494	2568.483380	K	N	284	305
PSM	LAPPLVTLLSGEPEVQYVALR	307	sp|P62944|AP2B1_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:730	ms_run[1]:scan=1.1.2726.2	83.19273	4	2568.408494	2568.483380	K	N	284	305
PSM	GAIVPAQEVPPPTVPMDYSWAR	308	sp|P16638|ACLY_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:730,16-UNIMOD:35	ms_run[1]:scan=1.1.2198.2	50.06775	3	2700.306371	2700.388828	K	E	807	829
PSM	SSLESIPLALLPAAAAGASTGEDTAGAGPR	309	sp|O54924|EXOC8_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:730	ms_run[1]:scan=1.1.2403.4	69.66385	4	3054.556494	3054.614013	K	E	92	122
PSM	VTAPQPAATNGDLASR	310	sp|Q64566|AT2C1_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:730	ms_run[1]:scan=1.1.1770.4	21.46687	3	1872.951071	1872.000794	K	S	198	214
PSM	SPAASGAPQAPAPAALLAGSPGGDAAPGPAPASSAPAGSEDAEK	311	sp|Q62764|YBOX3_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:730,44-UNIMOD:730	ms_run[1]:scan=1.1.2091.4	42.0094	6	4400.158341	4400.234561	K	K	33	77
PSM	SPAASGAPQAPAPAALLAGSPGGDAAPGPAPASSAPAGSEDAEK	312	sp|Q62764|YBOX3_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:730,44-UNIMOD:730	ms_run[1]:scan=1.1.2092.4	42.0705	6	4400.158341	4400.234561	K	K	33	77
PSM	ELQSQISDTSVVLSMDNSR	313	sp|Q10758|K2C8_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:730	ms_run[1]:scan=1.1.2186.4	49.26965	3	2413.137371	2412.210923	R	S	234	253
PSM	ASPATQPPPLLPPSNPGPDATVVGSAPTPLLPPSATAAAK	314	sp|Q91V33|KHDR1_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:730,40-UNIMOD:730	ms_run[1]:scan=1.1.2300.3	58.84935	5	4361.322118	4361.409612	R	M	57	97
PSM	EAVPVPVQEVEIDATTALSGPR	315	tr|A0A0G2K226|A0A0G2K226_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1001476, X!Tandem, ]	15	1-UNIMOD:730	ms_run[1]:scan=1.1.2387.2	67.8059	4	2581.3312	2581.3902	K	E	118	140
PSM	YPPPTELLDLQPLPVSALR	316	sp|F1LNJ2|U520_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	15	1-UNIMOD:730	ms_run[1]:scan=1.1.2439.2	73.45419	3	2422.289171	2422.377852	K	N	1298	1317
PSM	TVTNAVVTVPAYFNDSQR	317	tr|F1LZI1|F1LZI1_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	15	1-UNIMOD:730	ms_run[1]:scan=1.1.2137.2	45.57003	4	2286.138894	2285.195865	K	Q	138	156
PSM	EPPTDVTPTFLTTGVLSTLR	318	sp|Q4V7C6|GUAA_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1001476, X!Tandem, ]	15	1-UNIMOD:730	ms_run[1]:scan=1.1.2405.3	69.81181	4	2448.2602	2448.3412	K	Q	570	590
PSM	ILATPPQEDAPSVDIANIR	319	sp|P50137|TKT_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1001476, X!Tandem, ]	15	1-UNIMOD:730	ms_run[1]:scan=1.1.2217.3	51.76097	3	2324.1772	2323.2682	K	M	284	303
PSM	VPPAVIIPPAAPLSGR	320	sp|Q9JIH7|WNK1_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	15	1-UNIMOD:730	ms_run[1]:scan=1.1.2205.4	50.72903	3	1858.076171	1858.134709	K	R	1852	1868
PSM	LQMSVPGILNPHEIPEEMCD	321	sp|Q80U96|XPO1_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	15	1-UNIMOD:730,18-UNIMOD:35,19-UNIMOD:39	ms_run[1]:scan=1.1.2354.4	64.2515	3	2617.165871	2617.220308	K	-	1052	1072
PSM	LAAFYGV	322	tr|F1LQP9|F1LQP9_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	15	1-UNIMOD:730	ms_run[1]:scan=1.1.2354.3	64.2169	2	1043.558247	1043.595837	R	-	884	891
PSM	VLSLYMDCNLIASRHTEER	323	tr|D3ZCQ0|D3ZCQ0_RAT	1	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	15	1-UNIMOD:730,6-UNIMOD:35,8-UNIMOD:39	ms_run[1]:scan=1.1.2232.2	52.97653	3	2617.227971	2615.281268	R	D	179	198
PSM	VIESTQDLGNDLAGVMALQR	324	tr|A0A0G2K8W9|A0A0G2K8W9_RAT	0	userFasta.uniprot_rat_20200406	userFasta.uniprot_rat_20200406	[MS, MS:1002251, Comet, ]	15	1-UNIMOD:730	ms_run[1]:scan=1.1.2312.4	60.14182	3	2435.179571	2433.284028	K	K	977	997