MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	120124ry_414C2-43_JPST000083
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20191004\20191004085747383040^10.242.103.245^taba@jp\Psearch.ProteinPilotExecV5\120212ry_414C2-43_3_1.pilotFin.txt
MTD	software[1]	[MS, MS:1000663, ProteinPilot, 5.0.0.0, 4767]
MTD	software[1]-setting	FASTA=sprot_human_20181121.fasta
MTD	software[1]-setting	PARAGON_VERSION=5.0.0.0, 4767
MTD	software[1]-setting	UI_SAMPLE_TYPE=Identification
MTD	software[1]-setting	UI_CYS_ALKYLATION=Iodoacetamide
MTD	software[1]-setting	UI_DIGESTION=Trypsin + Lys C
MTD	software[1]-setting	UI_INSTRUMENT=TripleTOF 5600
MTD	software[1]-setting	UI_SEARCH_EFFORT=Thorough
MTD	software[1]-setting	UI_ID_FOCUS=Biological modifications
MTD	software[1]-setting	UI_MIN_UNUSED_PROTSCORE=0.0458
MTD	software[1]-setting	MSTOLERANCE=0.05
MTD	software[1]-setting	MSTOLERANCE_U=Daltons
MTD	software[1]-setting	MSMSTOLERANCE=0.1
MTD	software[1]-setting	MSMSTOLERANCE_U=Daltons
MTD	software[2]	[MS, MS:1001207, Mascot, 2.6.1]
MTD	software[2]-setting	DB=sprot_human_mix
MTD	software[2]-setting	DTAXONOMYB=All entries
MTD	software[2]-setting	CLE=Trypsin+Lys-C
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M)
MTD	software[2]-setting	CHARGE=2+ and 3+
MTD	software[2]-setting	TOL=20
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=0.1
MTD	software[2]-setting	ITOLU=Da
MTD	software[2]-setting	PEP_ISOTOPE_ERRORLE=0
MTD	software[2]-setting	PFA=1
MTD	software[2]-setting	MASS=Monoisotopic
MTD	software[2]-setting	INSTRUMENT=ESI-QUAD-TOF
MTD	software[3]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[3]-setting	DB=userFasta.sprot_human_mix_20181121
MTD	software[3]-setting	CLE=[R]|{P},[K]|{}
MTD	software[3]-setting	MODS=Carbamidomethyl (C)
MTD	software[3]-setting	IT_MODS=Oxidation (M)
MTD	software[3]-setting	TOL(-)=20
MTD	software[3]-setting	TOL(+)=20
MTD	software[3]-setting	TOLU=ppm
MTD	software[3]-setting	ITOL=0.1
MTD	software[3]-setting	ITOLU=Daltons
MTD	software[3]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[3]-setting	PFA=1
MTD	software[4]	[MS, MS:1002251, Comet, 2015.02 rev. 0]
MTD	software[4]-setting	Taxon=userFasta.sprot_human_mix_20181121
MTD	software[4]-setting	search_enzyme_number=2
MTD	software[4]-setting	FixMod=Carbamidomethyl (C)
MTD	software[4]-setting	VarMod=Oxidation (M)
MTD	software[4]-setting	max_variable_mods_in_peptide=5
MTD	software[4]-setting	allowed_missed_cleavage=1
MTD	software[4]-setting	peptide_mass_tolerance=20
MTD	software[4]-setting	peptide_mass_units=2
MTD	software[4]-setting	fragment_bin_tol=0.02
MTD	software[4]-setting	fragment_bin_offset=0.0
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[1]-site	M
MTD	variable_mod[1]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|Q92945|FUBP2_HUMAN	Far upstream element-binding protein 2 OS=Homo sapiens OX=9606 GN=KHSRP PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	53.0	null		0.13	53.0	15	7	3
PRT	sp|P35637-2|FUS_HUMAN	Isoform Short of RNA-binding protein FUS OS=Homo sapiens OX=9606 GN=FUS	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	51.0	null		0.05	51.0	3	1	0
PRT	sp|P51991|ROA3_HUMAN	Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens OX=9606 GN=HNRNPA3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1001476, X!Tandem, ]	51.0	null	196-UNIMOD:4,1-UNIMOD:1,158-UNIMOD:35	0.27	51.0	17	7	3
PRT	sp|P14866|HNRPL_HUMAN	Heterogeneous nuclear ribonucleoprotein L OS=Homo sapiens OX=9606 GN=HNRNPL PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	48.0	null		0.08	48.0	13	3	1
PRT	sp|P29692-2|EF1D_HUMAN	Isoform 2 of Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	48.0	null		0.08	48.0	6	3	1
PRT	sp|P67809|YBOX1_HUMAN	Nuclease-sensitive element-binding protein 1 OS=Homo sapiens OX=9606 GN=YBX1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	46.0	null		0.25	46.0	14	4	1
PRT	sp|P21333-2|FLNA_HUMAN	Isoform 2 of Filamin-A OS=Homo sapiens OX=9606 GN=FLNA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	45.0	null	2535-UNIMOD:4,623-UNIMOD:4,631-UNIMOD:4,1018-UNIMOD:4,1157-UNIMOD:4,2574-UNIMOD:4	0.10	45.0	37	20	9
PRT	sp|P80723|BASP1_HUMAN	Brain acid soluble protein 1 OS=Homo sapiens OX=9606 GN=BASP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ],[MS, MS:1000663, ProteinPilot, ]	45.0	null		0.52	45.0	22	7	3
PRT	sp|P29692|EF1D_HUMAN	Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D PE=1 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	45.0	null		0.13	45.0	2	2	0
PRT	sp|Q15102|PA1B3_HUMAN	Platelet-activating factor acetylhydrolase IB subunit gamma OS=Homo sapiens OX=9606 GN=PAFAH1B3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001207, Mascot, ]	45.0	null	2-UNIMOD:1,205-UNIMOD:4	0.19	45.0	7	3	0
PRT	sp|O43670-2|ZN207_HUMAN	Isoform 2 of BUB3-interacting and GLEBS motif-containing protein ZNF207 OS=Homo sapiens OX=9606 GN=ZNF207	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	44.0	null		0.05	44.0	3	2	1
PRT	sp|P11387|TOP1_HUMAN	DNA topoisomerase 1 OS=Homo sapiens OX=9606 GN=TOP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	44.0	null	504-UNIMOD:4,505-UNIMOD:4,630-UNIMOD:4	0.07	44.0	7	5	4
PRT	sp|P29966|MARCS_HUMAN	Myristoylated alanine-rich C-kinase substrate OS=Homo sapiens OX=9606 GN=MARCKS PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	43.0	null		0.42	43.0	24	9	3
PRT	sp|P54727|RD23B_HUMAN	UV excision repair protein RAD23 homolog B OS=Homo sapiens OX=9606 GN=RAD23B PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	43.0	null		0.11	43.0	7	4	2
PRT	sp|P18124|RL7_HUMAN	60S ribosomal protein L7 OS=Homo sapiens OX=9606 GN=RPL7 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	43.0	null		0.13	43.0	12	2	0
PRT	sp|Q9H3P7|GCP60_HUMAN	Golgi resident protein GCP60 OS=Homo sapiens OX=9606 GN=ACBD3 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	43.0	null		0.05	43.0	1	1	1
PRT	sp|P17096|HMGA1_HUMAN	High mobility group protein HMG-I/HMG-Y OS=Homo sapiens OX=9606 GN=HMGA1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	43.0	null		0.24	43.0	29	2	0
PRT	sp|P82979|SARNP_HUMAN	SAP domain-containing ribonucleoprotein OS=Homo sapiens OX=9606 GN=SARNP PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1001476, X!Tandem, ]	43.0	null	2-UNIMOD:1	0.22	43.0	5	3	1
PRT	sp|Q13263-2|TIF1B_HUMAN	Isoform 2 of Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	43.0	null		0.04	43.0	6	2	1
PRT	sp|P09651-2|ROA1_HUMAN	Isoform A1-A of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	42.0	null	175-UNIMOD:4	0.22	42.0	14	5	0
PRT	sp|P35527|K1C9_HUMAN	Keratin, type I cytoskeletal 9 OS=Homo sapiens OX=9606 GN=KRT9 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	42.0	null		0.09	42.0	3	3	3
PRT	sp|Q14697|GANAB_HUMAN	Neutral alpha-glucosidase AB OS=Homo sapiens OX=9606 GN=GANAB PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	42.0	null	41-UNIMOD:4,47-UNIMOD:4	0.07	42.0	8	6	4
PRT	sp|P52926|HMGA2_HUMAN	High mobility group protein HMGI-C OS=Homo sapiens OX=9606 GN=HMGA2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	42.0	null		0.30	42.0	7	2	0
PRT	sp|P49321|NASP_HUMAN	Nuclear autoantigenic sperm protein OS=Homo sapiens OX=9606 GN=NASP PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	42.0	null	254-UNIMOD:4	0.15	42.0	25	12	6
PRT	sp|P08621|RU17_HUMAN	U1 small nuclear ribonucleoprotein 70 kDa OS=Homo sapiens OX=9606 GN=SNRNP70 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	42.0	null		0.16	42.0	9	5	4
PRT	sp|Q9NWV8|BABA1_HUMAN	BRISC and BRCA1-A complex member 1 OS=Homo sapiens OX=9606 GN=BABAM1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	41.0	null		0.07	41.0	1	1	1
PRT	sp|Q6DKJ4|NXN_HUMAN	Nucleoredoxin OS=Homo sapiens OX=9606 GN=NXN PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	41.0	null		0.06	41.0	1	1	1
PRT	sp|P05114|HMGN1_HUMAN	Non-histone chromosomal protein HMG-14 OS=Homo sapiens OX=9606 GN=HMGN1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	41.0	null		0.35	41.0	8	3	1
PRT	sp|Q01650|LAT1_HUMAN	Large neutral amino acids transporter small subunit 1 OS=Homo sapiens OX=9606 GN=SLC7A5 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	41.0	null		0.07	41.0	5	3	2
PRT	sp|Q12906-7|ILF3_HUMAN	Isoform 7 of Interleukin enhancer-binding factor 3 OS=Homo sapiens OX=9606 GN=ILF3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	41.0	null		0.17	41.0	38	11	4
PRT	sp|P00390-3|GSHR_HUMAN	Isoform 2 of Glutathione reductase, mitochondrial OS=Homo sapiens OX=9606 GN=GSR	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	41.0	null		0.04	41.0	3	1	0
PRT	sp|P40222|TXLNA_HUMAN	Alpha-taxilin OS=Homo sapiens OX=9606 GN=TXLNA PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	41.0	null		0.08	41.0	3	3	3
PRT	sp|P31943|HNRH1_HUMAN	Heterogeneous nuclear ribonucleoprotein H OS=Homo sapiens OX=9606 GN=HNRNPH1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	40.0	null	290-UNIMOD:4	0.11	40.0	18	3	1
PRT	sp|P09429|HMGB1_HUMAN	High mobility group protein B1 OS=Homo sapiens OX=9606 GN=HMGB1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	40.0	null		0.16	40.0	5	3	2
PRT	sp|P18754-2|RCC1_HUMAN	Isoform 2 of Regulator of chromosome condensation OS=Homo sapiens OX=9606 GN=RCC1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	40.0	null		0.10	40.0	3	3	3
PRT	sp|Q9UKV3-5|ACINU_HUMAN	Isoform 4 of Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens OX=9606 GN=ACIN1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	40.0	null	733-UNIMOD:4	0.06	40.0	5	5	5
PRT	sp|Q13200|PSMD2_HUMAN	26S proteasome non-ATPase regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PSMD2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	39.0	null		0.10	39.0	9	7	5
PRT	sp|O00584|RNT2_HUMAN	Ribonuclease T2 OS=Homo sapiens OX=9606 GN=RNASET2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39.0	null	121-UNIMOD:4	0.06	39.0	2	1	0
PRT	sp|P0DN79|CBSL_HUMAN	Cystathionine beta-synthase-like protein OS=Homo sapiens OX=9606 GN=CBSL PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39.0	null	15-UNIMOD:4	0.03	39.0	3	1	0
PRT	sp|Q9H0S4-2|DDX47_HUMAN	Isoform 2 of Probable ATP-dependent RNA helicase DDX47 OS=Homo sapiens OX=9606 GN=DDX47	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39.0	null		0.08	39.0	3	3	3
PRT	sp|P62888|RL30_HUMAN	60S ribosomal protein L30 OS=Homo sapiens OX=9606 GN=RPL30 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	39.0	null	85-UNIMOD:4	0.25	39.0	13	2	1
PRT	sp|Q14684|RRP1B_HUMAN	Ribosomal RNA processing protein 1 homolog B OS=Homo sapiens OX=9606 GN=RRP1B PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39.0	null		0.09	39.0	5	4	3
PRT	sp|Q9NP81|SYSM_HUMAN	Serine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=SARS2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39.0	null		0.07	39.0	2	2	2
PRT	sp|P14868|SYDC_HUMAN	Aspartate--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=DARS PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39.0	null	130-UNIMOD:4	0.12	39.0	6	5	4
PRT	sp|Q9Y5S9|RBM8A_HUMAN	RNA-binding protein 8A OS=Homo sapiens OX=9606 GN=RBM8A PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39.0	null		0.11	39.0	3	1	0
PRT	sp|Q14671-2|PUM1_HUMAN	Isoform 2 of Pumilio homolog 1 OS=Homo sapiens OX=9606 GN=PUM1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38.0	null		0.04	38.0	3	3	3
PRT	sp|Q09028-2|RBBP4_HUMAN	Isoform 2 of Histone-binding protein RBBP4 OS=Homo sapiens OX=9606 GN=RBBP4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38.0	null	166-UNIMOD:4	0.04	38.0	1	1	0
PRT	sp|P34932|HSP74_HUMAN	Heat shock 70 kDa protein 4 OS=Homo sapiens OX=9606 GN=HSPA4 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38.0	null	779-UNIMOD:4	0.08	38.0	6	4	3
PRT	sp|P52597|HNRPF_HUMAN	Heterogeneous nuclear ribonucleoprotein F OS=Homo sapiens OX=9606 GN=HNRNPF PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38.0	null		0.06	38.0	5	2	1
PRT	sp|P13804|ETFA_HUMAN	Electron transfer flavoprotein subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=ETFA PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38.0	null		0.09	38.0	3	2	1
PRT	sp|P04264|K2C1_HUMAN	Keratin, type II cytoskeletal 1 OS=Homo sapiens OX=9606 GN=KRT1 PE=1 SV=6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38.0	null		0.12	38.0	6	5	4
PRT	sp|P32322-3|P5CR1_HUMAN	Isoform 3 of Pyrroline-5-carboxylate reductase 1, mitochondrial OS=Homo sapiens OX=9606 GN=PYCR1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38.0	null		0.11	38.0	4	3	2
PRT	sp|Q9UGP8|SEC63_HUMAN	Translocation protein SEC63 homolog OS=Homo sapiens OX=9606 GN=SEC63 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38.0	null	490-UNIMOD:4	0.05	38.0	2	2	2
PRT	sp|P39748|FEN1_HUMAN	Flap endonuclease 1 OS=Homo sapiens OX=9606 GN=FEN1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38.0	null		0.04	38.0	2	1	0
PRT	sp|P45880-1|VDAC2_HUMAN	Isoform 1 of Voltage-dependent anion-selective channel protein 2 OS=Homo sapiens OX=9606 GN=VDAC2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38.0	null	62-UNIMOD:4	0.06	38.0	2	1	0
PRT	sp|Q969G3-2|SMCE1_HUMAN	Isoform 2 of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 OS=Homo sapiens OX=9606 GN=SMARCE1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38.0	null		0.12	38.0	5	3	1
PRT	sp|Q8WVM8|SCFD1_HUMAN	Sec1 family domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SCFD1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38.0	null		0.03	38.0	1	1	1
PRT	sp|Q13283|G3BP1_HUMAN	Ras GTPase-activating protein-binding protein 1 OS=Homo sapiens OX=9606 GN=G3BP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	38.0	null	73-UNIMOD:4	0.12	38.0	6	5	4
PRT	sp|Q9UQ80|PA2G4_HUMAN	Proliferation-associated protein 2G4 OS=Homo sapiens OX=9606 GN=PA2G4 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38.0	null	149-UNIMOD:4	0.23	38.0	14	7	2
PRT	sp|Q7Z3K3-2|POGZ_HUMAN	Isoform 2 of Pogo transposable element with ZNF domain OS=Homo sapiens OX=9606 GN=POGZ	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38.0	null		0.03	38.0	3	3	3
PRT	sp|Q7KZF4|SND1_HUMAN	Staphylococcal nuclease domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SND1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	38.0	null		0.06	38.0	8	4	3
PRT	sp|Q8NC51-3|PAIRB_HUMAN	Isoform 3 of Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38.0	null		0.27	38.0	18	8	3
PRT	sp|Q96SQ9|CP2S1_HUMAN	Cytochrome P450 2S1 OS=Homo sapiens OX=9606 GN=CYP2S1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	38.0	null	251-UNIMOD:28	0.03	38.0	2	1	0
PRT	sp|P06748|NPM_HUMAN	Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	37.0	null		0.22	37.0	17	4	2
PRT	sp|Q92925-2|SMRD2_HUMAN	Isoform 2 of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2 OS=Homo sapiens OX=9606 GN=SMARCD2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37.0	null		0.04	37.0	1	1	1
PRT	sp|Q8IWS0-3|PHF6_HUMAN	Isoform 3 of PHD finger protein 6 OS=Homo sapiens OX=9606 GN=PHF6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37.0	null	211-UNIMOD:4,214-UNIMOD:4,304-UNIMOD:4	0.12	37.0	5	3	1
PRT	sp|P50851|LRBA_HUMAN	Lipopolysaccharide-responsive and beige-like anchor protein OS=Homo sapiens OX=9606 GN=LRBA PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37.0	null	1228-UNIMOD:4,2675-UNIMOD:4,343-UNIMOD:4	0.03	37.0	5	5	5
PRT	sp|Q9H1E3-2|NUCKS_HUMAN	Isoform 2 of Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 OS=Homo sapiens OX=9606 GN=NUCKS1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37.0	null		0.09	37.0	3	1	0
PRT	sp|Q8NBS9|TXND5_HUMAN	Thioredoxin domain-containing protein 5 OS=Homo sapiens OX=9606 GN=TXNDC5 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37.0	null	121-UNIMOD:4,128-UNIMOD:4,247-UNIMOD:4,254-UNIMOD:4,381-UNIMOD:4	0.13	37.0	5	4	3
PRT	sp|Q9H9Z2|LN28A_HUMAN	Protein lin-28 homolog A OS=Homo sapiens OX=9606 GN=LIN28A PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1001476, X!Tandem, ]	37.0	null	2-UNIMOD:1,13-UNIMOD:4,139-UNIMOD:385,139-UNIMOD:4,142-UNIMOD:4	0.28	37.0	11	4	0
PRT	sp|P18206|VINC_HUMAN	Vinculin OS=Homo sapiens OX=9606 GN=VCL PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	37.0	null	179-UNIMOD:28,422-UNIMOD:4,1018-UNIMOD:4	0.08	37.0	15	9	5
PRT	sp|P27348|1433T_HUMAN	14-3-3 protein theta OS=Homo sapiens OX=9606 GN=YWHAQ PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37.0	null	134-UNIMOD:4,25-UNIMOD:4	0.15	37.0	10	4	1
PRT	sp|Q9UKY7-2|CDV3_HUMAN	Isoform 2 of Protein CDV3 homolog OS=Homo sapiens OX=9606 GN=CDV3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37.0	null		0.46	37.0	4	4	4
PRT	sp|Q9NX24|NHP2_HUMAN	H/ACA ribonucleoprotein complex subunit 2 OS=Homo sapiens OX=9606 GN=NHP2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37.0	null	18-UNIMOD:4	0.13	37.0	1	1	1
PRT	sp|P30050-2|RL12_HUMAN	Isoform 2 of 60S ribosomal protein L12 OS=Homo sapiens OX=9606 GN=RPL12	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37.0	null	17-UNIMOD:4	0.12	37.0	8	1	0
PRT	sp|Q14980-2|NUMA1_HUMAN	Isoform 2 of Nuclear mitotic apparatus protein 1 OS=Homo sapiens OX=9606 GN=NUMA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37.0	null	1367-UNIMOD:4,658-UNIMOD:4,80-UNIMOD:4	0.11	37.0	29	19	14
PRT	sp|P27816-6|MAP4_HUMAN	Isoform 6 of Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37.0	null		0.06	37.0	6	5	4
PRT	sp|Q9NVA2-2|SEP11_HUMAN	Isoform 2 of Septin-11 OS=Homo sapiens OX=9606 GN=SEPT11	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37.0	null		0.10	37.0	3	3	3
PRT	sp|Q5T4S7-2|UBR4_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37.0	null	122-UNIMOD:4,104-UNIMOD:4,4946-UNIMOD:4	0.03	37.0	9	8	7
PRT	sp|P09874|PARP1_HUMAN	Poly [ADP-ribose] polymerase 1 OS=Homo sapiens OX=9606 GN=PARP1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37.0	null	429-UNIMOD:4	0.08	37.0	14	6	2
PRT	sp|P78527|PRKDC_HUMAN	DNA-dependent protein kinase catalytic subunit OS=Homo sapiens OX=9606 GN=PRKDC PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	37.0	null	25-UNIMOD:4,974-UNIMOD:4,1455-UNIMOD:4,1312-UNIMOD:4,111-UNIMOD:4	0.04	37.0	32	17	9
PRT	sp|Q8WW12|PCNP_HUMAN	PEST proteolytic signal-containing nuclear protein OS=Homo sapiens OX=9606 GN=PCNP PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36.0	null		0.17	36.0	2	2	2
PRT	sp|Q7Z6Z7-2|HUWE1_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens OX=9606 GN=HUWE1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36.0	null	3243-UNIMOD:4,1401-UNIMOD:4,467-UNIMOD:4,1832-UNIMOD:4	0.04	36.0	15	12	9
PRT	sp|Q16576-2|RBBP7_HUMAN	Isoform 2 of Histone-binding protein RBBP7 OS=Homo sapiens OX=9606 GN=RBBP7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36.0	null	210-UNIMOD:4	0.06	36.0	3	2	1
PRT	sp|Q9NZI8|IF2B1_HUMAN	Insulin-like growth factor 2 mRNA-binding protein 1 OS=Homo sapiens OX=9606 GN=IGF2BP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	36.0	null	253-UNIMOD:4,257-UNIMOD:4	0.13	36.0	14	6	2
PRT	sp|O95671-2|ASML_HUMAN	Isoform 2 of N-acetylserotonin O-methyltransferase-like protein OS=Homo sapiens OX=9606 GN=ASMTL	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36.0	null	258-UNIMOD:4	0.07	36.0	3	3	3
PRT	sp|P49006|MRP_HUMAN	MARCKS-related protein OS=Homo sapiens OX=9606 GN=MARCKSL1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36.0	null		0.08	36.0	5	1	0
PRT	sp|P15531-2|NDKA_HUMAN	Isoform 2 of Nucleoside diphosphate kinase A OS=Homo sapiens OX=9606 GN=NME1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36.0	null	115-UNIMOD:35	0.19	36.0	5	2	1
PRT	sp|Q9UBC3-2|DNM3B_HUMAN	Isoform 2 of DNA (cytosine-5)-methyltransferase 3B OS=Homo sapiens OX=9606 GN=DNMT3B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36.0	null	373-UNIMOD:4,415-UNIMOD:4,418-UNIMOD:4	0.05	36.0	9	4	1
PRT	sp|P42704|LPPRC_HUMAN	Leucine-rich PPR motif-containing protein, mitochondrial OS=Homo sapiens OX=9606 GN=LRPPRC PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	36.0	null	930-UNIMOD:4	0.08	36.0	19	10	6
PRT	sp|P23246|SFPQ_HUMAN	Splicing factor, proline- and glutamine-rich OS=Homo sapiens OX=9606 GN=SFPQ PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	36.0	null		0.15	36.0	19	8	3
PRT	sp|P51858|HDGF_HUMAN	Hepatoma-derived growth factor OS=Homo sapiens OX=9606 GN=HDGF PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	36.0	null	108-UNIMOD:4	0.18	36.0	9	4	1
PRT	sp|Q16527|CSRP2_HUMAN	Cysteine and glycine-rich protein 2 OS=Homo sapiens OX=9606 GN=CSRP2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	36.0	null	25-UNIMOD:4,122-UNIMOD:4,122-UNIMOD:385	0.35	36.0	11	5	1
PRT	sp|P63104|1433Z_HUMAN	14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	36.0	null	25-UNIMOD:4	0.15	36.0	11	4	1
PRT	sp|P02649|APOE_HUMAN	Apolipoprotein E OS=Homo sapiens OX=9606 GN=APOE PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36.0	null		0.15	36.0	5	4	3
PRT	sp|P38646|GRP75_HUMAN	Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	36.0	null		0.10	36.0	22	7	3
PRT	sp|P14618-2|KPYM_HUMAN	Isoform M1 of Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36.0	null		0.07	36.0	12	4	1
PRT	sp|Q9C0C2|TB182_HUMAN	182 kDa tankyrase-1-binding protein OS=Homo sapiens OX=9606 GN=TNKS1BP1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36.0	null	1373-UNIMOD:4	0.05	36.0	6	6	6
PRT	sp|O00264-2|PGRC1_HUMAN	Isoform 2 of Membrane-associated progesterone receptor component 1 OS=Homo sapiens OX=9606 GN=PGRMC1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36.0	null		0.21	36.0	3	2	1
PRT	sp|P02768|ALBU_HUMAN	Serum albumin OS=Homo sapiens OX=9606 GN=ALB PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	36.0	null	269-UNIMOD:4,270-UNIMOD:4,277-UNIMOD:4,384-UNIMOD:4,385-UNIMOD:4,393-UNIMOD:4,118-UNIMOD:28,125-UNIMOD:4,384-UNIMOD:385,591-UNIMOD:4,192-UNIMOD:4,193-UNIMOD:4,289-UNIMOD:4,77-UNIMOD:4,86-UNIMOD:4,114-UNIMOD:4,115-UNIMOD:4,111-UNIMOD:35,500-UNIMOD:4,501-UNIMOD:4,302-UNIMOD:4,303-UNIMOD:4	0.25	36.0	74	14	2
PRT	sp|P09493-3|TPM1_HUMAN	Isoform 3 of Tropomyosin alpha-1 chain OS=Homo sapiens OX=9606 GN=TPM1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36.0	null		0.16	36.0	10	5	4
PRT	sp|P62910|RL32_HUMAN	60S ribosomal protein L32 OS=Homo sapiens OX=9606 GN=RPL32 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36.0	null	96-UNIMOD:4	0.10	36.0	3	1	0
PRT	sp|P17987|TCPA_HUMAN	T-complex protein 1 subunit alpha OS=Homo sapiens OX=9606 GN=TCP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36.0	null	147-UNIMOD:4	0.11	36.0	9	5	3
PRT	sp|Q6P158|DHX57_HUMAN	Putative ATP-dependent RNA helicase DHX57 OS=Homo sapiens OX=9606 GN=DHX57 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36.0	null	598-UNIMOD:4	0.03	36.0	2	2	2
PRT	sp|P35659|DEK_HUMAN	Protein DEK OS=Homo sapiens OX=9606 GN=DEK PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001207, Mascot, ]	36.0	null	2-UNIMOD:1	0.12	36.0	3	3	3
PRT	sp|P23381|SYWC_HUMAN	Tryptophan--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=WARS PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35.0	null		0.03	35.0	3	1	0
PRT	sp|Q08257|QOR_HUMAN	Quinone oxidoreductase OS=Homo sapiens OX=9606 GN=CRYZ PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35.0	null	145-UNIMOD:4	0.12	35.0	5	3	1
PRT	sp|Q9P2E9|RRBP1_HUMAN	Ribosome-binding protein 1 OS=Homo sapiens OX=9606 GN=RRBP1 PE=1 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35.0	null		0.10	35.0	14	11	8
PRT	sp|Q8IZL8|PELP1_HUMAN	Proline-, glutamic acid- and leucine-rich protein 1 OS=Homo sapiens OX=9606 GN=PELP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35.0	null	522-UNIMOD:4	0.02	35.0	3	1	0
PRT	sp|Q13618-2|CUL3_HUMAN	Isoform 2 of Cullin-3 OS=Homo sapiens OX=9606 GN=CUL3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35.0	null	438-UNIMOD:4,440-UNIMOD:4,612-UNIMOD:4	0.06	35.0	3	3	3
PRT	sp|P00367|DHE3_HUMAN	Glutamate dehydrogenase 1, mitochondrial OS=Homo sapiens OX=9606 GN=GLUD1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	35.0	null		0.03	35.0	2	1	0
PRT	sp|O95182|NDUA7_HUMAN	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 OS=Homo sapiens OX=9606 GN=NDUFA7 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35.0	null	55-UNIMOD:4	0.26	35.0	2	2	2
PRT	sp|Q02952-2|AKA12_HUMAN	Isoform 2 of A-kinase anchor protein 12 OS=Homo sapiens OX=9606 GN=AKAP12	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35.0	null		0.10	35.0	15	10	5
PRT	sp|Q2Q1W2|LIN41_HUMAN	E3 ubiquitin-protein ligase TRIM71 OS=Homo sapiens OX=9606 GN=TRIM71 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35.0	null	212-UNIMOD:4,215-UNIMOD:4,220-UNIMOD:4,223-UNIMOD:4	0.03	35.0	4	2	0
PRT	sp|Q9P258|RCC2_HUMAN	Protein RCC2 OS=Homo sapiens OX=9606 GN=RCC2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	35.0	null	337-UNIMOD:4	0.12	35.0	17	4	0
PRT	sp|P31939-2|PUR9_HUMAN	Isoform 2 of Bifunctional purine biosynthesis protein PURH OS=Homo sapiens OX=9606 GN=ATIC	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35.0	null	433-UNIMOD:4	0.12	35.0	10	5	2
PRT	sp|Q15007|FL2D_HUMAN	Pre-mRNA-splicing regulator WTAP OS=Homo sapiens OX=9606 GN=WTAP PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35.0	null		0.09	35.0	2	2	2
PRT	sp|Q9Y3C6|PPIL1_HUMAN	Peptidyl-prolyl cis-trans isomerase-like 1 OS=Homo sapiens OX=9606 GN=PPIL1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35.0	null		0.11	35.0	1	1	1
PRT	sp|Q9Y295|DRG1_HUMAN	Developmentally-regulated GTP-binding protein 1 OS=Homo sapiens OX=9606 GN=DRG1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35.0	null		0.07	35.0	3	2	1
PRT	sp|O00541-2|PESC_HUMAN	Isoform 2 of Pescadillo homolog OS=Homo sapiens OX=9606 GN=PES1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35.0	null		0.03	35.0	2	1	0
PRT	sp|P26641-2|EF1G_HUMAN	Isoform 2 of Elongation factor 1-gamma OS=Homo sapiens OX=9606 GN=EEF1G	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35.0	null		0.05	35.0	5	2	1
PRT	sp|O95747|OXSR1_HUMAN	Serine/threonine-protein kinase OSR1 OS=Homo sapiens OX=9606 GN=OXSR1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35.0	null		0.05	35.0	3	2	1
PRT	sp|P51610-2|HCFC1_HUMAN	Isoform 2 of Host cell factor 1 OS=Homo sapiens OX=9606 GN=HCFC1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35.0	null	326-UNIMOD:4,352-UNIMOD:4,353-UNIMOD:4	0.05	35.0	9	7	5
PRT	sp|O15143|ARC1B_HUMAN	Actin-related protein 2/3 complex subunit 1B OS=Homo sapiens OX=9606 GN=ARPC1B PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35.0	null		0.09	35.0	4	3	2
PRT	sp|O75475|PSIP1_HUMAN	PC4 and SFRS1-interacting protein OS=Homo sapiens OX=9606 GN=PSIP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001207, Mascot, ],[MS, MS:1001476, X!Tandem, ]	35.0	null	101-UNIMOD:28	0.18	35.0	16	7	4
PRT	sp|P16403|H12_HUMAN	Histone H1.2 OS=Homo sapiens OX=9606 GN=HIST1H1C PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	35.0	null	2-UNIMOD:1	0.14	35.0	6	2	0
PRT	sp|Q13263|TIF1B_HUMAN	Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28 PE=1 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1000663, ProteinPilot, ]	35.0	null		0.04	35.0	2	2	1
PRT	sp|P05783|K1C18_HUMAN	Keratin, type I cytoskeletal 18 OS=Homo sapiens OX=9606 GN=KRT18 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001207, Mascot, ]	35.0	null		0.12	35.0	10	5	2
PRT	sp|O75874|IDHC_HUMAN	Isocitrate dehydrogenase [NADP] cytoplasmic OS=Homo sapiens OX=9606 GN=IDH1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34.0	null		0.09	34.0	9	3	1
PRT	sp|Q14103-3|HNRPD_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein D0 OS=Homo sapiens OX=9606 GN=HNRNPD	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34.0	null		0.18	34.0	10	5	2
PRT	sp|Q08J23|NSUN2_HUMAN	tRNA (cytosine(34)-C(5))-methyltransferase OS=Homo sapiens OX=9606 GN=NSUN2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34.0	null		0.03	34.0	2	2	2
PRT	sp|Q8TEA8|DTD1_HUMAN	D-aminoacyl-tRNA deacylase 1 OS=Homo sapiens OX=9606 GN=DTD1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34.0	null		0.08	34.0	1	1	1
PRT	sp|P11047|LAMC1_HUMAN	Laminin subunit gamma-1 OS=Homo sapiens OX=9606 GN=LAMC1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34.0	null	954-UNIMOD:4,956-UNIMOD:4,965-UNIMOD:4	0.01	34.0	1	1	1
PRT	sp|Q29RF7|PDS5A_HUMAN	Sister chromatid cohesion protein PDS5 homolog A OS=Homo sapiens OX=9606 GN=PDS5A PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34.0	null		0.07	34.0	6	6	6
PRT	sp|O43684-2|BUB3_HUMAN	Isoform 2 of Mitotic checkpoint protein BUB3 OS=Homo sapiens OX=9606 GN=BUB3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34.0	null	129-UNIMOD:4	0.09	34.0	6	2	0
PRT	sp|O76094|SRP72_HUMAN	Signal recognition particle subunit SRP72 OS=Homo sapiens OX=9606 GN=SRP72 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	34.0	null		0.09	34.0	5	5	5
PRT	sp|Q9UK76-2|JUPI1_HUMAN	Isoform 2 of Jupiter microtubule associated homolog 1 OS=Homo sapiens OX=9606 GN=JPT1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34.0	null		0.09	34.0	2	1	0
PRT	sp|Q8NE71-2|ABCF1_HUMAN	Isoform 2 of ATP-binding cassette sub-family F member 1 OS=Homo sapiens OX=9606 GN=ABCF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34.0	null		0.05	34.0	4	4	4
PRT	sp|Q04917|1433F_HUMAN	14-3-3 protein eta OS=Homo sapiens OX=9606 GN=YWHAH PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1001476, X!Tandem, ]	34.0	null	112-UNIMOD:4,2-UNIMOD:1	0.26	34.0	12	8	4
PRT	sp|Q9GZL7|WDR12_HUMAN	Ribosome biogenesis protein WDR12 OS=Homo sapiens OX=9606 GN=WDR12 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34.0	null		0.06	34.0	3	2	1
PRT	sp|Q13813|SPTN1_HUMAN	Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	34.0	null	2441-UNIMOD:4,2120-UNIMOD:4	0.11	34.0	38	22	12
PRT	sp|O43719|HTSF1_HUMAN	HIV Tat-specific factor 1 OS=Homo sapiens OX=9606 GN=HTATSF1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34.0	null		0.04	34.0	3	2	1
PRT	sp|Q16643-2|DREB_HUMAN	Isoform 2 of Drebrin OS=Homo sapiens OX=9606 GN=DBN1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34.0	null		0.03	34.0	4	1	0
PRT	sp|P04632|CPNS1_HUMAN	Calpain small subunit 1 OS=Homo sapiens OX=9606 GN=CAPNS1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34.0	null		0.06	34.0	2	1	0
PRT	sp|Q9BW27-3|NUP85_HUMAN	Isoform 3 of Nuclear pore complex protein Nup85 OS=Homo sapiens OX=9606 GN=NUP85	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34.0	null		0.04	34.0	1	1	1
PRT	sp|Q92841-3|DDX17_HUMAN	Isoform 4 of Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens OX=9606 GN=DDX17	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34.0	null	198-UNIMOD:4,507-UNIMOD:4	0.14	34.0	17	7	4
PRT	sp|P49588|SYAC_HUMAN	Alanine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=AARS PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34.0	null		0.05	34.0	6	5	4
PRT	sp|P25490|TYY1_HUMAN	Transcriptional repressor protein YY1 OS=Homo sapiens OX=9606 GN=YY1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34.0	null		0.05	34.0	1	1	1
PRT	sp|P78347-2|GTF2I_HUMAN	Isoform 2 of General transcription factor II-I OS=Homo sapiens OX=9606 GN=GTF2I	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34.0	null		0.08	34.0	8	6	4
PRT	sp|P30049|ATPD_HUMAN	ATP synthase subunit delta, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1D PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34.0	null		0.15	34.0	4	2	1
PRT	sp|P61978-2|HNRPK_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34.0	null	184-UNIMOD:4,185-UNIMOD:4	0.17	34.0	16	7	3
PRT	sp|P62917|RL8_HUMAN	60S ribosomal protein L8 OS=Homo sapiens OX=9606 GN=RPL8 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	34.0	null		0.12	34.0	10	3	0
PRT	sp|P26640|SYVC_HUMAN	Valine--tRNA ligase OS=Homo sapiens OX=9606 GN=VARS PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	34.0	null		0.06	34.0	9	5	1
PRT	sp|P43034|LIS1_HUMAN	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens OX=9606 GN=PAFAH1B1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34.0	null		0.04	34.0	3	1	0
PRT	sp|O43707|ACTN4_HUMAN	Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34.0	null		0.08	34.0	13	7	2
PRT	sp|P16401|H15_HUMAN	Histone H1.5 OS=Homo sapiens OX=9606 GN=HIST1H1B PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001207, Mascot, ]	34.0	null	2-UNIMOD:1	0.13	34.0	13	2	0
PRT	sp|Q02978|M2OM_HUMAN	Mitochondrial 2-oxoglutarate/malate carrier protein OS=Homo sapiens OX=9606 GN=SLC25A11 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	34.0	null	2-UNIMOD:1	0.05	34.0	2	1	0
PRT	sp|Q9BQA1|MEP50_HUMAN	Methylosome protein 50 OS=Homo sapiens OX=9606 GN=WDR77 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33.0	null	172-UNIMOD:4	0.05	33.0	2	1	0
PRT	sp|P48431|SOX2_HUMAN	Transcription factor SOX-2 OS=Homo sapiens OX=9606 GN=SOX2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33.0	null		0.09	33.0	3	2	1
PRT	sp|Q9BVJ6-2|UT14A_HUMAN	Isoform 2 of U3 small nucleolar RNA-associated protein 14 homolog A OS=Homo sapiens OX=9606 GN=UTP14A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33.0	null		0.03	33.0	1	1	1
PRT	sp|O15397|IPO8_HUMAN	Importin-8 OS=Homo sapiens OX=9606 GN=IPO8 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33.0	null	727-UNIMOD:4,736-UNIMOD:4	0.03	33.0	2	2	2
PRT	sp|Q9Y4W2-2|LAS1L_HUMAN	Isoform 2 of Ribosomal biogenesis protein LAS1L OS=Homo sapiens OX=9606 GN=LAS1L	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33.0	null		0.03	33.0	1	1	1
PRT	sp|Q9Y266|NUDC_HUMAN	Nuclear migration protein nudC OS=Homo sapiens OX=9606 GN=NUDC PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33.0	null		0.21	33.0	7	5	3
PRT	sp|Q9UDY2|ZO2_HUMAN	Tight junction protein ZO-2 OS=Homo sapiens OX=9606 GN=TJP2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33.0	null		0.06	33.0	5	5	5
PRT	sp|P40855|PEX19_HUMAN	Peroxisomal biogenesis factor 19 OS=Homo sapiens OX=9606 GN=PEX19 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33.0	null		0.07	33.0	1	1	1
PRT	sp|Q9P2T1-2|GMPR2_HUMAN	Isoform 2 of GMP reductase 2 OS=Homo sapiens OX=9606 GN=GMPR2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33.0	null	240-UNIMOD:4,242-UNIMOD:4,204-UNIMOD:4	0.08	33.0	2	2	2
PRT	sp|P08195-2|4F2_HUMAN	Isoform 2 of 4F2 cell-surface antigen heavy chain OS=Homo sapiens OX=9606 GN=SLC3A2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33.0	null		0.03	33.0	1	1	1
PRT	sp|O60763-2|USO1_HUMAN	Isoform 2 of General vesicular transport factor p115 OS=Homo sapiens OX=9606 GN=USO1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33.0	null		0.07	33.0	7	5	3
PRT	sp|Q9Y6M1-1|IF2B2_HUMAN	Isoform 2 of Insulin-like growth factor 2 mRNA-binding protein 2 OS=Homo sapiens OX=9606 GN=IGF2BP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33.0	null	255-UNIMOD:4	0.07	33.0	5	2	0
PRT	sp|O43396|TXNL1_HUMAN	Thioredoxin-like protein 1 OS=Homo sapiens OX=9606 GN=TXNL1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33.0	null		0.10	33.0	3	2	1
PRT	sp|P52272-2|HNRPM_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein M OS=Homo sapiens OX=9606 GN=HNRNPM	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33.0	null	114-UNIMOD:4	0.11	33.0	11	6	3
PRT	sp|O00231-2|PSD11_HUMAN	Isoform 2 of 26S proteasome non-ATPase regulatory subunit 11 OS=Homo sapiens OX=9606 GN=PSMD11	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33.0	null	202-UNIMOD:4	0.09	33.0	8	3	1
PRT	sp|Q9NR30|DDX21_HUMAN	Nucleolar RNA helicase 2 OS=Homo sapiens OX=9606 GN=DDX21 PE=1 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	33.0	null	462-UNIMOD:28	0.09	33.0	13	6	3
PRT	sp|P16989|YBOX3_HUMAN	Y-box-binding protein 3 OS=Homo sapiens OX=9606 GN=YBX3 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	33.0	null		0.16	33.0	6	4	3
PRT	sp|Q96GM5-2|SMRD1_HUMAN	Isoform 2 of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 OS=Homo sapiens OX=9606 GN=SMARCD1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33.0	null		0.09	33.0	4	3	2
PRT	sp|Q9BV44|THUM3_HUMAN	THUMP domain-containing protein 3 OS=Homo sapiens OX=9606 GN=THUMPD3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33.0	null		0.05	33.0	2	2	2
PRT	sp|Q13242|SRSF9_HUMAN	Serine/arginine-rich splicing factor 9 OS=Homo sapiens OX=9606 GN=SRSF9 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	33.0	null	138-UNIMOD:4,80-UNIMOD:4	0.19	33.0	9	4	1
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1001476, X!Tandem, ]	33.0	null	2202-UNIMOD:4,223-UNIMOD:4,634-UNIMOD:4,642-UNIMOD:4,634-UNIMOD:385	0.06	33.0	30	14	7
PRT	sp|P06730-3|IF4E_HUMAN	Isoform 3 of Eukaryotic translation initiation factor 4E OS=Homo sapiens OX=9606 GN=EIF4E	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33.0	null		0.06	33.0	3	1	0
PRT	sp|O95831|AIFM1_HUMAN	Apoptosis-inducing factor 1, mitochondrial OS=Homo sapiens OX=9606 GN=AIFM1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33.0	null		0.09	33.0	7	4	2
PRT	sp|Q9Y6C9|MTCH2_HUMAN	Mitochondrial carrier homolog 2 OS=Homo sapiens OX=9606 GN=MTCH2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33.0	null		0.07	33.0	2	1	0
PRT	sp|P22102|PUR2_HUMAN	Trifunctional purine biosynthetic protein adenosine-3 OS=Homo sapiens OX=9606 GN=GART PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33.0	null	41-UNIMOD:4	0.04	33.0	7	3	1
PRT	sp|Q12789-3|TF3C1_HUMAN	Isoform 2 of General transcription factor 3C polypeptide 1 OS=Homo sapiens OX=9606 GN=GTF3C1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33.0	null	853-UNIMOD:4,317-UNIMOD:4,320-UNIMOD:4	0.03	33.0	6	5	4
PRT	sp|P23526|SAHH_HUMAN	Adenosylhomocysteinase OS=Homo sapiens OX=9606 GN=AHCY PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33.0	null		0.03	33.0	2	1	0
PRT	sp|Q01518-2|CAP1_HUMAN	Isoform 2 of Adenylyl cyclase-associated protein 1 OS=Homo sapiens OX=9606 GN=CAP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33.0	null	92-UNIMOD:4,415-UNIMOD:4,355-UNIMOD:4	0.16	33.0	10	6	4
PRT	sp|P22314|UBA1_HUMAN	Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33.0	null		0.02	33.0	6	2	0
PRT	sp|P35580-3|MYH10_HUMAN	Isoform 3 of Myosin-10 OS=Homo sapiens OX=9606 GN=MYH10	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33.0	null	1032-UNIMOD:4,176-UNIMOD:4	0.13	33.0	39	23	13
PRT	sp|P35221-2|CTNA1_HUMAN	Isoform 2 of Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33.0	null	116-UNIMOD:4	0.04	33.0	5	3	1
PRT	sp|P67936|TPM4_HUMAN	Tropomyosin alpha-4 chain OS=Homo sapiens OX=9606 GN=TPM4 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	33.0	null		0.19	33.0	7	4	2
PRT	sp|Q9Y2X3|NOP58_HUMAN	Nucleolar protein 58 OS=Homo sapiens OX=9606 GN=NOP58 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33.0	null	439-UNIMOD:4	0.13	33.0	6	5	4
PRT	sp|Q07065|CKAP4_HUMAN	Cytoskeleton-associated protein 4 OS=Homo sapiens OX=9606 GN=CKAP4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33.0	null		0.09	33.0	7	4	1
PRT	sp|O15164-2|TIF1A_HUMAN	Isoform Short of Transcription intermediary factor 1-alpha OS=Homo sapiens OX=9606 GN=TRIM24	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33.0	null	848-UNIMOD:4,127-UNIMOD:4,130-UNIMOD:4,134-UNIMOD:4	0.05	33.0	4	3	2
PRT	sp|A6NHR9|SMHD1_HUMAN	Structural maintenance of chromosomes flexible hinge domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SMCHD1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001207, Mascot, ]	33.0	null	2-UNIMOD:1,1856-UNIMOD:4	0.02	33.0	3	3	3
PRT	sp|Q12792|TWF1_HUMAN	Twinfilin-1 OS=Homo sapiens OX=9606 GN=TWF1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	33.0	null	2-UNIMOD:1	0.04	33.0	1	1	1
PRT	sp|P29083|T2EA_HUMAN	General transcription factor IIE subunit 1 OS=Homo sapiens OX=9606 GN=GTF2E1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32.0	null		0.04	32.0	1	1	1
PRT	sp|Q99798|ACON_HUMAN	Aconitate hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=ACO2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|Q13151|ROA0_HUMAN	Heterogeneous nuclear ribonucleoprotein A0 OS=Homo sapiens OX=9606 GN=HNRNPA0 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	1-UNIMOD:1,7-UNIMOD:4	0.16	32.0	7	4	3
PRT	sp|P38159-2|RBMX_HUMAN	Isoform 2 of RNA-binding motif protein, X chromosome OS=Homo sapiens OX=9606 GN=RBMX	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32.0	null		0.17	32.0	12	6	3
PRT	sp|Q15654|TRIP6_HUMAN	Thyroid receptor-interacting protein 6 OS=Homo sapiens OX=9606 GN=TRIP6 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32.0	null	339-UNIMOD:4,342-UNIMOD:4	0.07	32.0	3	2	1
PRT	sp|Q96HC4|PDLI5_HUMAN	PDZ and LIM domain protein 5 OS=Homo sapiens OX=9606 GN=PDLIM5 PE=1 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32.0	null		0.05	32.0	2	2	2
PRT	sp|Q15691|MARE1_HUMAN	Microtubule-associated protein RP/EB family member 1 OS=Homo sapiens OX=9606 GN=MAPRE1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32.0	null		0.07	32.0	2	1	0
PRT	sp|P05455|LA_HUMAN	Lupus La protein OS=Homo sapiens OX=9606 GN=SSB PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	245-UNIMOD:4,215-UNIMOD:28	0.19	32.0	16	7	2
PRT	sp|Q02878|RL6_HUMAN	60S ribosomal protein L6 OS=Homo sapiens OX=9606 GN=RPL6 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32.0	null		0.23	32.0	12	7	4
PRT	sp|Q9Y6K1|DNM3A_HUMAN	DNA (cytosine-5)-methyltransferase 3A OS=Homo sapiens OX=9606 GN=DNMT3A PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32.0	null	387-UNIMOD:4	0.03	32.0	4	2	1
PRT	sp|P35579|MYH9_HUMAN	Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	32.0	null		0.07	32.0	19	13	9
PRT	sp|Q9Y2Z0-2|SGT1_HUMAN	Isoform 2 of Protein SGT1 homolog OS=Homo sapiens OX=9606 GN=SUGT1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32.0	null	122-UNIMOD:4,49-UNIMOD:4	0.24	32.0	9	6	3
PRT	sp|Q01581|HMCS1_HUMAN	Hydroxymethylglutaryl-CoA synthase, cytoplasmic OS=Homo sapiens OX=9606 GN=HMGCS1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32.0	null		0.05	32.0	3	2	1
PRT	sp|P47914|RL29_HUMAN	60S ribosomal protein L29 OS=Homo sapiens OX=9606 GN=RPL29 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32.0	null		0.10	32.0	4	1	0
PRT	sp|P33316-2|DUT_HUMAN	Isoform 2 of Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=DUT	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32.0	null	3-UNIMOD:4,134-UNIMOD:4	0.14	32.0	2	2	2
PRT	sp|O00592-2|PODXL_HUMAN	Isoform 2 of Podocalyxin OS=Homo sapiens OX=9606 GN=PODXL	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32.0	null	312-UNIMOD:4	0.07	32.0	5	3	2
PRT	sp|Q9Y4L1|HYOU1_HUMAN	Hypoxia up-regulated protein 1 OS=Homo sapiens OX=9606 GN=HYOU1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32.0	null		0.05	32.0	9	5	2
PRT	sp|P52907|CAZA1_HUMAN	F-actin-capping protein subunit alpha-1 OS=Homo sapiens OX=9606 GN=CAPZA1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32.0	null		0.06	32.0	1	1	1
PRT	sp|Q13867|BLMH_HUMAN	Bleomycin hydrolase OS=Homo sapiens OX=9606 GN=BLMH PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32.0	null		0.05	32.0	1	1	1
PRT	sp|Q14974|IMB1_HUMAN	Importin subunit beta-1 OS=Homo sapiens OX=9606 GN=KPNB1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32.0	null	543-UNIMOD:4	0.07	32.0	9	5	2
PRT	sp|P23528|COF1_HUMAN	Cofilin-1 OS=Homo sapiens OX=9606 GN=CFL1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32.0	null	139-UNIMOD:4	0.14	32.0	9	2	0
PRT	sp|O60271-2|JIP4_HUMAN	Isoform 2 of C-Jun-amino-terminal kinase-interacting protein 4 OS=Homo sapiens OX=9606 GN=SPAG9	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32.0	null		0.01	32.0	1	1	1
PRT	sp|Q13162|PRDX4_HUMAN	Peroxiredoxin-4 OS=Homo sapiens OX=9606 GN=PRDX4 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32.0	null		0.05	32.0	2	1	0
PRT	sp|P26583|HMGB2_HUMAN	High mobility group protein B2 OS=Homo sapiens OX=9606 GN=HMGB2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32.0	null		0.12	32.0	7	3	1
PRT	sp|P31942-2|HNRH3_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein H3 OS=Homo sapiens OX=9606 GN=HNRNPH3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32.0	null		0.11	32.0	3	3	3
PRT	sp|Q14690|RRP5_HUMAN	Protein RRP5 homolog OS=Homo sapiens OX=9606 GN=PDCD11 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32.0	null	599-UNIMOD:4,694-UNIMOD:4	0.05	32.0	10	8	6
PRT	sp|O15355|PPM1G_HUMAN	Protein phosphatase 1G OS=Homo sapiens OX=9606 GN=PPM1G PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32.0	null		0.16	32.0	11	6	2
PRT	sp|P55265-2|DSRAD_HUMAN	Isoform 2 of Double-stranded RNA-specific adenosine deaminase OS=Homo sapiens OX=9606 GN=ADAR	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32.0	null	883-UNIMOD:4	0.03	32.0	5	3	2
PRT	sp|P08133-2|ANXA6_HUMAN	Isoform 2 of Annexin A6 OS=Homo sapiens OX=9606 GN=ANXA6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32.0	null		0.06	32.0	5	3	2
PRT	sp|P27695|APEX1_HUMAN	DNA-(apurinic or apyrimidinic site) lyase OS=Homo sapiens OX=9606 GN=APEX1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32.0	null		0.09	32.0	6	3	1
PRT	sp|Q9NQZ2|SAS10_HUMAN	Something about silencing protein 10 OS=Homo sapiens OX=9606 GN=UTP3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32.0	null		0.04	32.0	2	1	0
PRT	sp|P60866-2|RS20_HUMAN	Isoform 2 of 40S ribosomal protein S20 OS=Homo sapiens OX=9606 GN=RPS20	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32.0	null		0.11	32.0	5	2	0
PRT	sp|P12268|IMDH2_HUMAN	Inosine-5'-monophosphate dehydrogenase 2 OS=Homo sapiens OX=9606 GN=IMPDH2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32.0	null		0.06	32.0	5	3	2
PRT	sp|P22087|FBRL_HUMAN	rRNA 2'-O-methyltransferase fibrillarin OS=Homo sapiens OX=9606 GN=FBL PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32.0	null		0.05	32.0	4	1	0
PRT	sp|P22695|QCR2_HUMAN	Cytochrome b-c1 complex subunit 2, mitochondrial OS=Homo sapiens OX=9606 GN=UQCRC2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32.0	null		0.07	32.0	2	2	2
PRT	sp|Q14166|TTL12_HUMAN	Tubulin--tyrosine ligase-like protein 12 OS=Homo sapiens OX=9606 GN=TTLL12 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32.0	null	98-UNIMOD:4	0.06	32.0	4	3	2
PRT	sp|P33176|KINH_HUMAN	Kinesin-1 heavy chain OS=Homo sapiens OX=9606 GN=KIF5B PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	65-UNIMOD:4,294-UNIMOD:4,699-UNIMOD:28	0.07	32.0	5	5	5
PRT	sp|P06753-2|TPM3_HUMAN	Isoform 2 of Tropomyosin alpha-3 chain OS=Homo sapiens OX=9606 GN=TPM3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	154-UNIMOD:385,154-UNIMOD:4	0.25	32.0	14	7	2
PRT	sp|P52732|KIF11_HUMAN	Kinesin-like protein KIF11 OS=Homo sapiens OX=9606 GN=KIF11 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32.0	null	704-UNIMOD:4	0.03	32.0	6	3	1
PRT	sp|P05023-4|AT1A1_HUMAN	Isoform 4 of Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens OX=9606 GN=ATP1A1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32.0	null	663-UNIMOD:4	0.06	32.0	8	5	3
PRT	sp|Q9H583|HEAT1_HUMAN	HEAT repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=HEATR1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32.0	null	1143-UNIMOD:4	0.02	32.0	4	3	2
PRT	sp|Q96AE4-2|FUBP1_HUMAN	Isoform 2 of Far upstream element-binding protein 1 OS=Homo sapiens OX=9606 GN=FUBP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32.0	null		0.08	32.0	13	5	1
PRT	sp|Q14566|MCM6_HUMAN	DNA replication licensing factor MCM6 OS=Homo sapiens OX=9606 GN=MCM6 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	32.0	null		0.06	32.0	7	4	1
PRT	sp|P32321|DCTD_HUMAN	Deoxycytidylate deaminase OS=Homo sapiens OX=9606 GN=DCTD PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32.0	null	40-UNIMOD:4	0.11	32.0	1	1	1
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32.0	null		0.09	32.0	14	8	4
PRT	sp|Q00610-2|CLH1_HUMAN	Isoform 2 of Clathrin heavy chain 1 OS=Homo sapiens OX=9606 GN=CLTC	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32.0	null	870-UNIMOD:4,918-UNIMOD:4,617-UNIMOD:4,753-UNIMOD:4	0.07	32.0	15	9	4
PRT	sp|Q9BVA1|TBB2B_HUMAN	Tubulin beta-2B chain OS=Homo sapiens OX=9606 GN=TUBB2B PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32.0	null	1-UNIMOD:35,12-UNIMOD:4,354-UNIMOD:4,330-UNIMOD:35,303-UNIMOD:4	0.14	32.0	52	5	1
PRT	sp|Q9P0T7|TMEM9_HUMAN	Transmembrane protein 9 OS=Homo sapiens OX=9606 GN=TMEM9 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32.0	null		0.11	32.0	1	1	1
PRT	sp|P60174|TPIS_HUMAN	Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32.0	null	255-UNIMOD:4,104-UNIMOD:4	0.18	32.0	18	4	0
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32.0	null	1092-UNIMOD:4	0.05	32.0	6	5	4
PRT	sp|O95235|KI20A_HUMAN	Kinesin-like protein KIF20A OS=Homo sapiens OX=9606 GN=KIF20A PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32.0	null		0.07	32.0	4	4	4
PRT	sp|Q9BV86-2|NTM1A_HUMAN	Isoform 2 of N-terminal Xaa-Pro-Lys N-methyltransferase 1 OS=Homo sapiens OX=9606 GN=NTMT1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32.0	null	64-UNIMOD:4,68-UNIMOD:4	0.11	32.0	2	1	0
PRT	sp|O00267-2|SPT5H_HUMAN	Isoform 2 of Transcription elongation factor SPT5 OS=Homo sapiens OX=9606 GN=SUPT5H	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32.0	null	736-UNIMOD:4	0.03	32.0	2	2	2
PRT	sp|P46821|MAP1B_HUMAN	Microtubule-associated protein 1B OS=Homo sapiens OX=9606 GN=MAP1B PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32.0	null	963-UNIMOD:4,2041-UNIMOD:4	0.03	32.0	7	5	3
PRT	sp|Q14697-2|GANAB_HUMAN	Isoform 2 of Neutral alpha-glucosidase AB OS=Homo sapiens OX=9606 GN=GANAB	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|Q14195-2|DPYL3_HUMAN	Isoform LCRMP-4 of Dihydropyrimidinase-related protein 3 OS=Homo sapiens OX=9606 GN=DPYSL3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32.0	null		0.04	32.0	2	2	2
PRT	sp|P60709|ACTB_HUMAN	Actin, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=ACTB PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001207, Mascot, ]	32.0	null	360-UNIMOD:28,325-UNIMOD:35,44-UNIMOD:35,47-UNIMOD:35	0.16	32.0	30	6	0
PRT	sp|P09651|ROA1_HUMAN	Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	32.0	null	175-UNIMOD:4	0.09	32.0	5	3	1
PRT	sp|P10412|H14_HUMAN	Histone H1.4 OS=Homo sapiens OX=9606 GN=HIST1H1E PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	32.0	null	2-UNIMOD:1	0.08	32.0	5	1	0
PRT	sp|Q5SSJ5|HP1B3_HUMAN	Heterochromatin protein 1-binding protein 3 OS=Homo sapiens OX=9606 GN=HP1BP3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001207, Mascot, ]	32.0	null	2-UNIMOD:1	0.10	32.0	5	5	5
PRT	sp|Q9Y3E5|PTH2_HUMAN	Peptidyl-tRNA hydrolase 2, mitochondrial OS=Homo sapiens OX=9606 GN=PTRH2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31.0	null	86-UNIMOD:4	0.08	31.0	1	1	1
PRT	sp|Q9UN86-2|G3BP2_HUMAN	Isoform B of Ras GTPase-activating protein-binding protein 2 OS=Homo sapiens OX=9606 GN=G3BP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31.0	null		0.06	31.0	4	2	1
PRT	sp|Q9P0L0|VAPA_HUMAN	Vesicle-associated membrane protein-associated protein A OS=Homo sapiens OX=9606 GN=VAPA PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31.0	null		0.17	31.0	7	4	2
PRT	sp|Q96PK6|RBM14_HUMAN	RNA-binding protein 14 OS=Homo sapiens OX=9606 GN=RBM14 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31.0	null		0.10	31.0	7	6	5
PRT	sp|Q9UPT8|ZC3H4_HUMAN	Zinc finger CCCH domain-containing protein 4 OS=Homo sapiens OX=9606 GN=ZC3H4 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31.0	null		0.03	31.0	2	2	2
PRT	sp|Q06830|PRDX1_HUMAN	Peroxiredoxin-1 OS=Homo sapiens OX=9606 GN=PRDX1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31.0	null	173-UNIMOD:4	0.21	31.0	6	4	3
PRT	sp|Q92917|GPKOW_HUMAN	G-patch domain and KOW motifs-containing protein OS=Homo sapiens OX=9606 GN=GPKOW PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31.0	null		0.03	31.0	1	1	1
PRT	sp|O75717|WDHD1_HUMAN	WD repeat and HMG-box DNA-binding protein 1 OS=Homo sapiens OX=9606 GN=WDHD1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	31.0	null		0.04	31.0	4	4	4
PRT	sp|Q99700-4|ATX2_HUMAN	Isoform 4 of Ataxin-2 OS=Homo sapiens OX=9606 GN=ATXN2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31.0	null		0.01	31.0	1	1	1
PRT	sp|Q9UNF1|MAGD2_HUMAN	Melanoma-associated antigen D2 OS=Homo sapiens OX=9606 GN=MAGED2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	2-UNIMOD:1	0.06	31.0	2	2	2
PRT	sp|O00746|NDKM_HUMAN	Nucleoside diphosphate kinase, mitochondrial OS=Homo sapiens OX=9606 GN=NME4 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31.0	null		0.08	31.0	1	1	1
PRT	sp|Q13428-4|TCOF_HUMAN	Isoform 4 of Treacle protein OS=Homo sapiens OX=9606 GN=TCOF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31.0	null		0.06	31.0	8	6	4
PRT	sp|P32969|RL9_HUMAN	60S ribosomal protein L9 OS=Homo sapiens OX=9606 GN=RPL9 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31.0	null	134-UNIMOD:4	0.08	31.0	3	1	0
PRT	sp|Q9Y5L4|TIM13_HUMAN	Mitochondrial import inner membrane translocase subunit Tim13 OS=Homo sapiens OX=9606 GN=TIMM13 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31.0	null	50-UNIMOD:4	0.17	31.0	1	1	1
PRT	sp|O43290|SNUT1_HUMAN	U4/U6.U5 tri-snRNP-associated protein 1 OS=Homo sapiens OX=9606 GN=SART1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31.0	null		0.06	31.0	3	3	3
PRT	sp|P61201-2|CSN2_HUMAN	Isoform 2 of COP9 signalosome complex subunit 2 OS=Homo sapiens OX=9606 GN=COPS2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31.0	null	186-UNIMOD:4	0.04	31.0	2	2	2
PRT	sp|P51659-2|DHB4_HUMAN	Isoform 2 of Peroxisomal multifunctional enzyme type 2 OS=Homo sapiens OX=9606 GN=HSD17B4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31.0	null	214-UNIMOD:4	0.04	31.0	4	2	0
PRT	sp|O60832|DKC1_HUMAN	H/ACA ribonucleoprotein complex subunit DKC1 OS=Homo sapiens OX=9606 GN=DKC1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	414-UNIMOD:28	0.13	31.0	10	7	5
PRT	sp|O43583|DENR_HUMAN	Density-regulated protein OS=Homo sapiens OX=9606 GN=DENR PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	2-UNIMOD:1,13-UNIMOD:4	0.17	31.0	2	2	2
PRT	sp|P08754|GNAI3_HUMAN	Guanine nucleotide-binding protein G(k) subunit alpha OS=Homo sapiens OX=9606 GN=GNAI3 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31.0	null	66-UNIMOD:4,139-UNIMOD:4	0.07	31.0	2	2	2
PRT	sp|Q9NQ55|SSF1_HUMAN	Suppressor of SWI4 1 homolog OS=Homo sapiens OX=9606 GN=PPAN PE=2 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31.0	null		0.03	31.0	1	1	1
PRT	sp|Q99808-2|S29A1_HUMAN	Isoform 2 of Equilibrative nucleoside transporter 1 OS=Homo sapiens OX=9606 GN=SLC29A1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31.0	null		0.06	31.0	3	2	1
PRT	sp|Q9HDC9|APMAP_HUMAN	Adipocyte plasma membrane-associated protein OS=Homo sapiens OX=9606 GN=APMAP PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31.0	null		0.07	31.0	2	2	2
PRT	sp|Q92598-2|HS105_HUMAN	Isoform Beta of Heat shock protein 105 kDa OS=Homo sapiens OX=9606 GN=HSPH1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31.0	null	752-UNIMOD:4	0.05	31.0	5	3	2
PRT	sp|P20700|LMNB1_HUMAN	Lamin-B1 OS=Homo sapiens OX=9606 GN=LMNB1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	31.0	null		0.19	31.0	23	11	5
PRT	sp|Q13620-1|CUL4B_HUMAN	Isoform 2 of Cullin-4B OS=Homo sapiens OX=9606 GN=CUL4B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31.0	null	619-UNIMOD:4,769-UNIMOD:4	0.06	31.0	5	5	5
PRT	sp|Q7L4I2-2|RSRC2_HUMAN	Isoform 2 of Arginine/serine-rich coiled-coil protein 2 OS=Homo sapiens OX=9606 GN=RSRC2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31.0	null	334-UNIMOD:4	0.04	31.0	1	1	1
PRT	sp|Q8WZA9|IRGQ_HUMAN	Immunity-related GTPase family Q protein OS=Homo sapiens OX=9606 GN=IRGQ PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31.0	null	340-UNIMOD:4	0.05	31.0	2	2	2
PRT	sp|Q14683|SMC1A_HUMAN	Structural maintenance of chromosomes protein 1A OS=Homo sapiens OX=9606 GN=SMC1A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31.0	null		0.13	31.0	18	14	12
PRT	sp|P04179-2|SODM_HUMAN	Isoform 2 of Superoxide dismutase [Mn], mitochondrial OS=Homo sapiens OX=9606 GN=SOD2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31.0	null		0.09	31.0	5	1	0
PRT	sp|Q7KZI7-11|MARK2_HUMAN	Isoform 11 of Serine/threonine-protein kinase MARK2 OS=Homo sapiens OX=9606 GN=MARK2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|Q7Z4V5-2|HDGR2_HUMAN	Isoform 2 of Hepatoma-derived growth factor-related protein 2 OS=Homo sapiens OX=9606 GN=HDGFL2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31.0	null	631-UNIMOD:4	0.13	31.0	7	6	5
PRT	sp|Q01844-3|EWS_HUMAN	Isoform 3 of RNA-binding protein EWS OS=Homo sapiens OX=9606 GN=EWSR1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31.0	null		0.05	31.0	3	2	1
PRT	sp|Q12904-2|AIMP1_HUMAN	Isoform 2 of Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 OS=Homo sapiens OX=9606 GN=AIMP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31.0	null	185-UNIMOD:4	0.08	31.0	2	2	2
PRT	sp|P16422|EPCAM_HUMAN	Epithelial cell adhesion molecule OS=Homo sapiens OX=9606 GN=EPCAM PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31.0	null	46-UNIMOD:4,48-UNIMOD:4,59-UNIMOD:4,135-UNIMOD:4	0.10	31.0	3	2	1
PRT	sp|P37198|NUP62_HUMAN	Nuclear pore glycoprotein p62 OS=Homo sapiens OX=9606 GN=NUP62 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31.0	null		0.03	31.0	1	1	1
PRT	sp|P08865|RSSA_HUMAN	40S ribosomal protein SA OS=Homo sapiens OX=9606 GN=RPSA PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31.0	null		0.05	31.0	3	1	0
PRT	sp|Q08211|DHX9_HUMAN	ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	31.0	null	438-UNIMOD:4	0.07	31.0	19	10	4
PRT	sp|P30041|PRDX6_HUMAN	Peroxiredoxin-6 OS=Homo sapiens OX=9606 GN=PRDX6 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31.0	null	91-UNIMOD:4	0.11	31.0	4	2	1
PRT	sp|P11142|HSP7C_HUMAN	Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31.0	null	87-UNIMOD:35,603-UNIMOD:4	0.08	31.0	10	4	1
PRT	sp|P53990-2|IST1_HUMAN	Isoform 2 of IST1 homolog OS=Homo sapiens OX=9606 GN=IST1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31.0	null	125-UNIMOD:4	0.09	31.0	15	2	0
PRT	sp|P05166-2|PCCB_HUMAN	Isoform 2 of Propionyl-CoA carboxylase beta chain, mitochondrial OS=Homo sapiens OX=9606 GN=PCCB	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31.0	null		0.03	31.0	2	1	0
PRT	sp|O00629|IMA3_HUMAN	Importin subunit alpha-3 OS=Homo sapiens OX=9606 GN=KPNA4 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31.0	null		0.03	31.0	1	1	1
PRT	sp|Q6ZN17|LN28B_HUMAN	Protein lin-28 homolog B OS=Homo sapiens OX=9606 GN=LIN28B PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	31.0	null	201-UNIMOD:4,107-UNIMOD:4,187-UNIMOD:4	0.19	31.0	4	3	2
PRT	sp|O00116|ADAS_HUMAN	Alkyldihydroxyacetonephosphate synthase, peroxisomal OS=Homo sapiens OX=9606 GN=AGPS PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31.0	null		0.08	31.0	4	3	2
PRT	sp|P35080|PROF2_HUMAN	Profilin-2 OS=Homo sapiens OX=9606 GN=PFN2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31.0	null		0.11	31.0	5	1	0
PRT	sp|P07900-2|HS90A_HUMAN	Isoform 2 of Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31.0	null		0.13	31.0	35	11	1
PRT	sp|P38919|IF4A3_HUMAN	Eukaryotic initiation factor 4A-III OS=Homo sapiens OX=9606 GN=EIF4A3 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	2-UNIMOD:1	0.13	31.0	9	5	2
PRT	sp|Q9Y530|OARD1_HUMAN	O-acetyl-ADP-ribose deacetylase 1 OS=Homo sapiens OX=9606 GN=OARD1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	33-UNIMOD:4,38-UNIMOD:4,2-UNIMOD:1	0.24	31.0	3	3	3
PRT	sp|P09622|DLDH_HUMAN	Dihydrolipoyl dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=DLD PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31.0	null	484-UNIMOD:4	0.11	31.0	7	4	3
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	31.0	null	567-UNIMOD:4,693-UNIMOD:4,697-UNIMOD:35	0.13	31.0	26	12	6
PRT	sp|Q6NZY4|ZCHC8_HUMAN	Zinc finger CCHC domain-containing protein 8 OS=Homo sapiens OX=9606 GN=ZCCHC8 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31.0	null		0.04	31.0	2	2	2
PRT	sp|Q10570|CPSF1_HUMAN	Cleavage and polyadenylation specificity factor subunit 1 OS=Homo sapiens OX=9606 GN=CPSF1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31.0	null	1044-UNIMOD:4	0.03	31.0	5	3	2
PRT	sp|P11717|MPRI_HUMAN	Cation-independent mannose-6-phosphate receptor OS=Homo sapiens OX=9606 GN=IGF2R PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	31.0	null	2188-UNIMOD:4,2194-UNIMOD:4,987-UNIMOD:4,531-UNIMOD:4,538-UNIMOD:4,1270-UNIMOD:4,1476-UNIMOD:4	0.03	31.0	9	5	4
PRT	sp|Q9Y263|PLAP_HUMAN	Phospholipase A-2-activating protein OS=Homo sapiens OX=9606 GN=PLAA PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31.0	null		0.02	31.0	2	1	0
PRT	sp|Q9BYX7|ACTBM_HUMAN	Putative beta-actin-like protein 3 OS=Homo sapiens OX=9606 GN=POTEKP PE=5 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31.0	null		0.04	31.0	5	1	0
PRT	sp|Q9UBW7|ZMYM2_HUMAN	Zinc finger MYM-type protein 2 OS=Homo sapiens OX=9606 GN=ZMYM2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001207, Mascot, ]	31.0	null	823-UNIMOD:4,1268-UNIMOD:4,494-UNIMOD:4,495-UNIMOD:4,498-UNIMOD:4	0.03	31.0	3	3	3
PRT	sp|Q9UHD8|SEPT9_HUMAN	Septin-9 OS=Homo sapiens OX=9606 GN=SEPT9 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001207, Mascot, ]	31.0	null		0.08	31.0	5	4	3
PRT	sp|Q01844|EWS_HUMAN	RNA-binding protein EWS OS=Homo sapiens OX=9606 GN=EWSR1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31.0	null		0.02	31.0	2	1	0
PRT	sp|P49755|TMEDA_HUMAN	Transmembrane emp24 domain-containing protein 10 OS=Homo sapiens OX=9606 GN=TMED10 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001207, Mascot, ]	31.0	null		0.06	31.0	2	1	0
PRT	sp|Q5T6F2|UBAP2_HUMAN	Ubiquitin-associated protein 2 OS=Homo sapiens OX=9606 GN=UBAP2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|Q9UIG0-2|BAZ1B_HUMAN	Isoform 2 of Tyrosine-protein kinase BAZ1B OS=Homo sapiens OX=9606 GN=BAZ1B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null	1198-UNIMOD:4,1201-UNIMOD:4	0.03	30.0	3	3	3
PRT	sp|P52434-3|RPAB3_HUMAN	Isoform 3 of DNA-directed RNA polymerases I, II, and III subunit RPABC3 OS=Homo sapiens OX=9606 GN=POLR2H	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null		0.15	30.0	2	2	2
PRT	sp|Q8N1G4|LRC47_HUMAN	Leucine-rich repeat-containing protein 47 OS=Homo sapiens OX=9606 GN=LRRC47 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	30.0	null		0.07	30.0	5	4	3
PRT	sp|P60981-2|DEST_HUMAN	Isoform 2 of Destrin OS=Homo sapiens OX=9606 GN=DSTN	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null	118-UNIMOD:4	0.09	30.0	2	1	0
PRT	sp|Q96QC0|PP1RA_HUMAN	Serine/threonine-protein phosphatase 1 regulatory subunit 10 OS=Homo sapiens OX=9606 GN=PPP1R10 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|Q9P2J5-2|SYLC_HUMAN	Isoform 2 of Leucine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=LARS	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null	882-UNIMOD:4,1039-UNIMOD:4	0.04	30.0	5	4	3
PRT	sp|P35241-5|RADI_HUMAN	Isoform 5 of Radixin OS=Homo sapiens OX=9606 GN=RDX	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null		0.04	30.0	3	2	1
PRT	sp|Q5UIP0|RIF1_HUMAN	Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null	1718-UNIMOD:4,1155-UNIMOD:4	0.06	30.0	11	11	11
PRT	sp|P35998|PRS7_HUMAN	26S proteasome regulatory subunit 7 OS=Homo sapiens OX=9606 GN=PSMC2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	30.0	null		0.11	30.0	8	5	3
PRT	sp|Q15942|ZYX_HUMAN	Zyxin OS=Homo sapiens OX=9606 GN=ZYX PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null	384-UNIMOD:4	0.08	30.0	5	3	1
PRT	sp|P23229-2|ITA6_HUMAN	Isoform Alpha-6X1A of Integrin alpha-6 OS=Homo sapiens OX=9606 GN=ITGA6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null	626-UNIMOD:4,632-UNIMOD:4	0.01	30.0	1	1	1
PRT	sp|Q07157-2|ZO1_HUMAN	Isoform Short of Tight junction protein ZO-1 OS=Homo sapiens OX=9606 GN=TJP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null		0.06	30.0	8	7	6
PRT	sp|P49368|TCPG_HUMAN	T-complex protein 1 subunit gamma OS=Homo sapiens OX=9606 GN=CCT3 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	30.0	null	455-UNIMOD:4	0.09	30.0	9	5	3
PRT	sp|Q5T7N2|LITD1_HUMAN	LINE-1 type transposase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=L1TD1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null	744-UNIMOD:4	0.11	30.0	15	10	6
PRT	sp|P30101|PDIA3_HUMAN	Protein disulfide-isomerase A3 OS=Homo sapiens OX=9606 GN=PDIA3 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	30.0	null		0.17	30.0	37	11	2
PRT	sp|Q9H2U1-2|DHX36_HUMAN	Isoform 2 of ATP-dependent DNA/RNA helicase DHX36 OS=Homo sapiens OX=9606 GN=DHX36	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null	284-UNIMOD:4	0.02	30.0	1	1	1
PRT	sp|P29762|RABP1_HUMAN	Cellular retinoic acid-binding protein 1 OS=Homo sapiens OX=9606 GN=CRABP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null	96-UNIMOD:4	0.33	30.0	7	3	1
PRT	sp|P22061-2|PIMT_HUMAN	Isoform 2 of Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Homo sapiens OX=9606 GN=PCMT1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null		0.16	30.0	3	3	3
PRT	sp|P23193|TCEA1_HUMAN	Transcription elongation factor A protein 1 OS=Homo sapiens OX=9606 GN=TCEA1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null	271-UNIMOD:4	0.08	30.0	4	3	2
PRT	sp|P55060-3|XPO2_HUMAN	Isoform 3 of Exportin-2 OS=Homo sapiens OX=9606 GN=CSE1L	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null	842-UNIMOD:4	0.06	30.0	7	6	5
PRT	sp|P46937-6|YAP1_HUMAN	Isoform 6 of Transcriptional coactivator YAP1 OS=Homo sapiens OX=9606 GN=YAP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null		0.04	30.0	1	1	1
PRT	sp|P43243|MATR3_HUMAN	Matrin-3 OS=Homo sapiens OX=9606 GN=MATR3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	30.0	null	230-UNIMOD:4,821-UNIMOD:4	0.12	30.0	17	9	4
PRT	sp|P09884|DPOLA_HUMAN	DNA polymerase alpha catalytic subunit OS=Homo sapiens OX=9606 GN=POLA1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|Q14691|PSF1_HUMAN	DNA replication complex GINS protein PSF1 OS=Homo sapiens OX=9606 GN=GINS1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null		0.08	30.0	1	1	1
PRT	sp|Q6UXH1-5|CREL2_HUMAN	Isoform 5 of Cysteine-rich with EGF-like domain protein 2 OS=Homo sapiens OX=9606 GN=CRELD2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null	337-UNIMOD:4,343-UNIMOD:4	0.04	30.0	1	1	1
PRT	sp|P62701|RS4X_HUMAN	40S ribosomal protein S4, X isoform OS=Homo sapiens OX=9606 GN=RPS4X PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	30.0	null		0.28	30.0	17	8	5
PRT	sp|Q13838-2|DX39B_HUMAN	Isoform 2 of Spliceosome RNA helicase DDX39B OS=Homo sapiens OX=9606 GN=DDX39B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null	180-UNIMOD:4	0.03	30.0	5	2	1
PRT	sp|Q5JNZ5|RS26L_HUMAN	Putative 40S ribosomal protein S26-like 1 OS=Homo sapiens OX=9606 GN=RPS26P11 PE=5 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	30.0	null	74-UNIMOD:4,77-UNIMOD:4	0.34	30.0	8	3	1
PRT	sp|Q96KR1|ZFR_HUMAN	Zinc finger RNA-binding protein OS=Homo sapiens OX=9606 GN=ZFR PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	30.0	null	587-UNIMOD:4,589-UNIMOD:4	0.11	30.0	11	8	6
PRT	sp|Q96EP5-2|DAZP1_HUMAN	Isoform 2 of DAZ-associated protein 1 OS=Homo sapiens OX=9606 GN=DAZAP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null		0.04	30.0	5	1	0
PRT	sp|Q7L190|DPPA4_HUMAN	Developmental pluripotency-associated protein 4 OS=Homo sapiens OX=9606 GN=DPPA4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null		0.06	30.0	3	2	1
PRT	sp|P52292|IMA1_HUMAN	Importin subunit alpha-1 OS=Homo sapiens OX=9606 GN=KPNA2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null		0.03	30.0	2	1	0
PRT	sp|O94808|GFPT2_HUMAN	Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 OS=Homo sapiens OX=9606 GN=GFPT2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null		0.03	30.0	1	1	1
PRT	sp|Q96PZ0-2|PUS7_HUMAN	Isoform 2 of Pseudouridylate synthase 7 homolog OS=Homo sapiens OX=9606 GN=PUS7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null		0.05	30.0	3	3	3
PRT	sp|Q01105|SET_HUMAN	Protein SET OS=Homo sapiens OX=9606 GN=SET PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null		0.08	30.0	6	2	1
PRT	sp|P14314-2|GLU2B_HUMAN	Isoform 2 of Glucosidase 2 subunit beta OS=Homo sapiens OX=9606 GN=PRKCSH	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null	468-UNIMOD:4,70-UNIMOD:4,77-UNIMOD:4	0.14	30.0	9	6	5
PRT	sp|Q7RTV0|PHF5A_HUMAN	PHD finger-like domain-containing protein 5A OS=Homo sapiens OX=9606 GN=PHF5A PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null	46-UNIMOD:4,49-UNIMOD:4	0.13	30.0	2	1	0
PRT	sp|Q8IY81|SPB1_HUMAN	pre-rRNA processing protein FTSJ3 OS=Homo sapiens OX=9606 GN=FTSJ3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|Q7Z7K6-3|CENPV_HUMAN	Isoform 3 of Centromere protein V OS=Homo sapiens OX=9606 GN=CENPV	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null		0.06	30.0	2	1	0
PRT	sp|P10768|ESTD_HUMAN	S-formylglutathione hydrolase OS=Homo sapiens OX=9606 GN=ESD PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null	28-UNIMOD:4	0.08	30.0	4	2	1
PRT	sp|Q9Y6Y8|S23IP_HUMAN	SEC23-interacting protein OS=Homo sapiens OX=9606 GN=SEC23IP PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|Q15056|IF4H_HUMAN	Eukaryotic translation initiation factor 4H OS=Homo sapiens OX=9606 GN=EIF4H PE=1 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null		0.06	30.0	1	1	1
PRT	sp|O95881|TXD12_HUMAN	Thioredoxin domain-containing protein 12 OS=Homo sapiens OX=9606 GN=TXNDC12 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1001476, X!Tandem, ]	30.0	null		0.09	30.0	3	1	0
PRT	sp|Q14839-2|CHD4_HUMAN	Isoform 2 of Chromodomain-helicase-DNA-binding protein 4 OS=Homo sapiens OX=9606 GN=CHD4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null		0.04	30.0	6	6	6
PRT	sp|P18669|PGAM1_HUMAN	Phosphoglycerate mutase 1 OS=Homo sapiens OX=9606 GN=PGAM1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null		0.19	30.0	16	5	1
PRT	sp|P62942|FKB1A_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Homo sapiens OX=9606 GN=FKBP1A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null		0.13	30.0	4	1	0
PRT	sp|Q9Y237-2|PIN4_HUMAN	Isoform 2 of Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 OS=Homo sapiens OX=9606 GN=PIN4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null		0.08	30.0	2	1	0
PRT	sp|Q05682-4|CALD1_HUMAN	Isoform 4 of Caldesmon OS=Homo sapiens OX=9606 GN=CALD1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null		0.12	30.0	7	6	5
PRT	sp|Q6NUQ4-2|TM214_HUMAN	Isoform 2 of Transmembrane protein 214 OS=Homo sapiens OX=9606 GN=TMEM214	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null	484-UNIMOD:4	0.02	30.0	1	1	1
PRT	sp|Q92896|GSLG1_HUMAN	Golgi apparatus protein 1 OS=Homo sapiens OX=9606 GN=GLG1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null	269-UNIMOD:4,324-UNIMOD:4,984-UNIMOD:4,118-UNIMOD:4,452-UNIMOD:4,950-UNIMOD:4	0.07	30.0	7	7	7
PRT	sp|P28799|GRN_HUMAN	Granulins OS=Homo sapiens OX=9606 GN=GRN PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	30.0	null	479-UNIMOD:28,481-UNIMOD:4,482-UNIMOD:4,488-UNIMOD:4	0.02	30.0	1	1	0
PRT	sp|Q09028|RBBP4_HUMAN	Histone-binding protein RBBP4 OS=Homo sapiens OX=9606 GN=RBBP4 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30.0	null	167-UNIMOD:4	0.04	30.0	1	1	0
PRT	sp|P22626-2|ROA2_HUMAN	Isoform A2 of Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null	38-UNIMOD:4,41-UNIMOD:35	0.11	29.0	11	5	1
PRT	sp|Q9NRX1|PNO1_HUMAN	RNA-binding protein PNO1 OS=Homo sapiens OX=9606 GN=PNO1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null		0.07	29.0	1	1	1
PRT	sp|P33778|H2B1B_HUMAN	Histone H2B type 1-B OS=Homo sapiens OX=9606 GN=HIST1H2BB PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null		0.10	29.0	4	1	0
PRT	sp|Q92673|SORL_HUMAN	Sortilin-related receptor OS=Homo sapiens OX=9606 GN=SORL1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	29.0	null	736-UNIMOD:4,1549-UNIMOD:4	0.02	29.0	4	4	4
PRT	sp|Q9Y5B9|SP16H_HUMAN	FACT complex subunit SPT16 OS=Homo sapiens OX=9606 GN=SUPT16H PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null		0.03	29.0	7	3	0
PRT	sp|O60884|DNJA2_HUMAN	DnaJ homolog subfamily A member 2 OS=Homo sapiens OX=9606 GN=DNAJA2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null	143-UNIMOD:4,146-UNIMOD:4	0.06	29.0	4	2	1
PRT	sp|Q96HS1|PGAM5_HUMAN	Serine/threonine-protein phosphatase PGAM5, mitochondrial OS=Homo sapiens OX=9606 GN=PGAM5 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null		0.09	29.0	4	3	2
PRT	sp|Q12955|ANK3_HUMAN	Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null		0.00	29.0	1	1	1
PRT	sp|P62258|1433E_HUMAN	14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null		0.27	29.0	16	6	1
PRT	sp|Q9UHI6|DDX20_HUMAN	Probable ATP-dependent RNA helicase DDX20 OS=Homo sapiens OX=9606 GN=DDX20 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|P04075-2|ALDOA_HUMAN	Isoform 2 of Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null	393-UNIMOD:4,294-UNIMOD:4	0.12	29.0	11	6	2
PRT	sp|O00148|DX39A_HUMAN	ATP-dependent RNA helicase DDX39A OS=Homo sapiens OX=9606 GN=DDX39A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null	164-UNIMOD:4,197-UNIMOD:4	0.05	29.0	3	2	1
PRT	sp|Q9BQP7|MGME1_HUMAN	Mitochondrial genome maintenance exonuclease 1 OS=Homo sapiens OX=9606 GN=MGME1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null		0.04	29.0	2	1	0
PRT	sp|P00441|SODC_HUMAN	Superoxide dismutase [Cu-Zn] OS=Homo sapiens OX=9606 GN=SOD1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null		0.08	29.0	2	1	0
PRT	sp|P26373|RL13_HUMAN	60S ribosomal protein L13 OS=Homo sapiens OX=9606 GN=RPL13 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	29.0	null		0.11	29.0	4	2	1
PRT	sp|P19338|NUCL_HUMAN	Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null	630-UNIMOD:35	0.05	29.0	9	3	1
PRT	sp|P33993|MCM7_HUMAN	DNA replication licensing factor MCM7 OS=Homo sapiens OX=9606 GN=MCM7 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null		0.04	29.0	4	2	0
PRT	sp|O00425|IF2B3_HUMAN	Insulin-like growth factor 2 mRNA-binding protein 3 OS=Homo sapiens OX=9606 GN=IGF2BP3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null	546-UNIMOD:4,194-UNIMOD:4	0.10	29.0	9	5	3
PRT	sp|Q03252|LMNB2_HUMAN	Lamin-B2 OS=Homo sapiens OX=9606 GN=LMNB2 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null		0.05	29.0	5	3	1
PRT	sp|Q9C0C9|UBE2O_HUMAN	(E3-independent) E2 ubiquitin-conjugating enzyme OS=Homo sapiens OX=9606 GN=UBE2O PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|P06744-2|G6PI_HUMAN	Isoform 2 of Glucose-6-phosphate isomerase OS=Homo sapiens OX=9606 GN=GPI	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null		0.06	29.0	4	3	2
PRT	sp|Q15233-2|NONO_HUMAN	Isoform 2 of Non-POU domain-containing octamer-binding protein OS=Homo sapiens OX=9606 GN=NONO	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null	56-UNIMOD:4	0.12	29.0	19	4	2
PRT	sp|O94979-10|SC31A_HUMAN	Isoform 10 of Protein transport protein Sec31A OS=Homo sapiens OX=9606 GN=SEC31A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null	605-UNIMOD:4	0.03	29.0	4	3	2
PRT	sp|Q16851|UGPA_HUMAN	UTP--glucose-1-phosphate uridylyltransferase OS=Homo sapiens OX=9606 GN=UGP2 PE=1 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	29.0	null	123-UNIMOD:4	0.10	29.0	12	5	1
PRT	sp|O95373|IPO7_HUMAN	Importin-7 OS=Homo sapiens OX=9606 GN=IPO7 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null	736-UNIMOD:4	0.02	29.0	1	1	1
PRT	sp|Q8WXA9-2|SREK1_HUMAN	Isoform 2 of Splicing regulatory glutamine/lysine-rich protein 1 OS=Homo sapiens OX=9606 GN=SREK1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null	610-UNIMOD:4	0.03	29.0	1	1	1
PRT	sp|Q9Y5K6|CD2AP_HUMAN	CD2-associated protein OS=Homo sapiens OX=9606 GN=CD2AP PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	29.0	null		0.04	29.0	3	2	1
PRT	sp|Q12756-2|KIF1A_HUMAN	Isoform 2 of Kinesin-like protein KIF1A OS=Homo sapiens OX=9606 GN=KIF1A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null	1754-UNIMOD:4	0.01	29.0	2	1	0
PRT	sp|P28838-2|AMPL_HUMAN	Isoform 2 of Cytosol aminopeptidase OS=Homo sapiens OX=9606 GN=LAP3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null		0.08	29.0	3	3	3
PRT	sp|Q86W42-3|THOC6_HUMAN	Isoform 3 of THO complex subunit 6 homolog OS=Homo sapiens OX=9606 GN=THOC6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null		0.06	29.0	2	2	2
PRT	sp|Q9Y230-2|RUVB2_HUMAN	Isoform 2 of RuvB-like 2 OS=Homo sapiens OX=9606 GN=RUVBL2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null	182-UNIMOD:4	0.09	29.0	7	3	1
PRT	sp|Q8IWB7|WDFY1_HUMAN	WD repeat and FYVE domain-containing protein 1 OS=Homo sapiens OX=9606 GN=WDFY1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null	344-UNIMOD:4,347-UNIMOD:4	0.07	29.0	2	2	2
PRT	sp|P26196|DDX6_HUMAN	Probable ATP-dependent RNA helicase DDX6 OS=Homo sapiens OX=9606 GN=DDX6 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null		0.05	29.0	1	1	1
PRT	sp|Q9UMS4|PRP19_HUMAN	Pre-mRNA-processing factor 19 OS=Homo sapiens OX=9606 GN=PRPF19 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	29.0	null	114-UNIMOD:4	0.03	29.0	3	1	0
PRT	sp|Q04637-3|IF4G1_HUMAN	Isoform B of Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null		0.06	29.0	9	8	7
PRT	sp|P49756|RBM25_HUMAN	RNA-binding protein 25 OS=Homo sapiens OX=9606 GN=RBM25 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null		0.04	29.0	3	2	1
PRT	sp|P46013|KI67_HUMAN	Proliferation marker protein Ki-67 OS=Homo sapiens OX=9606 GN=MKI67 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null	226-UNIMOD:4	0.06	29.0	12	12	12
PRT	sp|O75152|ZC11A_HUMAN	Zinc finger CCCH domain-containing protein 11A OS=Homo sapiens OX=9606 GN=ZC3H11A PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null		0.07	29.0	4	3	2
PRT	sp|Q9BXP5-2|SRRT_HUMAN	Isoform 2 of Serrate RNA effector molecule homolog OS=Homo sapiens OX=9606 GN=SRRT	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null	490-UNIMOD:4	0.08	29.0	8	6	4
PRT	sp|Q06546|GABPA_HUMAN	GA-binding protein alpha chain OS=Homo sapiens OX=9606 GN=GABPA PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null		0.06	29.0	2	2	2
PRT	sp|A0AVT1|UBA6_HUMAN	Ubiquitin-like modifier-activating enzyme 6 OS=Homo sapiens OX=9606 GN=UBA6 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null	347-UNIMOD:4	0.02	29.0	2	1	0
PRT	sp|P07355-2|ANXA2_HUMAN	Isoform 2 of Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null		0.09	29.0	6	3	1
PRT	sp|P62873-2|GBB1_HUMAN	Isoform 2 of Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Homo sapiens OX=9606 GN=GNB1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null	204-UNIMOD:4,148-UNIMOD:4,149-UNIMOD:4	0.15	29.0	7	4	2
PRT	sp|Q9Y3I0|RTCB_HUMAN	tRNA-splicing ligase RtcB homolog OS=Homo sapiens OX=9606 GN=RTCB PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null	485-UNIMOD:4	0.06	29.0	4	2	1
PRT	sp|P30419|NMT1_HUMAN	Glycylpeptide N-tetradecanoyltransferase 1 OS=Homo sapiens OX=9606 GN=NMT1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null		0.03	29.0	2	1	0
PRT	sp|Q9H6Z4-2|RANB3_HUMAN	Isoform 2 of Ran-binding protein 3 OS=Homo sapiens OX=9606 GN=RANBP3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null		0.03	29.0	1	1	1
PRT	sp|P14550|AK1A1_HUMAN	Alcohol dehydrogenase [NADP(+)] OS=Homo sapiens OX=9606 GN=AKR1A1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null	134-UNIMOD:4	0.07	29.0	3	2	1
PRT	sp|P00558|PGK1_HUMAN	Phosphoglycerate kinase 1 OS=Homo sapiens OX=9606 GN=PGK1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null	99-UNIMOD:4,50-UNIMOD:4	0.10	29.0	5	4	3
PRT	sp|Q9BYT8|NEUL_HUMAN	Neurolysin, mitochondrial OS=Homo sapiens OX=9606 GN=NLN PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	29.0	null	153-UNIMOD:4	0.05	29.0	4	3	2
PRT	sp|P05787-2|K2C8_HUMAN	Isoform 2 of Keratin, type II cytoskeletal 8 OS=Homo sapiens OX=9606 GN=KRT8	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null		0.15	29.0	10	7	5
PRT	sp|P27797|CALR_HUMAN	Calreticulin OS=Homo sapiens OX=9606 GN=CALR PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null	105-UNIMOD:4	0.11	29.0	9	4	2
PRT	sp|Q9UHB9|SRP68_HUMAN	Signal recognition particle subunit SRP68 OS=Homo sapiens OX=9606 GN=SRP68 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null		0.10	29.0	9	5	2
PRT	sp|Q9Y490|TLN1_HUMAN	Talin-1 OS=Homo sapiens OX=9606 GN=TLN1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null	1939-UNIMOD:4,1199-UNIMOD:4,1202-UNIMOD:4	0.04	29.0	10	9	8
PRT	sp|P45954|ACDSB_HUMAN	Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ACADSB PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null		0.03	29.0	1	1	1
PRT	sp|P05165|PCCA_HUMAN	Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Homo sapiens OX=9606 GN=PCCA PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null		0.04	29.0	3	2	1
PRT	sp|P49790-3|NU153_HUMAN	Isoform 3 of Nuclear pore complex protein Nup153 OS=Homo sapiens OX=9606 GN=NUP153	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null		0.04	29.0	4	4	4
PRT	sp|O15381|NVL_HUMAN	Nuclear valosin-containing protein-like OS=Homo sapiens OX=9606 GN=NVL PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|Q14202|ZMYM3_HUMAN	Zinc finger MYM-type protein 3 OS=Homo sapiens OX=9606 GN=ZMYM3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null	450-UNIMOD:4,451-UNIMOD:4,454-UNIMOD:4,557-UNIMOD:4	0.03	29.0	3	3	3
PRT	sp|P49916-3|DNLI3_HUMAN	Isoform 3 of DNA ligase 3 OS=Homo sapiens OX=9606 GN=LIG3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null	642-UNIMOD:4	0.05	29.0	5	4	2
PRT	sp|O75487|GPC4_HUMAN	Glypican-4 OS=Homo sapiens OX=9606 GN=GPC4 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null	341-UNIMOD:4	0.08	29.0	5	4	3
PRT	sp|P62633|CNBP_HUMAN	Cellular nucleic acid-binding protein OS=Homo sapiens OX=9606 GN=CNBP PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	29.0	null	140-UNIMOD:385,140-UNIMOD:4,150-UNIMOD:4,161-UNIMOD:385,161-UNIMOD:4,57-UNIMOD:385,57-UNIMOD:4	0.19	29.0	4	3	2
PRT	sp|Q6ZMR3|LDH6A_HUMAN	L-lactate dehydrogenase A-like 6A OS=Homo sapiens OX=9606 GN=LDHAL6A PE=2 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29.0	null	163-UNIMOD:4	0.04	29.0	4	1	0
PRT	sp|P30566|PUR8_HUMAN	Adenylosuccinate lyase OS=Homo sapiens OX=9606 GN=ADSL PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001207, Mascot, ]	29.0	null	2-UNIMOD:1	0.08	29.0	4	3	2
PRT	sp|Q6IBS0|TWF2_HUMAN	Twinfilin-2 OS=Homo sapiens OX=9606 GN=TWF2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001207, Mascot, ]	29.0	null	2-UNIMOD:1,141-UNIMOD:4	0.09	29.0	3	2	1
PRT	sp|Q6P1K2|PMF1_HUMAN	Polyamine-modulated factor 1 OS=Homo sapiens OX=9606 GN=PMF1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	29.0	null	2-UNIMOD:1,13-UNIMOD:4	0.08	29.0	1	1	1
PRT	sp|Q07020-2|RL18_HUMAN	Isoform 2 of 60S ribosomal protein L18 OS=Homo sapiens OX=9606 GN=RPL18	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null		0.16	28.0	5	2	0
PRT	sp|Q7KZ85|SPT6H_HUMAN	Transcription elongation factor SPT6 OS=Homo sapiens OX=9606 GN=SUPT6H PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null		0.01	28.0	2	2	2
PRT	sp|Q5TFE4-2|NT5D1_HUMAN	Isoform 2 of 5'-nucleotidase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=NT5DC1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|Q9H8V3-3|ECT2_HUMAN	Isoform 3 of Protein ECT2 OS=Homo sapiens OX=9606 GN=ECT2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null	221-UNIMOD:4	0.01	28.0	1	1	1
PRT	sp|O43852-2|CALU_HUMAN	Isoform 2 of Calumenin OS=Homo sapiens OX=9606 GN=CALU	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null		0.12	28.0	4	4	4
PRT	sp|Q01082-2|SPTB2_HUMAN	Isoform Short of Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null	112-UNIMOD:4,1900-UNIMOD:4	0.07	28.0	16	14	12
PRT	sp|Q9UHD9|UBQL2_HUMAN	Ubiquilin-2 OS=Homo sapiens OX=9606 GN=UBQLN2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|P13010|XRCC5_HUMAN	X-ray repair cross-complementing protein 5 OS=Homo sapiens OX=9606 GN=XRCC5 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null		0.05	28.0	7	3	1
PRT	sp|P13489|RINI_HUMAN	Ribonuclease inhibitor OS=Homo sapiens OX=9606 GN=RNH1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null	209-UNIMOD:4,216-UNIMOD:4,38-UNIMOD:4	0.05	28.0	2	2	2
PRT	sp|P26639-2|SYTC_HUMAN	Isoform 2 of Threonine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=TARS	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null		0.05	28.0	4	3	2
PRT	sp|P62633-2|CNBP_HUMAN	Isoform 2 of Cellular nucleic acid-binding protein OS=Homo sapiens OX=9606 GN=CNBP	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null	133-UNIMOD:4,143-UNIMOD:4,90-UNIMOD:4,91-UNIMOD:4,94-UNIMOD:4,112-UNIMOD:4,115-UNIMOD:4,151-UNIMOD:4	0.30	28.0	5	4	2
PRT	sp|Q8WU90|ZC3HF_HUMAN	Zinc finger CCCH domain-containing protein 15 OS=Homo sapiens OX=9606 GN=ZC3H15 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null		0.05	28.0	3	2	1
PRT	sp|Q9Y467|SALL2_HUMAN	Sal-like protein 2 OS=Homo sapiens OX=9606 GN=SALL2 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	28.0	null		0.05	28.0	5	4	3
PRT	sp|Q02790|FKBP4_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Homo sapiens OX=9606 GN=FKBP4 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null	396-UNIMOD:4	0.14	28.0	7	5	3
PRT	sp|P27635|RL10_HUMAN	60S ribosomal protein L10 OS=Homo sapiens OX=9606 GN=RPL10 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null	195-UNIMOD:4	0.11	28.0	4	2	1
PRT	sp|P07814|SYEP_HUMAN	Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens OX=9606 GN=EPRS PE=1 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null	336-UNIMOD:4,337-UNIMOD:4,1487-UNIMOD:4,1377-UNIMOD:4	0.10	28.0	16	12	9
PRT	sp|Q16630-2|CPSF6_HUMAN	Isoform 2 of Cleavage and polyadenylation specificity factor subunit 6 OS=Homo sapiens OX=9606 GN=CPSF6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null	159-UNIMOD:4	0.04	28.0	4	2	1
PRT	sp|P36578|RL4_HUMAN	60S ribosomal protein L4 OS=Homo sapiens OX=9606 GN=RPL4 PE=1 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null	96-UNIMOD:4,284-UNIMOD:35	0.08	28.0	8	3	1
PRT	sp|O75964|ATP5L_HUMAN	ATP synthase subunit g, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5MG PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null		0.13	28.0	2	2	2
PRT	sp|Q6FI81-3|CPIN1_HUMAN	Isoform 3 of Anamorsin OS=Homo sapiens OX=9606 GN=CIAPIN1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null		0.05	28.0	1	1	1
PRT	sp|P62495-2|ERF1_HUMAN	Isoform 2 of Eukaryotic peptide chain release factor subunit 1 OS=Homo sapiens OX=9606 GN=ETF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null	302-UNIMOD:4	0.03	28.0	1	1	1
PRT	sp|P35251-2|RFC1_HUMAN	Isoform 2 of Replication factor C subunit 1 OS=Homo sapiens OX=9606 GN=RFC1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null	607-UNIMOD:4	0.01	28.0	1	1	1
PRT	sp|P40938-2|RFC3_HUMAN	Isoform 2 of Replication factor C subunit 3 OS=Homo sapiens OX=9606 GN=RFC3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null		0.10	28.0	2	2	2
PRT	sp|Q93008-1|USP9X_HUMAN	Isoform 2 of Probable ubiquitin carboxyl-terminal hydrolase FAF-X OS=Homo sapiens OX=9606 GN=USP9X	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null	2293-UNIMOD:4,864-UNIMOD:4,540-UNIMOD:4,1908-UNIMOD:4	0.05	28.0	13	11	8
PRT	sp|Q96A65|EXOC4_HUMAN	Exocyst complex component 4 OS=Homo sapiens OX=9606 GN=EXOC4 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|Q13409-2|DC1I2_HUMAN	Isoform 2B of Cytoplasmic dynein 1 intermediate chain 2 OS=Homo sapiens OX=9606 GN=DYNC1I2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null		0.12	28.0	6	5	4
PRT	sp|P48735|IDHP_HUMAN	Isocitrate dehydrogenase [NADP], mitochondrial OS=Homo sapiens OX=9606 GN=IDH2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null	113-UNIMOD:4	0.10	28.0	5	5	5
PRT	sp|P78371|TCPB_HUMAN	T-complex protein 1 subunit beta OS=Homo sapiens OX=9606 GN=CCT2 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null	289-UNIMOD:4	0.09	28.0	7	4	1
PRT	sp|Q01860|PO5F1_HUMAN	POU domain, class 5, transcription factor 1 OS=Homo sapiens OX=9606 GN=POU5F1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null	185-UNIMOD:4	0.07	28.0	4	2	0
PRT	sp|O60664-4|PLIN3_HUMAN	Isoform 4 of Perilipin-3 OS=Homo sapiens OX=9606 GN=PLIN3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|Q00688|FKBP3_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP3 OS=Homo sapiens OX=9606 GN=FKBP3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null		0.05	28.0	4	1	0
PRT	sp|P07237|PDIA1_HUMAN	Protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null	425-UNIMOD:35	0.09	28.0	6	4	3
PRT	sp|P61247|RS3A_HUMAN	40S ribosomal protein S3a OS=Homo sapiens OX=9606 GN=RPS3A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	28.0	null	229-UNIMOD:35	0.13	28.0	8	3	1
PRT	sp|P37108|SRP14_HUMAN	Signal recognition particle 14 kDa protein OS=Homo sapiens OX=9606 GN=SRP14 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null		0.10	28.0	2	2	2
PRT	sp|Q9Y3Y2-3|CHTOP_HUMAN	Isoform 2 of Chromatin target of PRMT1 protein OS=Homo sapiens OX=9606 GN=CHTOP	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null		0.06	28.0	1	1	1
PRT	sp|P49411|EFTU_HUMAN	Elongation factor Tu, mitochondrial OS=Homo sapiens OX=9606 GN=TUFM PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	28.0	null	127-UNIMOD:4,290-UNIMOD:4	0.14	28.0	10	5	1
PRT	sp|P53618|COPB_HUMAN	Coatomer subunit beta OS=Homo sapiens OX=9606 GN=COPB1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null		0.04	28.0	3	3	3
PRT	sp|P25205|MCM3_HUMAN	DNA replication licensing factor MCM3 OS=Homo sapiens OX=9606 GN=MCM3 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null		0.09	28.0	10	7	4
PRT	sp|Q12788|TBL3_HUMAN	Transducin beta-like protein 3 OS=Homo sapiens OX=9606 GN=TBL3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null		0.02	28.0	2	1	0
PRT	sp|Q14247|SRC8_HUMAN	Src substrate cortactin OS=Homo sapiens OX=9606 GN=CTTN PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null		0.15	28.0	7	6	5
PRT	sp|P46060|RAGP1_HUMAN	Ran GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RANGAP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null		0.07	28.0	4	3	2
PRT	sp|Q86XP3|DDX42_HUMAN	ATP-dependent RNA helicase DDX42 OS=Homo sapiens OX=9606 GN=DDX42 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null	339-UNIMOD:4,346-UNIMOD:4	0.04	28.0	3	3	3
PRT	sp|Q7LBC6|KDM3B_HUMAN	Lysine-specific demethylase 3B OS=Homo sapiens OX=9606 GN=KDM3B PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null	937-UNIMOD:4,1451-UNIMOD:4	0.04	28.0	6	6	6
PRT	sp|P51148-2|RAB5C_HUMAN	Isoform 2 of Ras-related protein Rab-5C OS=Homo sapiens OX=9606 GN=RAB5C	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null		0.05	28.0	2	1	0
PRT	sp|P39023|RL3_HUMAN	60S ribosomal protein L3 OS=Homo sapiens OX=9606 GN=RPL3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	28.0	null	114-UNIMOD:4	0.07	28.0	12	3	1
PRT	sp|Q9Y383-3|LC7L2_HUMAN	Isoform 3 of Putative RNA-binding protein Luc7-like 2 OS=Homo sapiens OX=9606 GN=LUC7L2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null		0.09	28.0	3	3	3
PRT	sp|P22570-3|ADRO_HUMAN	Isoform 3 of NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Homo sapiens OX=9606 GN=FDXR	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null		0.02	28.0	2	1	0
PRT	sp|P13667|PDIA4_HUMAN	Protein disulfide-isomerase A4 OS=Homo sapiens OX=9606 GN=PDIA4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	28.0	null		0.15	28.0	15	8	4
PRT	sp|Q9NY93-2|DDX56_HUMAN	Isoform 2 of Probable ATP-dependent RNA helicase DDX56 OS=Homo sapiens OX=9606 GN=DDX56	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null		0.05	28.0	2	2	2
PRT	sp|Q9BSJ8|ESYT1_HUMAN	Extended synaptotagmin-1 OS=Homo sapiens OX=9606 GN=ESYT1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|Q86U86-8|PB1_HUMAN	Isoform 8 of Protein polybromo-1 OS=Homo sapiens OX=9606 GN=PBRM1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null		0.03	28.0	3	3	3
PRT	sp|Q99590|SCAFB_HUMAN	Protein SCAF11 OS=Homo sapiens OX=9606 GN=SCAF11 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null		0.02	28.0	2	2	2
PRT	sp|P83916|CBX1_HUMAN	Chromobox protein homolog 1 OS=Homo sapiens OX=9606 GN=CBX1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null		0.06	28.0	5	1	0
PRT	sp|P19367-3|HXK1_HUMAN	Isoform 3 of Hexokinase-1 OS=Homo sapiens OX=9606 GN=HK1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null		0.01	28.0	3	1	0
PRT	sp|O75368|SH3L1_HUMAN	SH3 domain-binding glutamic acid-rich-like protein OS=Homo sapiens OX=9606 GN=SH3BGRL PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null		0.13	28.0	3	2	1
PRT	sp|P49792|RBP2_HUMAN	E3 SUMO-protein ligase RanBP2 OS=Homo sapiens OX=9606 GN=RANBP2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	28.0	null	815-UNIMOD:4,2696-UNIMOD:385,2696-UNIMOD:4	0.04	28.0	13	9	6
PRT	sp|P62306|RUXF_HUMAN	Small nuclear ribonucleoprotein F OS=Homo sapiens OX=9606 GN=SNRPF PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null		0.16	28.0	3	1	0
PRT	sp|O75381-2|PEX14_HUMAN	Isoform 2 of Peroxisomal membrane protein PEX14 OS=Homo sapiens OX=9606 GN=PEX14	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null		0.10	28.0	1	1	1
PRT	sp|Q9NWH9|SLTM_HUMAN	SAFB-like transcription modulator OS=Homo sapiens OX=9606 GN=SLTM PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null		0.03	28.0	2	2	2
PRT	sp|Q9UFW8|CGBP1_HUMAN	CGG triplet repeat-binding protein 1 OS=Homo sapiens OX=9606 GN=CGGBP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null	92-UNIMOD:4	0.20	28.0	2	2	2
PRT	sp|P40121-2|CAPG_HUMAN	Isoform 2 of Macrophage-capping protein OS=Homo sapiens OX=9606 GN=CAPG	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null		0.08	28.0	3	2	1
PRT	sp|Q9NVX2|NLE1_HUMAN	Notchless protein homolog 1 OS=Homo sapiens OX=9606 GN=NLE1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null	251-UNIMOD:4	0.03	28.0	1	1	1
PRT	sp|P60510|PP4C_HUMAN	Serine/threonine-protein phosphatase 4 catalytic subunit OS=Homo sapiens OX=9606 GN=PPP4C PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null		0.05	28.0	1	1	1
PRT	sp|O95336|6PGL_HUMAN	6-phosphogluconolactonase OS=Homo sapiens OX=9606 GN=PGLS PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null		0.06	28.0	1	1	1
PRT	sp|P28072|PSB6_HUMAN	Proteasome subunit beta type-6 OS=Homo sapiens OX=9606 GN=PSMB6 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null		0.10	28.0	3	2	1
PRT	sp|P12270|TPR_HUMAN	Nucleoprotein TPR OS=Homo sapiens OX=9606 GN=TPR PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	28.0	null	1127-UNIMOD:4	0.03	28.0	11	7	3
PRT	sp|O95071-2|UBR5_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase UBR5 OS=Homo sapiens OX=9606 GN=UBR5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|P25788-2|PSA3_HUMAN	Isoform 2 of Proteasome subunit alpha type-3 OS=Homo sapiens OX=9606 GN=PSMA3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null		0.05	28.0	2	1	0
PRT	sp|O75369-2|FLNB_HUMAN	Isoform 2 of Filamin-B OS=Homo sapiens OX=9606 GN=FLNB	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null	2477-UNIMOD:4,604-UNIMOD:4,2407-UNIMOD:4,1326-UNIMOD:4	0.05	28.0	13	11	9
PRT	sp|P41252|SYIC_HUMAN	Isoleucine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=IARS PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null	120-UNIMOD:4	0.04	28.0	6	4	2
PRT	sp|O60749-2|SNX2_HUMAN	Isoform 2 of Sorting nexin-2 OS=Homo sapiens OX=9606 GN=SNX2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null		0.07	28.0	3	2	1
PRT	sp|Q92616|GCN1_HUMAN	eIF-2-alpha kinase activator GCN1 OS=Homo sapiens OX=9606 GN=GCN1 PE=1 SV=6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null	329-UNIMOD:4	0.04	28.0	8	8	8
PRT	sp|O76003|GLRX3_HUMAN	Glutaredoxin-3 OS=Homo sapiens OX=9606 GN=GLRX3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null		0.04	28.0	2	1	0
PRT	sp|Q9UQE7|SMC3_HUMAN	Structural maintenance of chromosomes protein 3 OS=Homo sapiens OX=9606 GN=SMC3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null	972-UNIMOD:4	0.09	28.0	10	9	8
PRT	sp|Q6P996-5|PDXD1_HUMAN	Isoform 5 of Pyridoxal-dependent decarboxylase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PDXDC1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null		0.03	28.0	2	1	0
PRT	sp|Q8TC12|RDH11_HUMAN	Retinol dehydrogenase 11 OS=Homo sapiens OX=9606 GN=RDH11 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null		0.13	28.0	5	3	1
PRT	sp|P50914|RL14_HUMAN	60S ribosomal protein L14 OS=Homo sapiens OX=9606 GN=RPL14 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	28.0	null	42-UNIMOD:4	0.06	28.0	4	1	0
PRT	sp|P60660-2|MYL6_HUMAN	Isoform Smooth muscle of Myosin light polypeptide 6 OS=Homo sapiens OX=9606 GN=MYL6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null		0.15	28.0	5	2	0
PRT	sp|Q9H4I3|TRABD_HUMAN	TraB domain-containing protein OS=Homo sapiens OX=9606 GN=TRABD PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|P18858-3|DNLI1_HUMAN	Isoform 3 of DNA ligase 1 OS=Homo sapiens OX=9606 GN=LIG1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null	249-UNIMOD:4	0.05	28.0	3	3	3
PRT	sp|Q6NUK1-2|SCMC1_HUMAN	Isoform 2 of Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Homo sapiens OX=9606 GN=SLC25A24	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null	311-UNIMOD:4	0.03	28.0	2	1	0
PRT	sp|Q8NFC6|BD1L1_HUMAN	Biorientation of chromosomes in cell division protein 1-like 1 OS=Homo sapiens OX=9606 GN=BOD1L1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null		0.01	28.0	2	2	2
PRT	sp|Q13153-2|PAK1_HUMAN	Isoform 2 of Serine/threonine-protein kinase PAK 1 OS=Homo sapiens OX=9606 GN=PAK1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null		0.03	28.0	2	1	0
PRT	sp|Q16181-2|SEPT7_HUMAN	Isoform 2 of Septin-7 OS=Homo sapiens OX=9606 GN=SEPT7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null	203-UNIMOD:4	0.10	28.0	4	3	1
PRT	sp|Q0VF96|CGNL1_HUMAN	Cingulin-like protein 1 OS=Homo sapiens OX=9606 GN=CGNL1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null	219-UNIMOD:4	0.03	28.0	3	3	3
PRT	sp|P54920|SNAA_HUMAN	Alpha-soluble NSF attachment protein OS=Homo sapiens OX=9606 GN=NAPA PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null		0.08	28.0	4	2	1
PRT	sp|P49591|SYSC_HUMAN	Serine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=SARS PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	28.0	null	395-UNIMOD:4,398-UNIMOD:4	0.06	28.0	2	2	2
PRT	sp|P00738|HPT_HUMAN	Haptoglobin OS=Homo sapiens OX=9606 GN=HP PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null	145-UNIMOD:4,149-UNIMOD:4	0.08	28.0	6	4	3
PRT	sp|Q9NY33-4|DPP3_HUMAN	Isoform 4 of Dipeptidyl peptidase 3 OS=Homo sapiens OX=9606 GN=DPP3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null		0.02	28.0	3	1	0
PRT	sp|Q03701|CEBPZ_HUMAN	CCAAT/enhancer-binding protein zeta OS=Homo sapiens OX=9606 GN=CEBPZ PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null		0.03	28.0	2	2	2
PRT	sp|Q9Y450|HBS1L_HUMAN	HBS1-like protein OS=Homo sapiens OX=9606 GN=HBS1L PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null		0.05	28.0	2	2	2
PRT	sp|Q15149|PLEC_HUMAN	Plectin OS=Homo sapiens OX=9606 GN=PLEC PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	28.0	null		0.02	28.0	7	7	7
PRT	sp|Q99439|CNN2_HUMAN	Calponin-2 OS=Homo sapiens OX=9606 GN=CNN2 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null	175-UNIMOD:4,215-UNIMOD:4	0.09	28.0	3	2	1
PRT	sp|Q9BZK7|TBL1R_HUMAN	F-box-like/WD repeat-containing protein TBL1XR1 OS=Homo sapiens OX=9606 GN=TBL1XR1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null		0.05	28.0	2	2	2
PRT	sp|P62070-4|RRAS2_HUMAN	Isoform 4 of Ras-related protein R-Ras2 OS=Homo sapiens OX=9606 GN=RRAS2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null		0.06	28.0	2	1	0
PRT	sp|P63208|SKP1_HUMAN	S-phase kinase-associated protein 1 OS=Homo sapiens OX=9606 GN=SKP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null	62-UNIMOD:4	0.22	28.0	2	2	2
PRT	sp|P63220|RS21_HUMAN	40S ribosomal protein S21 OS=Homo sapiens OX=9606 GN=RPS21 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	28.0	null	34-UNIMOD:35,62-UNIMOD:35	0.33	28.0	5	3	2
PRT	sp|Q14152|EIF3A_HUMAN	Eukaryotic translation initiation factor 3 subunit A OS=Homo sapiens OX=9606 GN=EIF3A PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001207, Mascot, ]	28.0	null	78-UNIMOD:4	0.07	28.0	11	9	7
PRT	sp|Q8NC51|PAIRB_HUMAN	Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28.0	null		0.12	28.0	3	3	1
PRT	sp|P22626|ROA2_HUMAN	Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	28.0	null	50-UNIMOD:4,191-UNIMOD:28	0.11	28.0	6	3	0
PRT	sp|Q9Y2Z0|SGT1_HUMAN	Protein SGT1 homolog OS=Homo sapiens OX=9606 GN=SUGT1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	28.0	null	154-UNIMOD:4,2-UNIMOD:1	0.09	28.0	2	2	1
PRT	sp|Q15029|U5S1_HUMAN	116 kDa U5 small nuclear ribonucleoprotein component OS=Homo sapiens OX=9606 GN=EFTUD2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28.0	null		0.01	28.0	1	1	0
PRT	sp|Q9BQ39|DDX50_HUMAN	ATP-dependent RNA helicase DDX50 OS=Homo sapiens OX=9606 GN=DDX50 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	28.0	null	413-UNIMOD:28,417-UNIMOD:4	0.08	28.0	6	5	4
PRT	sp|O94888|UBXN7_HUMAN	UBX domain-containing protein 7 OS=Homo sapiens OX=9606 GN=UBXN7 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001207, Mascot, ]	28.0	null	2-UNIMOD:1	0.06	28.0	3	2	1
PRT	sp|P17302|CXA1_HUMAN	Gap junction alpha-1 protein OS=Homo sapiens OX=9606 GN=GJA1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001207, Mascot, ]	28.0	null	54-UNIMOD:385,54-UNIMOD:4,61-UNIMOD:4,65-UNIMOD:4	0.08	28.0	5	2	0
PRT	sp|P21796|VDAC1_HUMAN	Voltage-dependent anion-selective channel protein 1 OS=Homo sapiens OX=9606 GN=VDAC1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001207, Mascot, ]	28.0	null		0.13	28.0	2	2	2
PRT	sp|Q9Y265|RUVB1_HUMAN	RuvB-like 1 OS=Homo sapiens OX=9606 GN=RUVBL1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001207, Mascot, ]	28.0	null	34-UNIMOD:28	0.03	28.0	2	1	0
PRT	sp|Q9P2R3|ANFY1_HUMAN	Rabankyrin-5 OS=Homo sapiens OX=9606 GN=ANKFY1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28.0	null	460-UNIMOD:4	0.02	28.0	1	1	1
PRT	sp|P34897-2|GLYM_HUMAN	Isoform 2 of Serine hydroxymethyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=SHMT2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null	231-UNIMOD:4	0.06	27.0	5	3	2
PRT	sp|Q15369-2|ELOC_HUMAN	Isoform 2 of Elongin-C OS=Homo sapiens OX=9606 GN=ELOC	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.13	27.0	1	1	1
PRT	sp|O15042-2|SR140_HUMAN	Isoform 2 of U2 snRNP-associated SURP motif-containing protein OS=Homo sapiens OX=9606 GN=U2SURP	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.04	27.0	3	3	3
PRT	sp|O14908|GIPC1_HUMAN	PDZ domain-containing protein GIPC1 OS=Homo sapiens OX=9606 GN=GIPC1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.10	27.0	2	2	2
PRT	sp|P04424-3|ARLY_HUMAN	Isoform 3 of Argininosuccinate lyase OS=Homo sapiens OX=9606 GN=ASL	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|Q96SQ9-2|CP2S1_HUMAN	Isoform 2 of Cytochrome P450 2S1 OS=Homo sapiens OX=9606 GN=CYP2S1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.03	27.0	1	1	0
PRT	sp|P24752|THIL_HUMAN	Acetyl-CoA acetyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=ACAT1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null	196-UNIMOD:4	0.03	27.0	1	1	1
PRT	sp|Q96T37-3|RBM15_HUMAN	Isoform 3 of RNA-binding protein 15 OS=Homo sapiens OX=9606 GN=RBM15	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.04	27.0	2	2	2
PRT	sp|O14617-2|AP3D1_HUMAN	Isoform 2 of AP-3 complex subunit delta-1 OS=Homo sapiens OX=9606 GN=AP3D1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|Q53EL6-2|PDCD4_HUMAN	Isoform 2 of Programmed cell death protein 4 OS=Homo sapiens OX=9606 GN=PDCD4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.06	27.0	2	2	2
PRT	sp|Q9UJA5|TRM6_HUMAN	tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6 OS=Homo sapiens OX=9606 GN=TRMT6 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.06	27.0	2	2	2
PRT	sp|Q9Y305-4|ACOT9_HUMAN	Isoform 4 of Acyl-coenzyme A thioesterase 9, mitochondrial OS=Homo sapiens OX=9606 GN=ACOT9	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|P28074|PSB5_HUMAN	Proteasome subunit beta type-5 OS=Homo sapiens OX=9606 GN=PSMB5 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.09	27.0	2	2	2
PRT	sp|Q1KMD3|HNRL2_HUMAN	Heterogeneous nuclear ribonucleoprotein U-like protein 2 OS=Homo sapiens OX=9606 GN=HNRNPUL2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|P62380|TBPL1_HUMAN	TATA box-binding protein-like protein 1 OS=Homo sapiens OX=9606 GN=TBPL1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null	68-UNIMOD:4	0.08	27.0	1	1	1
PRT	sp|Q9UNX3|RL26L_HUMAN	60S ribosomal protein L26-like 1 OS=Homo sapiens OX=9606 GN=RPL26L1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	27.0	null		0.17	27.0	5	2	1
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null	564-UNIMOD:4	0.07	27.0	12	5	3
PRT	sp|P31946-2|1433B_HUMAN	Isoform Short of 14-3-3 protein beta/alpha OS=Homo sapiens OX=9606 GN=YWHAB	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.11	27.0	3	2	1
PRT	sp|Q9HC38-2|GLOD4_HUMAN	Isoform 2 of Glyoxalase domain-containing protein 4 OS=Homo sapiens OX=9606 GN=GLOD4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.04	27.0	1	1	1
PRT	sp|P31948|STIP1_HUMAN	Stress-induced-phosphoprotein 1 OS=Homo sapiens OX=9606 GN=STIP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null	461-UNIMOD:4	0.10	27.0	10	5	3
PRT	sp|Q9NX63|MIC19_HUMAN	MICOS complex subunit MIC19 OS=Homo sapiens OX=9606 GN=CHCHD3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1000663, ProteinPilot, ]	27.0	null	183-UNIMOD:4	0.11	27.0	3	2	1
PRT	sp|Q96BK5|PINX1_HUMAN	PIN2/TERF1-interacting telomerase inhibitor 1 OS=Homo sapiens OX=9606 GN=PINX1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.05	27.0	1	1	1
PRT	sp|P27694|RFA1_HUMAN	Replication protein A 70 kDa DNA-binding subunit OS=Homo sapiens OX=9606 GN=RPA1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.08	27.0	6	5	4
PRT	sp|Q14192|FHL2_HUMAN	Four and a half LIM domains protein 2 OS=Homo sapiens OX=9606 GN=FHL2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null	185-UNIMOD:4,188-UNIMOD:4,191-UNIMOD:4	0.12	27.0	3	3	3
PRT	sp|P27708|PYR1_HUMAN	CAD protein OS=Homo sapiens OX=9606 GN=CAD PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null	280-UNIMOD:4,1613-UNIMOD:4	0.05	27.0	11	9	7
PRT	sp|Q10567-2|AP1B1_HUMAN	Isoform B of AP-1 complex subunit beta-1 OS=Homo sapiens OX=9606 GN=AP1B1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null	859-UNIMOD:4	0.01	27.0	1	1	1
PRT	sp|Q5VTE0|EF1A3_HUMAN	Putative elongation factor 1-alpha-like 3 OS=Homo sapiens OX=9606 GN=EEF1A1P5 PE=5 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null	155-UNIMOD:35	0.09	27.0	10	4	0
PRT	sp|P60891|PRPS1_HUMAN	Ribose-phosphate pyrophosphokinase 1 OS=Homo sapiens OX=9606 GN=PRPS1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null	165-UNIMOD:4	0.09	27.0	6	2	0
PRT	sp|P84090|ERH_HUMAN	Enhancer of rudimentary homolog OS=Homo sapiens OX=9606 GN=ERH PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.12	27.0	2	1	0
PRT	sp|Q56VL3|OCAD2_HUMAN	OCIA domain-containing protein 2 OS=Homo sapiens OX=9606 GN=OCIAD2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null	130-UNIMOD:4,134-UNIMOD:4,137-UNIMOD:4,106-UNIMOD:4	0.14	27.0	2	2	2
PRT	sp|Q8IX90-3|SKA3_HUMAN	Isoform 3 of Spindle and kinetochore-associated protein 3 OS=Homo sapiens OX=9606 GN=SKA3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.04	27.0	1	1	1
PRT	sp|Q92621|NU205_HUMAN	Nuclear pore complex protein Nup205 OS=Homo sapiens OX=9606 GN=NUP205 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.02	27.0	4	4	4
PRT	sp|P20290|BTF3_HUMAN	Transcription factor BTF3 OS=Homo sapiens OX=9606 GN=BTF3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null	22-UNIMOD:4	0.08	27.0	2	1	0
PRT	sp|Q9NRZ9-2|HELLS_HUMAN	Isoform 2 of Lymphoid-specific helicase OS=Homo sapiens OX=9606 GN=HELLS	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.07	27.0	5	5	5
PRT	sp|Q15365|PCBP1_HUMAN	Poly(rC)-binding protein 1 OS=Homo sapiens OX=9606 GN=PCBP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null	54-UNIMOD:4	0.10	27.0	13	3	0
PRT	sp|P55809|SCOT1_HUMAN	Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial OS=Homo sapiens OX=9606 GN=OXCT1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null	504-UNIMOD:4	0.05	27.0	2	2	2
PRT	sp|P15311|EZRI_HUMAN	Ezrin OS=Homo sapiens OX=9606 GN=EZR PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.06	27.0	4	4	4
PRT	sp|P61011|SRP54_HUMAN	Signal recognition particle 54 kDa protein OS=Homo sapiens OX=9606 GN=SRP54 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.04	27.0	4	2	0
PRT	sp|P30626-2|SORCN_HUMAN	Isoform 2 of Sorcin OS=Homo sapiens OX=9606 GN=SRI	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.13	27.0	7	2	0
PRT	sp|P61088|UBE2N_HUMAN	Ubiquitin-conjugating enzyme E2 N OS=Homo sapiens OX=9606 GN=UBE2N PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.08	27.0	3	1	0
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	27.0	null		0.09	27.0	15	7	4
PRT	sp|P29401-2|TKT_HUMAN	Isoform 2 of Transketolase OS=Homo sapiens OX=9606 GN=TKT	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.10	27.0	29	6	3
PRT	sp|O60264|SMCA5_HUMAN	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Homo sapiens OX=9606 GN=SMARCA5 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null	891-UNIMOD:4	0.09	27.0	12	8	4
PRT	sp|O14672|ADA10_HUMAN	Disintegrin and metalloproteinase domain-containing protein 10 OS=Homo sapiens OX=9606 GN=ADAM10 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	27.0	null	580-UNIMOD:4,582-UNIMOD:4	0.04	27.0	2	2	2
PRT	sp|P28340|DPOD1_HUMAN	DNA polymerase delta catalytic subunit OS=Homo sapiens OX=9606 GN=POLD1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.02	27.0	2	2	2
PRT	sp|Q01970-2|PLCB3_HUMAN	Isoform 2 of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3 OS=Homo sapiens OX=9606 GN=PLCB3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null	126-UNIMOD:4	0.04	27.0	3	3	3
PRT	sp|P62841|RS15_HUMAN	40S ribosomal protein S15 OS=Homo sapiens OX=9606 GN=RPS15 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	27.0	null		0.19	27.0	6	2	0
PRT	sp|O75533|SF3B1_HUMAN	Splicing factor 3B subunit 1 OS=Homo sapiens OX=9606 GN=SF3B1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	27.0	null		0.08	27.0	11	7	3
PRT	sp|Q15637-3|SF01_HUMAN	Isoform 3 of Splicing factor 1 OS=Homo sapiens OX=9606 GN=SF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null	279-UNIMOD:4	0.10	27.0	8	5	3
PRT	sp|Q9NX46|ARHL2_HUMAN	Poly(ADP-ribose) glycohydrolase ARH3 OS=Homo sapiens OX=9606 GN=ADPRHL2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.05	27.0	1	1	1
PRT	sp|Q7Z460|CLAP1_HUMAN	CLIP-associating protein 1 OS=Homo sapiens OX=9606 GN=CLASP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|Q9NZ01|TECR_HUMAN	Very-long-chain enoyl-CoA reductase OS=Homo sapiens OX=9606 GN=TECR PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.07	27.0	4	2	0
PRT	sp|Q9Y6E2|BZW2_HUMAN	Basic leucine zipper and W2 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=BZW2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|Q8TCS8|PNPT1_HUMAN	Polyribonucleotide nucleotidyltransferase 1, mitochondrial OS=Homo sapiens OX=9606 GN=PNPT1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	27.0	null		0.03	27.0	2	2	2
PRT	sp|Q06210|GFPT1_HUMAN	Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 OS=Homo sapiens OX=9606 GN=GFPT1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1001476, X!Tandem, ]	27.0	null	638-UNIMOD:4,631-UNIMOD:28	0.06	27.0	5	4	3
PRT	sp|P25398|RS12_HUMAN	40S ribosomal protein S12 OS=Homo sapiens OX=9606 GN=RPS12 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null	106-UNIMOD:4,108-UNIMOD:4	0.17	27.0	11	3	1
PRT	sp|P07858|CATB_HUMAN	Cathepsin B OS=Homo sapiens OX=9606 GN=CTSB PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null	211-UNIMOD:4	0.08	27.0	2	2	2
PRT	sp|P48681|NEST_HUMAN	Nestin OS=Homo sapiens OX=9606 GN=NES PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	27.0	null		0.07	27.0	10	9	8
PRT	sp|Q9Y5A9-2|YTHD2_HUMAN	Isoform 2 of YTH domain-containing family protein 2 OS=Homo sapiens OX=9606 GN=YTHDF2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.04	27.0	3	2	1
PRT	sp|P84103|SRSF3_HUMAN	Serine/arginine-rich splicing factor 3 OS=Homo sapiens OX=9606 GN=SRSF3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.15	27.0	3	2	1
PRT	sp|P61758|PFD3_HUMAN	Prefoldin subunit 3 OS=Homo sapiens OX=9606 GN=VBP1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.07	27.0	1	1	1
PRT	sp|Q5RKV6|EXOS6_HUMAN	Exosome complex component MTR3 OS=Homo sapiens OX=9606 GN=EXOSC6 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.14	27.0	4	3	2
PRT	sp|O00299|CLIC1_HUMAN	Chloride intracellular channel protein 1 OS=Homo sapiens OX=9606 GN=CLIC1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	27.0	null	191-UNIMOD:4,24-UNIMOD:4	0.17	27.0	6	4	3
PRT	sp|Q5QJE6|TDIF2_HUMAN	Deoxynucleotidyltransferase terminal-interacting protein 2 OS=Homo sapiens OX=9606 GN=DNTTIP2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.07	27.0	3	3	3
PRT	sp|P52209-2|6PGD_HUMAN	Isoform 2 of 6-phosphogluconate dehydrogenase, decarboxylating OS=Homo sapiens OX=9606 GN=PGD	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null	389-UNIMOD:4	0.03	27.0	3	1	0
PRT	sp|Q9UHB6-4|LIMA1_HUMAN	Isoform 4 of LIM domain and actin-binding protein 1 OS=Homo sapiens OX=9606 GN=LIMA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.03	27.0	2	2	2
PRT	sp|Q04726-2|TLE3_HUMAN	Isoform 2 of Transducin-like enhancer protein 3 OS=Homo sapiens OX=9606 GN=TLE3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|Q7Z2T5|TRM1L_HUMAN	TRMT1-like protein OS=Homo sapiens OX=9606 GN=TRMT1L PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.04	27.0	3	2	1
PRT	sp|Q6P2Q9|PRP8_HUMAN	Pre-mRNA-processing-splicing factor 8 OS=Homo sapiens OX=9606 GN=PRPF8 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	27.0	null		0.02	27.0	7	4	2
PRT	sp|Q5VZL5-4|ZMYM4_HUMAN	Isoform 4 of Zinc finger MYM-type protein 4 OS=Homo sapiens OX=9606 GN=ZMYM4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|Q96MF7|NSE2_HUMAN	E3 SUMO-protein ligase NSE2 OS=Homo sapiens OX=9606 GN=NSMCE2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null	185-UNIMOD:4	0.06	27.0	1	1	1
PRT	sp|P61289-2|PSME3_HUMAN	Isoform 2 of Proteasome activator complex subunit 3 OS=Homo sapiens OX=9606 GN=PSME3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null	92-UNIMOD:4	0.05	27.0	3	2	1
PRT	sp|O00170|AIP_HUMAN	AH receptor-interacting protein OS=Homo sapiens OX=9606 GN=AIP PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.05	27.0	1	1	1
PRT	sp|O43175|SERA_HUMAN	D-3-phosphoglycerate dehydrogenase OS=Homo sapiens OX=9606 GN=PHGDH PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.08	27.0	9	4	1
PRT	sp|Q16629-4|SRSF7_HUMAN	Isoform 4 of Serine/arginine-rich splicing factor 7 OS=Homo sapiens OX=9606 GN=SRSF7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null	119-UNIMOD:4	0.14	27.0	5	3	2
PRT	sp|Q14677-2|EPN4_HUMAN	Isoform 2 of Clathrin interactor 1 OS=Homo sapiens OX=9606 GN=CLINT1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.06	27.0	5	3	1
PRT	sp|P36542-2|ATPG_HUMAN	Isoform Heart of ATP synthase subunit gamma, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1C	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null	103-UNIMOD:4	0.12	27.0	5	3	2
PRT	sp|Q14444-2|CAPR1_HUMAN	Isoform 2 of Caprin-1 OS=Homo sapiens OX=9606 GN=CAPRIN1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.03	27.0	5	2	1
PRT	sp|Q9H3N1|TMX1_HUMAN	Thioredoxin-related transmembrane protein 1 OS=Homo sapiens OX=9606 GN=TMX1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.13	27.0	6	3	1
PRT	sp|P31937|3HIDH_HUMAN	3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=HIBADH PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.04	27.0	1	1	1
PRT	sp|O43390-2|HNRPR_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein R OS=Homo sapiens OX=9606 GN=HNRNPR	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null	226-UNIMOD:4	0.02	27.0	3	1	0
PRT	sp|Q9NRF8|PYRG2_HUMAN	CTP synthase 2 OS=Homo sapiens OX=9606 GN=CTPS2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.05	27.0	2	2	2
PRT	sp|Q9NYF8-2|BCLF1_HUMAN	Isoform 2 of Bcl-2-associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.06	27.0	6	4	2
PRT	sp|P18621-3|RL17_HUMAN	Isoform 3 of 60S ribosomal protein L17 OS=Homo sapiens OX=9606 GN=RPL17	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.07	27.0	4	1	0
PRT	sp|Q14061|COX17_HUMAN	Cytochrome c oxidase copper chaperone OS=Homo sapiens OX=9606 GN=COX17 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.27	27.0	2	1	0
PRT	sp|Q14696|MESD_HUMAN	LRP chaperone MESD OS=Homo sapiens OX=9606 GN=MESD PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.06	27.0	3	1	0
PRT	sp|P16402|H13_HUMAN	Histone H1.3 OS=Homo sapiens OX=9606 GN=HIST1H1D PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.11	27.0	10	3	0
PRT	sp|P09661|RU2A_HUMAN	U2 small nuclear ribonucleoprotein A' OS=Homo sapiens OX=9606 GN=SNRPA1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	27.0	null		0.05	27.0	4	2	0
PRT	sp|P40926|MDHM_HUMAN	Malate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=MDH2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.07	27.0	5	2	1
PRT	sp|Q15717-2|ELAV1_HUMAN	Isoform 2 of ELAV-like protein 1 OS=Homo sapiens OX=9606 GN=ELAVL1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.07	27.0	5	2	0
PRT	sp|Q15293|RCN1_HUMAN	Reticulocalbin-1 OS=Homo sapiens OX=9606 GN=RCN1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.07	27.0	3	2	1
PRT	sp|Q9HB90|RRAGC_HUMAN	Ras-related GTP-binding protein C OS=Homo sapiens OX=9606 GN=RRAGC PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|P42677|RS27_HUMAN	40S ribosomal protein S27 OS=Homo sapiens OX=9606 GN=RPS27 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	27.0	null		0.14	27.0	3	1	0
PRT	sp|P21108|PRPS3_HUMAN	Ribose-phosphate pyrophosphokinase 3 OS=Homo sapiens OX=9606 GN=PRPS1L1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null	165-UNIMOD:4	0.04	27.0	2	1	0
PRT	sp|P35250-2|RFC2_HUMAN	Isoform 2 of Replication factor C subunit 2 OS=Homo sapiens OX=9606 GN=RFC2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null	221-UNIMOD:4,137-UNIMOD:4	0.12	27.0	18	3	1
PRT	sp|Q00325-2|MPCP_HUMAN	Isoform B of Phosphate carrier protein, mitochondrial OS=Homo sapiens OX=9606 GN=SLC25A3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.04	27.0	8	1	0
PRT	sp|Q96I25|SPF45_HUMAN	Splicing factor 45 OS=Homo sapiens OX=9606 GN=RBM17 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.08	27.0	3	3	3
PRT	sp|O43765|SGTA_HUMAN	Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Homo sapiens OX=9606 GN=SGTA PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null	148-UNIMOD:4	0.12	27.0	4	3	2
PRT	sp|P46087-4|NOP2_HUMAN	Isoform 4 of Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase OS=Homo sapiens OX=9606 GN=NOP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.04	27.0	2	2	2
PRT	sp|P63244|RACK1_HUMAN	Receptor of activated protein C kinase 1 OS=Homo sapiens OX=9606 GN=RACK1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	27.0	null		0.04	27.0	4	2	1
PRT	sp|O00410-3|IPO5_HUMAN	Isoform 3 of Importin-5 OS=Homo sapiens OX=9606 GN=IPO5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null	284-UNIMOD:4	0.03	27.0	4	3	2
PRT	sp|Q9NQ29|LUC7L_HUMAN	Putative RNA-binding protein Luc7-like 1 OS=Homo sapiens OX=9606 GN=LUC7L PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.04	27.0	1	1	1
PRT	sp|Q86V48|LUZP1_HUMAN	Leucine zipper protein 1 OS=Homo sapiens OX=9606 GN=LUZP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.04	27.0	3	3	3
PRT	sp|Q8TED0|UTP15_HUMAN	U3 small nucleolar RNA-associated protein 15 homolog OS=Homo sapiens OX=9606 GN=UTP15 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|Q9UNZ2-5|NSF1C_HUMAN	Isoform 3 of NSFL1 cofactor p47 OS=Homo sapiens OX=9606 GN=NSFL1C	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.10	27.0	3	3	3
PRT	sp|O14646-2|CHD1_HUMAN	Isoform 2 of Chromodomain-helicase-DNA-binding protein 1 OS=Homo sapiens OX=9606 GN=CHD1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|O75688-2|PPM1B_HUMAN	Isoform Beta-2 of Protein phosphatase 1B OS=Homo sapiens OX=9606 GN=PPM1B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null	163-UNIMOD:4,172-UNIMOD:4	0.05	27.0	1	1	1
PRT	sp|P35269|T2FA_HUMAN	General transcription factor IIF subunit 1 OS=Homo sapiens OX=9606 GN=GTF2F1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.04	27.0	1	1	1
PRT	sp|O00411|RPOM_HUMAN	DNA-directed RNA polymerase, mitochondrial OS=Homo sapiens OX=9606 GN=POLRMT PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|P35613-3|BASI_HUMAN	Isoform 3 of Basigin OS=Homo sapiens OX=9606 GN=BSG	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null	30-UNIMOD:35,33-UNIMOD:4	0.10	27.0	1	1	1
PRT	sp|P52272|HNRPM_HUMAN	Heterogeneous nuclear ribonucleoprotein M OS=Homo sapiens OX=9606 GN=HNRNPM PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	27.0	null	389-UNIMOD:28	0.05	27.0	3	2	0
PRT	sp|O00571|DDX3X_HUMAN	ATP-dependent RNA helicase DDX3X OS=Homo sapiens OX=9606 GN=DDX3X PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001207, Mascot, ]	27.0	null	604-UNIMOD:28,317-UNIMOD:4	0.07	27.0	5	4	3
PRT	sp|O75534|CSDE1_HUMAN	Cold shock domain-containing protein E1 OS=Homo sapiens OX=9606 GN=CSDE1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	27.0	null	497-UNIMOD:28,506-UNIMOD:4	0.02	27.0	2	1	0
PRT	sp|P14314|GLU2B_HUMAN	Glucosidase 2 subunit beta OS=Homo sapiens OX=9606 GN=PRKCSH PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27.0	null	471-UNIMOD:4	0.03	27.0	1	1	0
PRT	sp|O60763|USO1_HUMAN	General vesicular transport factor p115 OS=Homo sapiens OX=9606 GN=USO1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27.0	null		0.02	27.0	1	1	0
PRT	sp|P49916|DNLI3_HUMAN	DNA ligase 3 OS=Homo sapiens OX=9606 GN=LIG3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	27.0	null	729-UNIMOD:385,729-UNIMOD:4	0.01	27.0	1	1	0
PRT	sp|Q15020|SART3_HUMAN	Squamous cell carcinoma antigen recognized by T-cells 3 OS=Homo sapiens OX=9606 GN=SART3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	27.0	null	2-UNIMOD:1	0.02	27.0	1	1	1
PRT	sp|P29144|TPP2_HUMAN	Tripeptidyl-peptidase 2 OS=Homo sapiens OX=9606 GN=TPP2 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001207, Mascot, ]	27.0	null	209-UNIMOD:4	0.04	27.0	3	3	3
PRT	sp|Q9BUJ2|HNRL1_HUMAN	Heterogeneous nuclear ribonucleoprotein U-like protein 1 OS=Homo sapiens OX=9606 GN=HNRNPUL1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27.0	null		0.02	27.0	1	1	0
PRT	sp|Q7Z4H3|HDDC2_HUMAN	HD domain-containing protein 2 OS=Homo sapiens OX=9606 GN=HDDC2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	27.0	null	2-UNIMOD:1	0.07	27.0	1	1	1
PRT	sp|Q58FF8|H90B2_HUMAN	Putative heat shock protein HSP 90-beta 2 OS=Homo sapiens OX=9606 GN=HSP90AB2P PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27.0	null		0.03	27.0	1	1	0
PRT	sp|P36957|ODO2_HUMAN	Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial OS=Homo sapiens OX=9606 GN=DLST PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|Q9Y5J1|UTP18_HUMAN	U3 small nucleolar RNA-associated protein 18 homolog OS=Homo sapiens OX=9606 GN=UTP18 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|Q9NRN7|ADPPT_HUMAN	L-aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase OS=Homo sapiens OX=9606 GN=AASDHPPT PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.05	26.0	1	1	1
PRT	sp|Q96SU4-2|OSBL9_HUMAN	Isoform 2 of Oxysterol-binding protein-related protein 9 OS=Homo sapiens OX=9606 GN=OSBPL9	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|O75694-2|NU155_HUMAN	Isoform 2 of Nuclear pore complex protein Nup155 OS=Homo sapiens OX=9606 GN=NUP155	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|P60468|SC61B_HUMAN	Protein transport protein Sec61 subunit beta OS=Homo sapiens OX=9606 GN=SEC61B PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.17	26.0	3	1	0
PRT	sp|Q86UP2-4|KTN1_HUMAN	Isoform 4 of Kinectin OS=Homo sapiens OX=9606 GN=KTN1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.06	26.0	6	6	6
PRT	sp|Q00839-2|HNRPU_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null	370-UNIMOD:4,372-UNIMOD:4,588-UNIMOD:4	0.08	26.0	18	6	3
PRT	sp|Q9BZE4|NOG1_HUMAN	Nucleolar GTP-binding protein 1 OS=Homo sapiens OX=9606 GN=GTPBP4 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.03	26.0	2	2	2
PRT	sp|P07737|PROF1_HUMAN	Profilin-1 OS=Homo sapiens OX=9606 GN=PFN1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1001476, X!Tandem, ]	26.0	null	128-UNIMOD:4,117-UNIMOD:27	0.15	26.0	6	2	0
PRT	sp|Q96T76-8|MMS19_HUMAN	Isoform 5 of MMS19 nucleotide excision repair protein homolog OS=Homo sapiens OX=9606 GN=MMS19	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|P35232|PHB_HUMAN	Prohibitin OS=Homo sapiens OX=9606 GN=PHB PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.15	26.0	6	4	2
PRT	sp|P84098|RL19_HUMAN	60S ribosomal protein L19 OS=Homo sapiens OX=9606 GN=RPL19 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.15	26.0	6	4	2
PRT	sp|P50579-2|MAP2_HUMAN	Isoform 2 of Methionine aminopeptidase 2 OS=Homo sapiens OX=9606 GN=METAP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.05	26.0	2	2	2
PRT	sp|Q15185-3|TEBP_HUMAN	Isoform 3 of Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.08	26.0	2	1	0
PRT	sp|Q9HAV0|GBB4_HUMAN	Guanine nucleotide-binding protein subunit beta-4 OS=Homo sapiens OX=9606 GN=GNB4 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null	204-UNIMOD:4,148-UNIMOD:4,149-UNIMOD:4	0.08	26.0	4	2	1
PRT	sp|O15145|ARPC3_HUMAN	Actin-related protein 2/3 complex subunit 3 OS=Homo sapiens OX=9606 GN=ARPC3 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.21	26.0	4	3	2
PRT	sp|P17980|PRS6A_HUMAN	26S proteasome regulatory subunit 6A OS=Homo sapiens OX=9606 GN=PSMC3 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null	387-UNIMOD:4,396-UNIMOD:4	0.05	26.0	2	2	2
PRT	sp|Q9H307|PININ_HUMAN	Pinin OS=Homo sapiens OX=9606 GN=PNN PE=1 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	26.0	null		0.10	26.0	10	7	5
PRT	sp|Q99729-2|ROAA_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A/B OS=Homo sapiens OX=9606 GN=HNRNPAB	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.04	26.0	2	1	0
PRT	sp|P02787|TRFE_HUMAN	Serotransferrin OS=Homo sapiens OX=9606 GN=TF PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null	350-UNIMOD:4,358-UNIMOD:4,260-UNIMOD:4	0.05	26.0	4	2	1
PRT	sp|Q92552-2|RT27_HUMAN	Isoform 2 of 28S ribosomal protein S27, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS27	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.08	26.0	2	2	2
PRT	sp|Q15046-2|SYK_HUMAN	Isoform Mitochondrial of Lysine--tRNA ligase OS=Homo sapiens OX=9606 GN=KARS	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.02	26.0	2	2	2
PRT	sp|P62269|RS18_HUMAN	40S ribosomal protein S18 OS=Homo sapiens OX=9606 GN=RPS18 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.15	26.0	9	3	1
PRT	sp|P48634|PRC2A_HUMAN	Protein PRRC2A OS=Homo sapiens OX=9606 GN=PRRC2A PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|P04899-5|GNAI2_HUMAN	Isoform 5 of Guanine nucleotide-binding protein G(i) subunit alpha-2 OS=Homo sapiens OX=9606 GN=GNAI2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null	50-UNIMOD:4	0.04	26.0	2	1	0
PRT	sp|Q15061|WDR43_HUMAN	WD repeat-containing protein 43 OS=Homo sapiens OX=9606 GN=WDR43 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.04	26.0	3	2	1
PRT	sp|P46779|RL28_HUMAN	60S ribosomal protein L28 OS=Homo sapiens OX=9606 GN=RPL28 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1001476, X!Tandem, ]	26.0	null	23-UNIMOD:28	0.18	26.0	6	2	0
PRT	sp|P36639-2|8ODP_HUMAN	Isoform p22 of 7,8-dihydro-8-oxoguanine triphosphatase OS=Homo sapiens OX=9606 GN=NUDT1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.07	26.0	1	1	1
PRT	sp|Q9NTJ5|SAC1_HUMAN	Phosphatidylinositide phosphatase SAC1 OS=Homo sapiens OX=9606 GN=SACM1L PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null	445-UNIMOD:4	0.04	26.0	2	2	2
PRT	sp|P31930|QCR1_HUMAN	Cytochrome b-c1 complex subunit 1, mitochondrial OS=Homo sapiens OX=9606 GN=UQCRC1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null	380-UNIMOD:4	0.07	26.0	3	3	3
PRT	sp|O94901-9|SUN1_HUMAN	Isoform 9 of SUN domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SUN1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null	630-UNIMOD:4	0.01	26.0	1	1	1
PRT	sp|Q15417|CNN3_HUMAN	Calponin-3 OS=Homo sapiens OX=9606 GN=CNN3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null	173-UNIMOD:4	0.12	26.0	5	3	2
PRT	sp|P51114|FXR1_HUMAN	Fragile X mental retardation syndrome-related protein 1 OS=Homo sapiens OX=9606 GN=FXR1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.08	26.0	4	4	4
PRT	sp|O60488-2|ACSL4_HUMAN	Isoform Short of Long-chain-fatty-acid--CoA ligase 4 OS=Homo sapiens OX=9606 GN=ACSL4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.04	26.0	2	2	2
PRT	sp|Q3LXA3-2|TKFC_HUMAN	Isoform 2 of Triokinase/FMN cyclase OS=Homo sapiens OX=9606 GN=TKFC	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.04	26.0	1	1	1
PRT	sp|P46777|RL5_HUMAN	60S ribosomal protein L5 OS=Homo sapiens OX=9606 GN=RPL5 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	26.0	null		0.04	26.0	9	1	0
PRT	sp|P42574|CASP3_HUMAN	Caspase-3 OS=Homo sapiens OX=9606 GN=CASP3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.04	26.0	2	1	0
PRT	sp|Q5VYK3|ECM29_HUMAN	Proteasome adapter and scaffold protein ECM29 OS=Homo sapiens OX=9606 GN=ECPAS PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|O96011-2|PX11B_HUMAN	Isoform 2 of Peroxisomal membrane protein 11B OS=Homo sapiens OX=9606 GN=PEX11B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.05	26.0	1	1	1
PRT	sp|Q9UJZ1-2|STML2_HUMAN	Isoform 2 of Stomatin-like protein 2, mitochondrial OS=Homo sapiens OX=9606 GN=STOML2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.13	26.0	6	3	1
PRT	sp|Q4VC31|CCD58_HUMAN	Coiled-coil domain-containing protein 58 OS=Homo sapiens OX=9606 GN=CCDC58 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null	74-UNIMOD:4	0.08	26.0	3	1	0
PRT	sp|Q9BTE7|DCNL5_HUMAN	DCN1-like protein 5 OS=Homo sapiens OX=9606 GN=DCUN1D5 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null	115-UNIMOD:4,117-UNIMOD:4	0.05	26.0	1	1	1
PRT	sp|Q6IA86-5|ELP2_HUMAN	Isoform 5 of Elongator complex protein 2 OS=Homo sapiens OX=9606 GN=ELP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q96DI7-2|SNR40_HUMAN	Isoform 2 of U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens OX=9606 GN=SNRNP40	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null	168-UNIMOD:4	0.07	26.0	2	2	2
PRT	sp|Q13547|HDAC1_HUMAN	Histone deacetylase 1 OS=Homo sapiens OX=9606 GN=HDAC1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.05	26.0	4	2	1
PRT	sp|P46379-2|BAG6_HUMAN	Isoform 2 of Large proline-rich protein BAG6 OS=Homo sapiens OX=9606 GN=BAG6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.02	26.0	3	2	1
PRT	sp|Q9NS69|TOM22_HUMAN	Mitochondrial import receptor subunit TOM22 homolog OS=Homo sapiens OX=9606 GN=TOMM22 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.09	26.0	1	1	1
PRT	sp|P20962|PTMS_HUMAN	Parathymosin OS=Homo sapiens OX=9606 GN=PTMS PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.25	26.0	6	2	1
PRT	sp|P61981|1433G_HUMAN	14-3-3 protein gamma OS=Homo sapiens OX=9606 GN=YWHAG PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1001476, X!Tandem, ]	26.0	null	2-UNIMOD:1	0.21	26.0	6	5	4
PRT	sp|P09382|LEG1_HUMAN	Galectin-1 OS=Homo sapiens OX=9606 GN=LGALS1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null	61-UNIMOD:4	0.19	26.0	3	2	1
PRT	sp|P17812|PYRG1_HUMAN	CTP synthase 1 OS=Homo sapiens OX=9606 GN=CTPS1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	26.0	null	30-UNIMOD:4,218-UNIMOD:4	0.06	26.0	4	3	2
PRT	sp|P05091-2|ALDH2_HUMAN	Isoform 2 of Aldehyde dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ALDH2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null	339-UNIMOD:4	0.10	26.0	5	4	3
PRT	sp|P12814-2|ACTN1_HUMAN	Isoform 2 of Alpha-actinin-1 OS=Homo sapiens OX=9606 GN=ACTN1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.03	26.0	3	2	1
PRT	sp|Q01085-2|TIAR_HUMAN	Isoform 2 of Nucleolysin TIAR OS=Homo sapiens OX=9606 GN=TIAL1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.06	26.0	4	2	0
PRT	sp|P54577|SYYC_HUMAN	Tyrosine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=YARS PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.08	26.0	9	4	1
PRT	sp|P37802-2|TAGL2_HUMAN	Isoform 2 of Transgelin-2 OS=Homo sapiens OX=9606 GN=TAGLN2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.05	26.0	2	1	0
PRT	sp|Q96EK6|GNA1_HUMAN	Glucosamine 6-phosphate N-acetyltransferase OS=Homo sapiens OX=9606 GN=GNPNAT1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null	128-UNIMOD:4	0.07	26.0	1	1	1
PRT	sp|Q92820|GGH_HUMAN	Gamma-glutamyl hydrolase OS=Homo sapiens OX=9606 GN=GGH PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.04	26.0	2	1	0
PRT	sp|P05198|IF2A_HUMAN	Eukaryotic translation initiation factor 2 subunit 1 OS=Homo sapiens OX=9606 GN=EIF2S1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null	70-UNIMOD:4	0.08	26.0	5	3	2
PRT	sp|Q13509|TBB3_HUMAN	Tubulin beta-3 chain OS=Homo sapiens OX=9606 GN=TUBB3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.03	26.0	2	1	0
PRT	sp|P04843|RPN1_HUMAN	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Homo sapiens OX=9606 GN=RPN1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.07	26.0	6	4	2
PRT	sp|Q99460-2|PSMD1_HUMAN	Isoform 2 of 26S proteasome non-ATPase regulatory subunit 1 OS=Homo sapiens OX=9606 GN=PSMD1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null	112-UNIMOD:4	0.02	26.0	4	1	0
PRT	sp|O95218-2|ZRAB2_HUMAN	Isoform 2 of Zinc finger Ran-binding domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZRANB2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null	74-UNIMOD:4	0.11	26.0	5	4	3
PRT	sp|P49840|GSK3A_HUMAN	Glycogen synthase kinase-3 alpha OS=Homo sapiens OX=9606 GN=GSK3A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.09	26.0	2	2	2
PRT	sp|Q9BT78|CSN4_HUMAN	COP9 signalosome complex subunit 4 OS=Homo sapiens OX=9606 GN=COPS4 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null	232-UNIMOD:4	0.04	26.0	2	1	0
PRT	sp|Q9Y5V3-2|MAGD1_HUMAN	Isoform 2 of Melanoma-associated antigen D1 OS=Homo sapiens OX=9606 GN=MAGED1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q13148|TADBP_HUMAN	TAR DNA-binding protein 43 OS=Homo sapiens OX=9606 GN=TARDBP PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.06	26.0	3	2	1
PRT	sp|Q14157-5|UBP2L_HUMAN	Isoform 5 of Ubiquitin-associated protein 2-like OS=Homo sapiens OX=9606 GN=UBAP2L	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.04	26.0	5	3	1
PRT	sp|P53041|PPP5_HUMAN	Serine/threonine-protein phosphatase 5 OS=Homo sapiens OX=9606 GN=PPP5C PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null	404-UNIMOD:4	0.05	26.0	3	2	1
PRT	sp|P11233|RALA_HUMAN	Ras-related protein Ral-A OS=Homo sapiens OX=9606 GN=RALA PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.06	26.0	1	1	1
PRT	sp|Q9Y2W1|TR150_HUMAN	Thyroid hormone receptor-associated protein 3 OS=Homo sapiens OX=9606 GN=THRAP3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	26.0	null		0.06	26.0	7	5	3
PRT	sp|P42766|RL35_HUMAN	60S ribosomal protein L35 OS=Homo sapiens OX=9606 GN=RPL35 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.09	26.0	19	1	0
PRT	sp|P50454|SERPH_HUMAN	Serpin H1 OS=Homo sapiens OX=9606 GN=SERPINH1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|P61764|STXB1_HUMAN	Syntaxin-binding protein 1 OS=Homo sapiens OX=9606 GN=STXBP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q9UBF2|COPG2_HUMAN	Coatomer subunit gamma-2 OS=Homo sapiens OX=9606 GN=COPG2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1001476, X!Tandem, ]	26.0	null		0.04	26.0	5	3	1
PRT	sp|Q96B26|EXOS8_HUMAN	Exosome complex component RRP43 OS=Homo sapiens OX=9606 GN=EXOSC8 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null	60-UNIMOD:4	0.09	26.0	2	2	2
PRT	sp|Q13895|BYST_HUMAN	Bystin OS=Homo sapiens OX=9606 GN=BYSL PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1001476, X!Tandem, ]	26.0	null	64-UNIMOD:28	0.08	26.0	3	2	1
PRT	sp|Q8ND24|RN214_HUMAN	RING finger protein 214 OS=Homo sapiens OX=9606 GN=RNF214 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|O43837-2|IDH3B_HUMAN	Isoform A of Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=IDH3B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.04	26.0	1	1	1
PRT	sp|Q96DH6-2|MSI2H_HUMAN	Isoform 2 of RNA-binding protein Musashi homolog 2 OS=Homo sapiens OX=9606 GN=MSI2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null	164-UNIMOD:4	0.05	26.0	1	1	1
PRT	sp|P54886-2|P5CS_HUMAN	Isoform Short of Delta-1-pyrroline-5-carboxylate synthase OS=Homo sapiens OX=9606 GN=ALDH18A1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null	88-UNIMOD:4	0.05	26.0	4	3	2
PRT	sp|Q6NVY1|HIBCH_HUMAN	3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=HIBCH PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|P22307-7|NLTP_HUMAN	Isoform 7 of Non-specific lipid-transfer protein OS=Homo sapiens OX=9606 GN=SCP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.02	26.0	2	1	0
PRT	sp|Q8NAV1|PR38A_HUMAN	Pre-mRNA-splicing factor 38A OS=Homo sapiens OX=9606 GN=PRPF38A PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.05	26.0	1	1	1
PRT	sp|P49915|GUAA_HUMAN	GMP synthase [glutamine-hydrolyzing] OS=Homo sapiens OX=9606 GN=GMPS PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.07	26.0	4	4	4
PRT	sp|O75822-2|EIF3J_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit J OS=Homo sapiens OX=9606 GN=EIF3J	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.11	26.0	2	2	2
PRT	sp|Q9Y6I3-3|EPN1_HUMAN	Isoform 3 of Epsin-1 OS=Homo sapiens OX=9606 GN=EPN1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|O95163|ELP1_HUMAN	Elongator complex protein 1 OS=Homo sapiens OX=9606 GN=ELP1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.02	26.0	2	2	2
PRT	sp|P45974-2|UBP5_HUMAN	Isoform Short of Ubiquitin carboxyl-terminal hydrolase 5 OS=Homo sapiens OX=9606 GN=USP5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.06	26.0	5	4	3
PRT	sp|Q15047-3|SETB1_HUMAN	Isoform 3 of Histone-lysine N-methyltransferase SETDB1 OS=Homo sapiens OX=9606 GN=SETDB1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|P62826|RAN_HUMAN	GTP-binding nuclear protein Ran OS=Homo sapiens OX=9606 GN=RAN PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.11	26.0	10	4	2
PRT	sp|Q10472|GALT1_HUMAN	Polypeptide N-acetylgalactosaminyltransferase 1 OS=Homo sapiens OX=9606 GN=GALNT1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null	523-UNIMOD:4	0.03	26.0	1	1	1
PRT	sp|Q9UNM6-2|PSD13_HUMAN	Isoform 2 of 26S proteasome non-ATPase regulatory subunit 13 OS=Homo sapiens OX=9606 GN=PSMD13	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null	116-UNIMOD:4	0.06	26.0	4	2	0
PRT	sp|Q1ED39|KNOP1_HUMAN	Lysine-rich nucleolar protein 1 OS=Homo sapiens OX=9606 GN=KNOP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.05	26.0	2	2	2
PRT	sp|Q9UDR5|AASS_HUMAN	Alpha-aminoadipic semialdehyde synthase, mitochondrial OS=Homo sapiens OX=9606 GN=AASS PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.05	26.0	8	4	1
PRT	sp|Q9UGV2-2|NDRG3_HUMAN	Isoform 2 of Protein NDRG3 OS=Homo sapiens OX=9606 GN=NDRG3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.05	26.0	2	1	0
PRT	sp|Q5VTR2|BRE1A_HUMAN	E3 ubiquitin-protein ligase BRE1A OS=Homo sapiens OX=9606 GN=RNF20 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q8WUP2-2|FBLI1_HUMAN	Isoform 2 of Filamin-binding LIM protein 1 OS=Homo sapiens OX=9606 GN=FBLIM1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|Q16658|FSCN1_HUMAN	Fascin OS=Homo sapiens OX=9606 GN=FSCN1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	26.0	null	397-UNIMOD:4	0.09	26.0	7	4	1
PRT	sp|P50990-2|TCPQ_HUMAN	Isoform 2 of T-complex protein 1 subunit theta OS=Homo sapiens OX=9606 GN=CCT8	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.14	26.0	10	7	5
PRT	sp|P53621-2|COPA_HUMAN	Isoform 2 of Coatomer subunit alpha OS=Homo sapiens OX=9606 GN=COPA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null	254-UNIMOD:4	0.03	26.0	4	3	2
PRT	sp|P63010-2|AP2B1_HUMAN	Isoform 2 of AP-2 complex subunit beta OS=Homo sapiens OX=9606 GN=AP2B1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null	241-UNIMOD:4,871-UNIMOD:4	0.04	26.0	3	3	3
PRT	sp|P18065|IBP2_HUMAN	Insulin-like growth factor-binding protein 2 OS=Homo sapiens OX=9606 GN=IGFBP2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	26.0	null	98-UNIMOD:4,84-UNIMOD:4,86-UNIMOD:4,87-UNIMOD:4,90-UNIMOD:4	0.11	26.0	4	3	2
PRT	sp|Q5BKZ1|ZN326_HUMAN	DBIRD complex subunit ZNF326 OS=Homo sapiens OX=9606 GN=ZNF326 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.02	26.0	3	1	0
PRT	sp|O60701|UGDH_HUMAN	UDP-glucose 6-dehydrogenase OS=Homo sapiens OX=9606 GN=UGDH PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.05	26.0	4	2	0
PRT	sp|Q15554|TERF2_HUMAN	Telomeric repeat-binding factor 2 OS=Homo sapiens OX=9606 GN=TERF2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|P26038|MOES_HUMAN	Moesin OS=Homo sapiens OX=9606 GN=MSN PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.10	26.0	7	6	5
PRT	sp|Q9NX58|LYAR_HUMAN	Cell growth-regulating nucleolar protein OS=Homo sapiens OX=9606 GN=LYAR PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null	28-UNIMOD:4,30-UNIMOD:4,33-UNIMOD:4,36-UNIMOD:4	0.12	26.0	3	3	3
PRT	sp|Q13085-2|ACACA_HUMAN	Isoform 2 of Acetyl-CoA carboxylase 1 OS=Homo sapiens OX=9606 GN=ACACA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null	1711-UNIMOD:4	0.03	26.0	5	5	4
PRT	sp|O14745|NHRF1_HUMAN	Na(+)/H(+) exchange regulatory cofactor NHE-RF1 OS=Homo sapiens OX=9606 GN=SLC9A3R1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	26.0	null		0.15	26.0	11	4	1
PRT	sp|P09525-2|ANXA4_HUMAN	Isoform 2 of Annexin A4 OS=Homo sapiens OX=9606 GN=ANXA4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.11	26.0	2	2	2
PRT	sp|P07954-2|FUMH_HUMAN	Isoform Cytoplasmic of Fumarate hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=FH	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.06	26.0	3	2	1
PRT	sp|Q9UIF9-2|BAZ2A_HUMAN	Isoform 1 of Bromodomain adjacent to zinc finger domain protein 2A OS=Homo sapiens OX=9606 GN=BAZ2A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|Q9ULC3|RAB23_HUMAN	Ras-related protein Rab-23 OS=Homo sapiens OX=9606 GN=RAB23 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.07	26.0	1	1	1
PRT	sp|Q9UBU9|NXF1_HUMAN	Nuclear RNA export factor 1 OS=Homo sapiens OX=9606 GN=NXF1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|O75347|TBCA_HUMAN	Tubulin-specific chaperone A OS=Homo sapiens OX=9606 GN=TBCA PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001207, Mascot, ]	26.0	null		0.31	26.0	5	4	3
PRT	sp|O00762|UBE2C_HUMAN	Ubiquitin-conjugating enzyme E2 C OS=Homo sapiens OX=9606 GN=UBE2C PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	26.0	null	2-UNIMOD:1	0.09	26.0	2	1	0
PRT	sp|P11413|G6PD_HUMAN	Glucose-6-phosphate 1-dehydrogenase OS=Homo sapiens OX=9606 GN=G6PD PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|Q8N1F7|NUP93_HUMAN	Nuclear pore complex protein Nup93 OS=Homo sapiens OX=9606 GN=NUP93 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001207, Mascot, ]	26.0	null		0.03	26.0	2	2	2
PRT	sp|Q9Y2R0|COA3_HUMAN	Cytochrome c oxidase assembly factor 3 homolog, mitochondrial OS=Homo sapiens OX=9606 GN=COA3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	26.0	null	2-UNIMOD:1	0.12	26.0	1	1	1
PRT	sp|Q8IYB5|SMAP1_HUMAN	Stromal membrane-associated protein 1 OS=Homo sapiens OX=9606 GN=SMAP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|Q00610|CLH1_HUMAN	Clathrin heavy chain 1 OS=Homo sapiens OX=9606 GN=CLTC PE=1 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26.0	null	870-UNIMOD:4,918-UNIMOD:4	0.02	26.0	2	2	0
PRT	sp|Q9Y520|PRC2C_HUMAN	Protein PRRC2C OS=Homo sapiens OX=9606 GN=PRRC2C PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26.0	null		0.01	26.0	2	1	0
PRT	sp|P06454-2|PTMA_HUMAN	Isoform 2 of Prothymosin alpha OS=Homo sapiens OX=9606 GN=PTMA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.11	25.0	3	2	1
PRT	sp|P23588-2|IF4B_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 4B OS=Homo sapiens OX=9606 GN=EIF4B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.08	25.0	6	4	3
PRT	sp|Q9NU22|MDN1_HUMAN	Midasin OS=Homo sapiens OX=9606 GN=MDN1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null	979-UNIMOD:4	0.01	25.0	4	4	4
PRT	sp|P50552|VASP_HUMAN	Vasodilator-stimulated phosphoprotein OS=Homo sapiens OX=9606 GN=VASP PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1001476, X!Tandem, ]	25.0	null	2-UNIMOD:1,7-UNIMOD:4	0.06	25.0	4	2	0
PRT	sp|Q13492-2|PICAL_HUMAN	Isoform 2 of Phosphatidylinositol-binding clathrin assembly protein OS=Homo sapiens OX=9606 GN=PICALM	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.06	25.0	3	3	3
PRT	sp|Q9Y6G9|DC1L1_HUMAN	Cytoplasmic dynein 1 light intermediate chain 1 OS=Homo sapiens OX=9606 GN=DYNC1LI1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.05	25.0	2	2	2
PRT	sp|O43252|PAPS1_HUMAN	Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 1 OS=Homo sapiens OX=9606 GN=PAPSS1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q9H6K5-2|PRR36_HUMAN	Isoform 2 of Proline-rich protein 36 OS=Homo sapiens OX=9606 GN=PRR36	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|P42166|LAP2A_HUMAN	Lamina-associated polypeptide 2, isoform alpha OS=Homo sapiens OX=9606 GN=TMPO PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.03	25.0	3	2	1
PRT	sp|Q13247-3|SRSF6_HUMAN	Isoform SRP55-3 of Serine/arginine-rich splicing factor 6 OS=Homo sapiens OX=9606 GN=SRSF6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.04	25.0	1	1	0
PRT	sp|Q9Y657|SPIN1_HUMAN	Spindlin-1 OS=Homo sapiens OX=9606 GN=SPIN1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.10	25.0	2	2	2
PRT	sp|Q9H8S9-2|MOB1A_HUMAN	Isoform 2 of MOB kinase activator 1A OS=Homo sapiens OX=9606 GN=MOB1A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.09	25.0	1	1	1
PRT	sp|P21281|VATB2_HUMAN	V-type proton ATPase subunit B, brain isoform OS=Homo sapiens OX=9606 GN=ATP6V1B2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|P27824-2|CALX_HUMAN	Isoform 2 of Calnexin OS=Homo sapiens OX=9606 GN=CANX	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.03	25.0	2	2	1
PRT	sp|P00338-3|LDHA_HUMAN	Isoform 3 of L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.09	25.0	6	4	2
PRT	sp|Q07666|KHDR1_HUMAN	KH domain-containing, RNA-binding, signal transduction-associated protein 1 OS=Homo sapiens OX=9606 GN=KHDRBS1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.06	25.0	6	2	0
PRT	sp|Q9P2X0-2|DPM3_HUMAN	Isoform 2 of Dolichol-phosphate mannosyltransferase subunit 3 OS=Homo sapiens OX=9606 GN=DPM3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null	97-UNIMOD:4	0.19	25.0	2	2	2
PRT	sp|O75380|NDUS6_HUMAN	NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFS6 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null	87-UNIMOD:4	0.13	25.0	1	1	1
PRT	sp|P62263|RS14_HUMAN	40S ribosomal protein S14 OS=Homo sapiens OX=9606 GN=RPS14 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.18	25.0	3	2	1
PRT	sp|P37268-3|FDFT_HUMAN	Isoform 3 of Squalene synthase OS=Homo sapiens OX=9606 GN=FDFT1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.03	25.0	3	1	0
PRT	sp|Q8TDD1-2|DDX54_HUMAN	Isoform 2 of ATP-dependent RNA helicase DDX54 OS=Homo sapiens OX=9606 GN=DDX54	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.04	25.0	2	2	2
PRT	sp|O95202|LETM1_HUMAN	Mitochondrial proton/calcium exchanger protein OS=Homo sapiens OX=9606 GN=LETM1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.02	25.0	2	1	0
PRT	sp|Q96IZ0|PAWR_HUMAN	PRKC apoptosis WT1 regulator protein OS=Homo sapiens OX=9606 GN=PAWR PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.04	25.0	1	1	1
PRT	sp|Q15008-4|PSMD6_HUMAN	Isoform 4 of 26S proteasome non-ATPase regulatory subunit 6 OS=Homo sapiens OX=9606 GN=PSMD6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|O00161-2|SNP23_HUMAN	Isoform SNAP-23b of Synaptosomal-associated protein 23 OS=Homo sapiens OX=9606 GN=SNAP23	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.09	25.0	1	1	1
PRT	sp|Q8WXD5|GEMI6_HUMAN	Gem-associated protein 6 OS=Homo sapiens OX=9606 GN=GEMIN6 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.08	25.0	1	1	1
PRT	sp|Q01780|EXOSX_HUMAN	Exosome component 10 OS=Homo sapiens OX=9606 GN=EXOSC10 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null	411-UNIMOD:4	0.05	25.0	4	4	4
PRT	sp|Q92541|RTF1_HUMAN	RNA polymerase-associated protein RTF1 homolog OS=Homo sapiens OX=9606 GN=RTF1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.02	25.0	2	1	0
PRT	sp|Q8NFH4|NUP37_HUMAN	Nucleoporin Nup37 OS=Homo sapiens OX=9606 GN=NUP37 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null	149-UNIMOD:4	0.05	25.0	1	1	1
PRT	sp|P62750|RL23A_HUMAN	60S ribosomal protein L23a OS=Homo sapiens OX=9606 GN=RPL23A PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	25.0	null		0.15	25.0	6	3	1
PRT	sp|Q15020-4|SART3_HUMAN	Isoform 4 of Squamous cell carcinoma antigen recognized by T-cells 3 OS=Homo sapiens OX=9606 GN=SART3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.03	25.0	4	2	0
PRT	sp|P53985|MOT1_HUMAN	Monocarboxylate transporter 1 OS=Homo sapiens OX=9606 GN=SLC16A1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.10	25.0	4	3	2
PRT	sp|Q9H2J4|PDCL3_HUMAN	Phosducin-like protein 3 OS=Homo sapiens OX=9606 GN=PDCL3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1000663, ProteinPilot, ]	25.0	null		0.05	25.0	2	1	0
PRT	sp|P62195-2|PRS8_HUMAN	Isoform 2 of 26S proteasome regulatory subunit 8 OS=Homo sapiens OX=9606 GN=PSMC5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null	201-UNIMOD:4	0.03	25.0	1	1	1
PRT	sp|P08727|K1C19_HUMAN	Keratin, type I cytoskeletal 19 OS=Homo sapiens OX=9606 GN=KRT19 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1000663, ProteinPilot, ]	25.0	null		0.17	25.0	9	7	5
PRT	sp|P13073|COX41_HUMAN	Cytochrome c oxidase subunit 4 isoform 1, mitochondrial OS=Homo sapiens OX=9606 GN=COX4I1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.07	25.0	4	1	0
PRT	sp|Q2M389|WASC4_HUMAN	WASH complex subunit 4 OS=Homo sapiens OX=9606 GN=WASHC4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.02	25.0	2	2	2
PRT	sp|Q969Z0|FAKD4_HUMAN	FAST kinase domain-containing protein 4 OS=Homo sapiens OX=9606 GN=TBRG4 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q9NZL4-3|HPBP1_HUMAN	Isoform 3 of Hsp70-binding protein 1 OS=Homo sapiens OX=9606 GN=HSPBP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null	244-UNIMOD:4	0.03	25.0	1	1	1
PRT	sp|Q9NPE3|NOP10_HUMAN	H/ACA ribonucleoprotein complex subunit 3 OS=Homo sapiens OX=9606 GN=NOP10 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null	28-UNIMOD:4	0.27	25.0	1	1	1
PRT	sp|P25787|PSA2_HUMAN	Proteasome subunit alpha type-2 OS=Homo sapiens OX=9606 GN=PSMA2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.05	25.0	2	1	0
PRT	sp|P07195|LDHB_HUMAN	L-lactate dehydrogenase B chain OS=Homo sapiens OX=9606 GN=LDHB PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.12	25.0	7	4	2
PRT	sp|Q86UE4|LYRIC_HUMAN	Protein LYRIC OS=Homo sapiens OX=9606 GN=MTDH PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.05	25.0	2	2	2
PRT	sp|Q15121-2|PEA15_HUMAN	Isoform 2 of Astrocytic phosphoprotein PEA-15 OS=Homo sapiens OX=9606 GN=PEA15	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.07	25.0	1	1	1
PRT	sp|Q7Z2Z2-2|EFL1_HUMAN	Isoform 2 of Elongation factor-like GTPase 1 OS=Homo sapiens OX=9606 GN=EFL1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|P45973|CBX5_HUMAN	Chromobox protein homolog 5 OS=Homo sapiens OX=9606 GN=CBX5 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.06	25.0	2	1	0
PRT	sp|Q9Y314|NOSIP_HUMAN	Nitric oxide synthase-interacting protein OS=Homo sapiens OX=9606 GN=NOSIP PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.05	25.0	1	1	1
PRT	sp|Q9NXA8-2|SIR5_HUMAN	Isoform 2 of NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Homo sapiens OX=9606 GN=SIRT5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null	166-UNIMOD:4,169-UNIMOD:4	0.04	25.0	1	1	1
PRT	sp|O14757-3|CHK1_HUMAN	Isoform 3 of Serine/threonine-protein kinase Chk1 OS=Homo sapiens OX=9606 GN=CHEK1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.04	25.0	1	1	1
PRT	sp|Q13685|AAMP_HUMAN	Angio-associated migratory cell protein OS=Homo sapiens OX=9606 GN=AAMP PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null	216-UNIMOD:4,220-UNIMOD:4	0.06	25.0	2	2	2
PRT	sp|Q9UBM7|DHCR7_HUMAN	7-dehydrocholesterol reductase OS=Homo sapiens OX=9606 GN=DHCR7 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null	380-UNIMOD:4	0.03	25.0	1	1	1
PRT	sp|Q93009-3|UBP7_HUMAN	Isoform 3 of Ubiquitin carboxyl-terminal hydrolase 7 OS=Homo sapiens OX=9606 GN=USP7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null	299-UNIMOD:4	0.03	25.0	3	3	3
PRT	sp|Q8N9N8|EIF1A_HUMAN	Probable RNA-binding protein EIF1AD OS=Homo sapiens OX=9606 GN=EIF1AD PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.10	25.0	1	1	1
PRT	sp|Q99436|PSB7_HUMAN	Proteasome subunit beta type-7 OS=Homo sapiens OX=9606 GN=PSMB7 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.08	25.0	4	2	1
PRT	sp|P62273-2|RS29_HUMAN	Isoform 2 of 40S ribosomal protein S29 OS=Homo sapiens OX=9606 GN=RPS29	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.18	25.0	6	1	0
PRT	sp|P56192|SYMC_HUMAN	Methionine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=MARS PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.07	25.0	6	5	4
PRT	sp|O00754-2|MA2B1_HUMAN	Isoform 2 of Lysosomal alpha-mannosidase OS=Homo sapiens OX=9606 GN=MAN2B1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|Q9P2R7-2|SUCB1_HUMAN	Isoform 2 of Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=SUCLA2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null	130-UNIMOD:4,136-UNIMOD:4	0.07	25.0	4	3	2
PRT	sp|Q9HC35|EMAL4_HUMAN	Echinoderm microtubule-associated protein-like 4 OS=Homo sapiens OX=9606 GN=EML4 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.03	25.0	3	2	1
PRT	sp|Q96C86|DCPS_HUMAN	m7GpppX diphosphatase OS=Homo sapiens OX=9606 GN=DCPS PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null	37-UNIMOD:4	0.09	25.0	2	2	2
PRT	sp|P11586|C1TC_HUMAN	C-1-tetrahydrofolate synthase, cytoplasmic OS=Homo sapiens OX=9606 GN=MTHFD1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.06	25.0	7	5	4
PRT	sp|O43491-4|E41L2_HUMAN	Isoform 4 of Band 4.1-like protein 2 OS=Homo sapiens OX=9606 GN=EPB41L2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1001476, X!Tandem, ]	25.0	null	2-UNIMOD:1	0.05	25.0	6	3	1
PRT	sp|Q9BTW9-4|TBCD_HUMAN	Isoform 4 of Tubulin-specific chaperone D OS=Homo sapiens OX=9606 GN=TBCD	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null	899-UNIMOD:4	0.02	25.0	3	2	1
PRT	sp|P11388-4|TOP2A_HUMAN	Isoform 4 of DNA topoisomerase 2-alpha OS=Homo sapiens OX=9606 GN=TOP2A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null	473-UNIMOD:4	0.04	25.0	6	6	6
PRT	sp|P15121|ALDR_HUMAN	Aldose reductase OS=Homo sapiens OX=9606 GN=AKR1B1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null	299-UNIMOD:4,304-UNIMOD:4	0.10	25.0	8	3	1
PRT	sp|O14497|ARI1A_HUMAN	AT-rich interactive domain-containing protein 1A OS=Homo sapiens OX=9606 GN=ARID1A PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	25.0	null	1981-UNIMOD:4,1983-UNIMOD:4	0.03	25.0	5	4	3
PRT	sp|Q53FT3|HIKES_HUMAN	Protein Hikeshi OS=Homo sapiens OX=9606 GN=HIKESHI PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.07	25.0	1	1	1
PRT	sp|O95865|DDAH2_HUMAN	N(G),N(G)-dimethylarginine dimethylaminohydrolase 2 OS=Homo sapiens OX=9606 GN=DDAH2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.05	25.0	1	1	1
PRT	sp|Q9NS86|LANC2_HUMAN	LanC-like protein 2 OS=Homo sapiens OX=9606 GN=LANCL2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|P49750|YLPM1_HUMAN	YLP motif-containing protein 1 OS=Homo sapiens OX=9606 GN=YLPM1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.03	25.0	4	4	4
PRT	sp|P55735-2|SEC13_HUMAN	Isoform 2 of Protein SEC13 homolog OS=Homo sapiens OX=9606 GN=SEC13	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null	173-UNIMOD:4	0.13	25.0	5	3	2
PRT	sp|Q14498-2|RBM39_HUMAN	Isoform 2 of RNA-binding protein 39 OS=Homo sapiens OX=9606 GN=RBM39	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.04	25.0	3	2	1
PRT	sp|Q7Z392-3|TPC11_HUMAN	Isoform 3 of Trafficking protein particle complex subunit 11 OS=Homo sapiens OX=9606 GN=TRAPPC11	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q8IYD1|ERF3B_HUMAN	Eukaryotic peptide chain release factor GTP-binding subunit ERF3B OS=Homo sapiens OX=9606 GN=GSPT2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.02	25.0	2	1	0
PRT	sp|P55036|PSMD4_HUMAN	26S proteasome non-ATPase regulatory subunit 4 OS=Homo sapiens OX=9606 GN=PSMD4 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|P28370|SMCA1_HUMAN	Probable global transcription activator SNF2L1 OS=Homo sapiens OX=9606 GN=SMARCA1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	25.0	null		0.04	25.0	3	3	3
PRT	sp|Q15437|SC23B_HUMAN	Protein transport protein Sec23B OS=Homo sapiens OX=9606 GN=SEC23B PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	25.0	null		0.03	25.0	2	2	2
PRT	sp|Q9UPN3|MACF1_HUMAN	Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.01	25.0	5	5	5
PRT	sp|O75223|GGCT_HUMAN	Gamma-glutamylcyclotransferase OS=Homo sapiens OX=9606 GN=GGCT PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.07	25.0	2	1	0
PRT	sp|Q9BY77|PDIP3_HUMAN	Polymerase delta-interacting protein 3 OS=Homo sapiens OX=9606 GN=POLDIP3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.06	25.0	3	2	1
PRT	sp|P24928|RPB1_HUMAN	DNA-directed RNA polymerase II subunit RPB1 OS=Homo sapiens OX=9606 GN=POLR2A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.02	25.0	3	2	1
PRT	sp|P58107|EPIPL_HUMAN	Epiplakin OS=Homo sapiens OX=9606 GN=EPPK1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|P09417-2|DHPR_HUMAN	Isoform 2 of Dihydropteridine reductase OS=Homo sapiens OX=9606 GN=QDPR	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null	130-UNIMOD:4	0.07	25.0	2	1	0
PRT	sp|O43809|CPSF5_HUMAN	Cleavage and polyadenylation specificity factor subunit 5 OS=Homo sapiens OX=9606 GN=NUDT21 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.06	25.0	2	1	0
PRT	sp|Q15173-2|2A5B_HUMAN	Isoform Beta-2 of Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit beta isoform OS=Homo sapiens OX=9606 GN=PPP2R5B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null	362-UNIMOD:4	0.03	25.0	1	1	1
PRT	sp|Q9H7B2|RPF2_HUMAN	Ribosome production factor 2 homolog OS=Homo sapiens OX=9606 GN=RPF2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.11	25.0	5	3	1
PRT	sp|P62424|RL7A_HUMAN	60S ribosomal protein L7a OS=Homo sapiens OX=9606 GN=RPL7A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.16	25.0	9	4	1
PRT	sp|P08134|RHOC_HUMAN	Rho-related GTP-binding protein RhoC OS=Homo sapiens OX=9606 GN=RHOC PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null	16-UNIMOD:4	0.07	25.0	3	2	1
PRT	sp|P62280|RS11_HUMAN	40S ribosomal protein S11 OS=Homo sapiens OX=9606 GN=RPS11 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.13	25.0	4	3	2
PRT	sp|P48047|ATPO_HUMAN	ATP synthase subunit O, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5PO PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.06	25.0	2	1	0
PRT	sp|Q49A26-3|GLYR1_HUMAN	Isoform 3 of Putative oxidoreductase GLYR1 OS=Homo sapiens OX=9606 GN=GLYR1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null	231-UNIMOD:4	0.02	25.0	1	1	1
PRT	sp|Q6P1J9|CDC73_HUMAN	Parafibromin OS=Homo sapiens OX=9606 GN=CDC73 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null	145-UNIMOD:4	0.04	25.0	2	2	2
PRT	sp|Q13561-2|DCTN2_HUMAN	Isoform 2 of Dynactin subunit 2 OS=Homo sapiens OX=9606 GN=DCTN2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.05	25.0	2	2	2
PRT	sp|Q13112|CAF1B_HUMAN	Chromatin assembly factor 1 subunit B OS=Homo sapiens OX=9606 GN=CHAF1B PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q6PGP7|TTC37_HUMAN	Tetratricopeptide repeat protein 37 OS=Homo sapiens OX=9606 GN=TTC37 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null	329-UNIMOD:4	0.02	25.0	2	2	2
PRT	sp|Q99584|S10AD_HUMAN	Protein S100-A13 OS=Homo sapiens OX=9606 GN=S100A13 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.12	25.0	1	1	1
PRT	sp|Q9BZL1|UBL5_HUMAN	Ubiquitin-like protein 5 OS=Homo sapiens OX=9606 GN=UBL5 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null	18-UNIMOD:4	0.16	25.0	1	1	1
PRT	sp|Q5T8P6-2|RBM26_HUMAN	Isoform 2 of RNA-binding protein 26 OS=Homo sapiens OX=9606 GN=RBM26	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.03	25.0	2	2	1
PRT	sp|Q01469|FABP5_HUMAN	Fatty acid-binding protein 5 OS=Homo sapiens OX=9606 GN=FABP5 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null	67-UNIMOD:4	0.09	25.0	3	1	0
PRT	sp|Q96RS6-2|NUDC1_HUMAN	Isoform 2 of NudC domain-containing protein 1 OS=Homo sapiens OX=9606 GN=NUDCD1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null	82-UNIMOD:4,347-UNIMOD:4	0.04	25.0	3	2	1
PRT	sp|P20618|PSB1_HUMAN	Proteasome subunit beta type-1 OS=Homo sapiens OX=9606 GN=PSMB1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.05	25.0	1	1	1
PRT	sp|Q969T9|WBP2_HUMAN	WW domain-binding protein 2 OS=Homo sapiens OX=9606 GN=WBP2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.10	25.0	2	2	2
PRT	sp|Q9UJU6-2|DBNL_HUMAN	Isoform 2 of Drebrin-like protein OS=Homo sapiens OX=9606 GN=DBNL	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.05	25.0	3	2	1
PRT	sp|Q12792-4|TWF1_HUMAN	Isoform 4 of Twinfilin-1 OS=Homo sapiens OX=9606 GN=TWF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.06	25.0	1	1	1
PRT	sp|Q96FW1|OTUB1_HUMAN	Ubiquitin thioesterase OTUB1 OS=Homo sapiens OX=9606 GN=OTUB1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	25.0	null	91-UNIMOD:4	0.09	25.0	4	2	0
PRT	sp|Q13573|SNW1_HUMAN	SNW domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SNW1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.03	25.0	2	1	0
PRT	sp|P36776|LONM_HUMAN	Lon protease homolog, mitochondrial OS=Homo sapiens OX=9606 GN=LONP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null	682-UNIMOD:4	0.03	25.0	3	2	1
PRT	sp|Q96F07|CYFP2_HUMAN	Cytoplasmic FMR1-interacting protein 2 OS=Homo sapiens OX=9606 GN=CYFIP2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|O75821|EIF3G_HUMAN	Eukaryotic translation initiation factor 3 subunit G OS=Homo sapiens OX=9606 GN=EIF3G PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null	139-UNIMOD:4	0.05	25.0	1	1	1
PRT	sp|Q92900-2|RENT1_HUMAN	Isoform 2 of Regulator of nonsense transcripts 1 OS=Homo sapiens OX=9606 GN=UPF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.03	25.0	3	3	3
PRT	sp|Q9H9B1|EHMT1_HUMAN	Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens OX=9606 GN=EHMT1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null	842-UNIMOD:4,627-UNIMOD:4,630-UNIMOD:4	0.04	25.0	3	3	3
PRT	sp|P62316|SMD2_HUMAN	Small nuclear ribonucleoprotein Sm D2 OS=Homo sapiens OX=9606 GN=SNRPD2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null	46-UNIMOD:4,63-UNIMOD:4	0.28	25.0	8	3	1
PRT	sp|Q8WXI9|P66B_HUMAN	Transcriptional repressor p66-beta OS=Homo sapiens OX=9606 GN=GATAD2B PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q9HCS7|SYF1_HUMAN	Pre-mRNA-splicing factor SYF1 OS=Homo sapiens OX=9606 GN=XAB2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|P0DP23|CALM1_HUMAN	Calmodulin-1 OS=Homo sapiens OX=9606 GN=CALM1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.08	25.0	1	1	1
PRT	sp|Q9NZB2-6|F120A_HUMAN	Isoform F of Constitutive coactivator of PPAR-gamma-like protein 1 OS=Homo sapiens OX=9606 GN=FAM120A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null	947-UNIMOD:4	0.02	25.0	1	1	1
PRT	sp|O75970-2|MPDZ_HUMAN	Isoform 2 of Multiple PDZ domain protein OS=Homo sapiens OX=9606 GN=MPDZ	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|Q96T60-2|PNKP_HUMAN	Isoform 2 of Bifunctional polynucleotide phosphatase/kinase OS=Homo sapiens OX=9606 GN=PNKP	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q96RQ3|MCCA_HUMAN	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=MCCC1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|P57088|TMM33_HUMAN	Transmembrane protein 33 OS=Homo sapiens OX=9606 GN=TMEM33 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.04	25.0	2	1	0
PRT	sp|O95251|KAT7_HUMAN	Histone acetyltransferase KAT7 OS=Homo sapiens OX=9606 GN=KAT7 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null	185-UNIMOD:4,190-UNIMOD:4	0.03	25.0	1	1	1
PRT	sp|Q9UGI8|TES_HUMAN	Testin OS=Homo sapiens OX=9606 GN=TES PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null	361-UNIMOD:4,364-UNIMOD:4	0.05	25.0	1	1	1
PRT	sp|Q16181|SEPT7_HUMAN	Septin-7 OS=Homo sapiens OX=9606 GN=SEPT7 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25.0	null	204-UNIMOD:4	0.03	25.0	1	1	0
PRT	sp|Q13247|SRSF6_HUMAN	Serine/arginine-rich splicing factor 6 OS=Homo sapiens OX=9606 GN=SRSF6 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25.0	null	132-UNIMOD:28	0.04	25.0	2	1	0
PRT	sp|P09417|DHPR_HUMAN	Dihydropteridine reductase OS=Homo sapiens OX=9606 GN=QDPR PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	25.0	null	161-UNIMOD:4,2-UNIMOD:1	0.10	25.0	2	2	1
PRT	sp|Q96A08|H2B1A_HUMAN	Histone H2B type 1-A OS=Homo sapiens OX=9606 GN=HIST1H2BA PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25.0	null	49-UNIMOD:28	0.09	25.0	4	1	0
PRT	sp|O60216|RAD21_HUMAN	Double-strand-break repair protein rad21 homolog OS=Homo sapiens OX=9606 GN=RAD21 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|P14635|CCNB1_HUMAN	G2/mitotic-specific cyclin-B1 OS=Homo sapiens OX=9606 GN=CCNB1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25.0	null	180-UNIMOD:28	0.03	25.0	1	1	1
PRT	sp|P33991|MCM4_HUMAN	DNA replication licensing factor MCM4 OS=Homo sapiens OX=9606 GN=MCM4 PE=1 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001207, Mascot, ],[MS, MS:1001476, X!Tandem, ]	25.0	null	328-UNIMOD:4	0.05	25.0	6	4	2
PRT	sp|O00592|PODXL_HUMAN	Podocalyxin OS=Homo sapiens OX=9606 GN=PODXL PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25.0	null		0.03	25.0	1	1	0
PRT	sp|Q9UHJ6|SHPK_HUMAN	Sedoheptulokinase OS=Homo sapiens OX=9606 GN=SHPK PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q13442|HAP28_HUMAN	28 kDa heat- and acid-stable phosphoprotein OS=Homo sapiens OX=9606 GN=PDAP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25.0	null		0.07	25.0	2	1	0
PRT	sp|Q13347|EIF3I_HUMAN	Eukaryotic translation initiation factor 3 subunit I OS=Homo sapiens OX=9606 GN=EIF3I PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null	76-UNIMOD:4,81-UNIMOD:4	0.17	24.0	8	5	2
PRT	sp|O75362|ZN217_HUMAN	Zinc finger protein 217 OS=Homo sapiens OX=9606 GN=ZNF217 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.02	24.0	2	1	0
PRT	sp|Q13155-2|AIMP2_HUMAN	Isoform 2 of Aminoacyl tRNA synthase complex-interacting multifunctional protein 2 OS=Homo sapiens OX=9606 GN=AIMP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.05	24.0	1	1	1
PRT	sp|P19388|RPAB1_HUMAN	DNA-directed RNA polymerases I, II, and III subunit RPABC1 OS=Homo sapiens OX=9606 GN=POLR2E PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	24.0	null	21-UNIMOD:4	0.10	24.0	8	2	1
PRT	sp|Q8WWY3|PRP31_HUMAN	U4/U6 small nuclear ribonucleoprotein Prp31 OS=Homo sapiens OX=9606 GN=PRPF31 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|P60953|CDC42_HUMAN	Cell division control protein 42 homolog OS=Homo sapiens OX=9606 GN=CDC42 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	24.0	null	134-UNIMOD:28,157-UNIMOD:4,6-UNIMOD:4	0.18	24.0	5	3	1
PRT	sp|P40227-2|TCPZ_HUMAN	Isoform 2 of T-complex protein 1 subunit zeta OS=Homo sapiens OX=9606 GN=CCT6A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.07	24.0	6	4	3
PRT	sp|Q92522|H1X_HUMAN	Histone H1x OS=Homo sapiens OX=9606 GN=H1FX PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.08	24.0	2	2	2
PRT	sp|P56270-2|MAZ_HUMAN	Isoform 2 of Myc-associated zinc finger protein OS=Homo sapiens OX=9606 GN=MAZ	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null	421-UNIMOD:4,424-UNIMOD:4	0.03	24.0	1	1	1
PRT	sp|O95453-2|PARN_HUMAN	Isoform 2 of Poly(A)-specific ribonuclease PARN OS=Homo sapiens OX=9606 GN=PARN	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.04	24.0	2	2	2
PRT	sp|Q9BWD1-2|THIC_HUMAN	Isoform 2 of Acetyl-CoA acetyltransferase, cytosolic OS=Homo sapiens OX=9606 GN=ACAT2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.05	24.0	3	2	1
PRT	sp|Q92485|ASM3B_HUMAN	Acid sphingomyelinase-like phosphodiesterase 3b OS=Homo sapiens OX=9606 GN=SMPDL3B PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q13610|PWP1_HUMAN	Periodic tryptophan protein 1 homolog OS=Homo sapiens OX=9606 GN=PWP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null	154-UNIMOD:4	0.05	24.0	2	2	2
PRT	sp|P0DN76|U2AF5_HUMAN	Splicing factor U2AF 35 kDa subunit-like protein OS=Homo sapiens OX=9606 GN=U2AF1L5 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.06	24.0	1	1	1
PRT	sp|P49736|MCM2_HUMAN	DNA replication licensing factor MCM2 OS=Homo sapiens OX=9606 GN=MCM2 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.04	24.0	4	3	2
PRT	sp|O75534-2|CSDE1_HUMAN	Isoform 2 of Cold shock domain-containing protein E1 OS=Homo sapiens OX=9606 GN=CSDE1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null	475-UNIMOD:4	0.06	24.0	4	4	3
PRT	sp|Q96JM2-3|ZN462_HUMAN	Isoform 3 of Zinc finger protein 462 OS=Homo sapiens OX=9606 GN=ZNF462	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.01	24.0	2	2	2
PRT	sp|P08758|ANXA5_HUMAN	Annexin A5 OS=Homo sapiens OX=9606 GN=ANXA5 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.10	24.0	4	3	2
PRT	sp|P61006-2|RAB8A_HUMAN	Isoform 2 of Ras-related protein Rab-8A OS=Homo sapiens OX=9606 GN=RAB8A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.06	24.0	1	1	1
PRT	sp|O43747-2|AP1G1_HUMAN	Isoform 2 of AP-1 complex subunit gamma-1 OS=Homo sapiens OX=9606 GN=AP1G1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null	160-UNIMOD:4	0.03	24.0	2	2	2
PRT	sp|Q9BXW7-2|HDHD5_HUMAN	Isoform 1 of Haloacid dehalogenase-like hydrolase domain-containing 5 OS=Homo sapiens OX=9606 GN=HDHD5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|P61026|RAB10_HUMAN	Ras-related protein Rab-10 OS=Homo sapiens OX=9606 GN=RAB10 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.07	24.0	1	1	1
PRT	sp|O75367-3|H2AY_HUMAN	Isoform 3 of Core histone macro-H2A.1 OS=Homo sapiens OX=9606 GN=H2AFY	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null	296-UNIMOD:4	0.03	24.0	2	2	2
PRT	sp|Q07955|SRSF1_HUMAN	Serine/arginine-rich splicing factor 1 OS=Homo sapiens OX=9606 GN=SRSF1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.08	24.0	5	2	0
PRT	sp|P16949-2|STMN1_HUMAN	Isoform 2 of Stathmin OS=Homo sapiens OX=9606 GN=STMN1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.06	24.0	3	1	0
PRT	sp|Q9UBC2-2|EP15R_HUMAN	Isoform 2 of Epidermal growth factor receptor substrate 15-like 1 OS=Homo sapiens OX=9606 GN=EPS15L1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q8N490-2|PNKD_HUMAN	Isoform 2 of Probable hydrolase PNKD OS=Homo sapiens OX=9606 GN=PNKD	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.08	24.0	1	1	1
PRT	sp|P33240-2|CSTF2_HUMAN	Isoform 2 of Cleavage stimulation factor subunit 2 OS=Homo sapiens OX=9606 GN=CSTF2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null	150-UNIMOD:4	0.02	24.0	3	1	0
PRT	sp|O00515|LAD1_HUMAN	Ladinin-1 OS=Homo sapiens OX=9606 GN=LAD1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q9NRX4-2|PHP14_HUMAN	Isoform 2 of 14 kDa phosphohistidine phosphatase OS=Homo sapiens OX=9606 GN=PHPT1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null	69-UNIMOD:4,71-UNIMOD:4,73-UNIMOD:4	0.10	24.0	1	1	1
PRT	sp|O96000-2|NDUBA_HUMAN	Isoform 2 of NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 OS=Homo sapiens OX=9606 GN=NDUFB10	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null	119-UNIMOD:4	0.13	24.0	2	2	2
PRT	sp|P00492|HPRT_HUMAN	Hypoxanthine-guanine phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=HPRT1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null	106-UNIMOD:4	0.06	24.0	1	1	1
PRT	sp|Q6UXN9|WDR82_HUMAN	WD repeat-containing protein 82 OS=Homo sapiens OX=9606 GN=WDR82 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.05	24.0	1	1	1
PRT	sp|Q96GQ7|DDX27_HUMAN	Probable ATP-dependent RNA helicase DDX27 OS=Homo sapiens OX=9606 GN=DDX27 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null	259-UNIMOD:4,261-UNIMOD:4	0.03	24.0	2	2	2
PRT	sp|Q86VP6|CAND1_HUMAN	Cullin-associated NEDD8-dissociated protein 1 OS=Homo sapiens OX=9606 GN=CAND1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	24.0	null	356-UNIMOD:4,71-UNIMOD:4	0.05	24.0	10	7	4
PRT	sp|Q9NQW7-2|XPP1_HUMAN	Isoform 2 of Xaa-Pro aminopeptidase 1 OS=Homo sapiens OX=9606 GN=XPNPEP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null	279-UNIMOD:4	0.04	24.0	2	2	2
PRT	sp|Q9NW13|RBM28_HUMAN	RNA-binding protein 28 OS=Homo sapiens OX=9606 GN=RBM28 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.03	24.0	2	2	2
PRT	sp|Q8IXH7-4|NELFD_HUMAN	Isoform NELF-D of Negative elongation factor C/D OS=Homo sapiens OX=9606 GN=NELFCD	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null	388-UNIMOD:4,389-UNIMOD:4	0.03	24.0	1	1	1
PRT	sp|P31040-2|SDHA_HUMAN	Isoform 2 of Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Homo sapiens OX=9606 GN=SDHA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null	488-UNIMOD:4,419-UNIMOD:4,427-UNIMOD:4	0.08	24.0	6	4	2
PRT	sp|Q96SI9-2|STRBP_HUMAN	Isoform 2 of Spermatid perinuclear RNA-binding protein OS=Homo sapiens OX=9606 GN=STRBP	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.04	24.0	2	2	2
PRT	sp|Q9BV38|WDR18_HUMAN	WD repeat-containing protein 18 OS=Homo sapiens OX=9606 GN=WDR18 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.08	24.0	4	3	2
PRT	sp|P49748-2|ACADV_HUMAN	Isoform 2 of Very long-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ACADVL	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q15366-2|PCBP2_HUMAN	Isoform 2 of Poly(rC)-binding protein 2 OS=Homo sapiens OX=9606 GN=PCBP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.03	24.0	5	1	0
PRT	sp|O15067|PUR4_HUMAN	Phosphoribosylformylglycinamidine synthase OS=Homo sapiens OX=9606 GN=PFAS PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null	270-UNIMOD:4	0.01	24.0	1	1	1
PRT	sp|O00567|NOP56_HUMAN	Nucleolar protein 56 OS=Homo sapiens OX=9606 GN=NOP56 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null	211-UNIMOD:4	0.12	24.0	7	6	5
PRT	sp|Q96RE7|NACC1_HUMAN	Nucleus accumbens-associated protein 1 OS=Homo sapiens OX=9606 GN=NACC1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null	416-UNIMOD:4	0.02	24.0	1	1	1
PRT	sp|P41250|GARS_HUMAN	Glycine--tRNA ligase OS=Homo sapiens OX=9606 GN=GARS PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null	466-UNIMOD:4,471-UNIMOD:4	0.03	24.0	3	2	1
PRT	sp|Q8IVM0-2|CCD50_HUMAN	Isoform 2 of Coiled-coil domain-containing protein 50 OS=Homo sapiens OX=9606 GN=CCDC50	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q9UIA9|XPO7_HUMAN	Exportin-7 OS=Homo sapiens OX=9606 GN=XPO7 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.02	24.0	3	2	1
PRT	sp|Q9BWF3|RBM4_HUMAN	RNA-binding protein 4 OS=Homo sapiens OX=9606 GN=RBM4 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null	162-UNIMOD:4,89-UNIMOD:4	0.17	24.0	7	5	3
PRT	sp|P98179|RBM3_HUMAN	RNA-binding protein 3 OS=Homo sapiens OX=9606 GN=RBM3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	24.0	null		0.22	24.0	3	3	3
PRT	sp|Q15459|SF3A1_HUMAN	Splicing factor 3A subunit 1 OS=Homo sapiens OX=9606 GN=SF3A1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	24.0	null		0.08	24.0	5	5	5
PRT	sp|Q9BRU9|UTP23_HUMAN	rRNA-processing protein UTP23 homolog OS=Homo sapiens OX=9606 GN=UTP23 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.06	24.0	1	1	1
PRT	sp|Q99714-2|HCD2_HUMAN	Isoform 2 of 3-hydroxyacyl-CoA dehydrogenase type-2 OS=Homo sapiens OX=9606 GN=HSD17B10	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.12	24.0	2	2	2
PRT	sp|P61604|CH10_HUMAN	10 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPE1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	24.0	null		0.20	24.0	5	2	1
PRT	sp|O75150-4|BRE1B_HUMAN	Isoform 4 of E3 ubiquitin-protein ligase BRE1B OS=Homo sapiens OX=9606 GN=RNF40	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.03	24.0	2	2	2
PRT	sp|Q12769|NU160_HUMAN	Nuclear pore complex protein Nup160 OS=Homo sapiens OX=9606 GN=NUP160 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.02	24.0	3	2	1
PRT	sp|P46100|ATRX_HUMAN	Transcriptional regulator ATRX OS=Homo sapiens OX=9606 GN=ATRX PE=1 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q8NF37|PCAT1_HUMAN	Lysophosphatidylcholine acyltransferase 1 OS=Homo sapiens OX=9606 GN=LPCAT1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q9NPF5|DMAP1_HUMAN	DNA methyltransferase 1-associated protein 1 OS=Homo sapiens OX=9606 GN=DMAP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|O95299|NDUAA_HUMAN	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFA10 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1001476, X!Tandem, ]	24.0	null	182-UNIMOD:28,183-UNIMOD:4	0.07	24.0	2	2	2
PRT	sp|O60716-11|CTND1_HUMAN	Isoform 2AC of Catenin delta-1 OS=Homo sapiens OX=9606 GN=CTNND1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null	375-UNIMOD:4	0.03	24.0	2	2	2
PRT	sp|Q13228-4|SBP1_HUMAN	Isoform 4 of Methanethiol oxidase OS=Homo sapiens OX=9606 GN=SELENBP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null	99-UNIMOD:4	0.02	24.0	1	1	1
PRT	sp|P38606-2|VATA_HUMAN	Isoform 2 of V-type proton ATPase catalytic subunit A OS=Homo sapiens OX=9606 GN=ATP6V1A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|P62241|RS8_HUMAN	40S ribosomal protein S8 OS=Homo sapiens OX=9606 GN=RPS8 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	24.0	null	174-UNIMOD:4,182-UNIMOD:4	0.17	24.0	7	4	1
PRT	sp|Q9H6V9-2|LDAH_HUMAN	Isoform 2 of Lipid droplet-associated hydrolase OS=Homo sapiens OX=9606 GN=LDAH	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.05	24.0	1	1	1
PRT	sp|P33992|MCM5_HUMAN	DNA replication licensing factor MCM5 OS=Homo sapiens OX=9606 GN=MCM5 PE=1 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null	397-UNIMOD:4	0.03	24.0	3	2	1
PRT	sp|Q08431-2|MFGM_HUMAN	Isoform 2 of Lactadherin OS=Homo sapiens OX=9606 GN=MFGE8	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null	100-UNIMOD:4,104-UNIMOD:4	0.09	24.0	3	2	1
PRT	sp|Q9NUQ3-2|TXLNG_HUMAN	Isoform 2 of Gamma-taxilin OS=Homo sapiens OX=9606 GN=TXLNG	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.08	24.0	3	3	3
PRT	sp|Q9Y2R4|DDX52_HUMAN	Probable ATP-dependent RNA helicase DDX52 OS=Homo sapiens OX=9606 GN=DDX52 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|P51572-2|BAP31_HUMAN	Isoform 2 of B-cell receptor-associated protein 31 OS=Homo sapiens OX=9606 GN=BCAP31	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.10	24.0	7	3	2
PRT	sp|Q9UNN5|FAF1_HUMAN	FAS-associated factor 1 OS=Homo sapiens OX=9606 GN=FAF1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q8WVY7|UBCP1_HUMAN	Ubiquitin-like domain-containing CTD phosphatase 1 OS=Homo sapiens OX=9606 GN=UBLCP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.04	24.0	3	1	0
PRT	sp|P08670|VIME_HUMAN	Vimentin OS=Homo sapiens OX=9606 GN=VIM PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|Q08380|LG3BP_HUMAN	Galectin-3-binding protein OS=Homo sapiens OX=9606 GN=LGALS3BP PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q12830-2|BPTF_HUMAN	Isoform 2 of Nucleosome-remodeling factor subunit BPTF OS=Homo sapiens OX=9606 GN=BPTF	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.01	24.0	3	2	1
PRT	sp|Q9UJQ4|SALL4_HUMAN	Sal-like protein 4 OS=Homo sapiens OX=9606 GN=SALL4 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null	568-UNIMOD:4,571-UNIMOD:4	0.01	24.0	2	1	0
PRT	sp|Q9NTK5|OLA1_HUMAN	Obg-like ATPase 1 OS=Homo sapiens OX=9606 GN=OLA1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|Q9Y520-4|PRC2C_HUMAN	Isoform 4 of Protein PRRC2C OS=Homo sapiens OX=9606 GN=PRRC2C	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null	620-UNIMOD:4	0.01	24.0	4	3	2
PRT	sp|Q5T0N5-2|FBP1L_HUMAN	Isoform 2 of Formin-binding protein 1-like OS=Homo sapiens OX=9606 GN=FNBP1L	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.04	24.0	2	2	2
PRT	sp|Q06203|PUR1_HUMAN	Amidophosphoribosyltransferase OS=Homo sapiens OX=9606 GN=PPAT PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|P15880|RS2_HUMAN	40S ribosomal protein S2 OS=Homo sapiens OX=9606 GN=RPS2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null	182-UNIMOD:4	0.14	24.0	6	4	2
PRT	sp|Q6UN15-5|FIP1_HUMAN	Isoform 5 of Pre-mRNA 3'-end-processing factor FIP1 OS=Homo sapiens OX=9606 GN=FIP1L1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|O14981|BTAF1_HUMAN	TATA-binding protein-associated factor 172 OS=Homo sapiens OX=9606 GN=BTAF1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.01	24.0	2	2	2
PRT	sp|Q13435|SF3B2_HUMAN	Splicing factor 3B subunit 2 OS=Homo sapiens OX=9606 GN=SF3B2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.03	24.0	6	3	1
PRT	sp|P09960|LKHA4_HUMAN	Leukotriene A-4 hydrolase OS=Homo sapiens OX=9606 GN=LTA4H PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.02	24.0	2	1	0
PRT	sp|P40925-3|MDHC_HUMAN	Isoform 3 of Malate dehydrogenase, cytoplasmic OS=Homo sapiens OX=9606 GN=MDH1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.09	24.0	5	3	2
PRT	sp|Q07812-2|BAX_HUMAN	Isoform Beta of Apoptosis regulator BAX OS=Homo sapiens OX=9606 GN=BAX	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.11	24.0	2	2	2
PRT	sp|Q8IZ83|A16A1_HUMAN	Aldehyde dehydrogenase family 16 member A1 OS=Homo sapiens OX=9606 GN=ALDH16A1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null	249-UNIMOD:4,350-UNIMOD:4	0.05	24.0	3	3	3
PRT	sp|Q06136|KDSR_HUMAN	3-ketodihydrosphingosine reductase OS=Homo sapiens OX=9606 GN=KDSR PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null	245-UNIMOD:4	0.05	24.0	1	1	1
PRT	sp|Q9P2W9|STX18_HUMAN	Syntaxin-18 OS=Homo sapiens OX=9606 GN=STX18 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null	107-UNIMOD:4	0.03	24.0	1	1	1
PRT	sp|P62805|H4_HUMAN	Histone H4 OS=Homo sapiens OX=9606 GN=HIST1H4A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.22	24.0	4	2	1
PRT	sp|Q9H9B4|SFXN1_HUMAN	Sideroflexin-1 OS=Homo sapiens OX=9606 GN=SFXN1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.11	24.0	3	3	3
PRT	sp|P63167|DYL1_HUMAN	Dynein light chain 1, cytoplasmic OS=Homo sapiens OX=9606 GN=DYNLL1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.13	24.0	1	1	1
PRT	sp|O75312|ZPR1_HUMAN	Zinc finger protein ZPR1 OS=Homo sapiens OX=9606 GN=ZPR1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.08	24.0	3	3	3
PRT	sp|O95433|AHSA1_HUMAN	Activator of 90 kDa heat shock protein ATPase homolog 1 OS=Homo sapiens OX=9606 GN=AHSA1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null	301-UNIMOD:4	0.04	24.0	1	1	1
PRT	sp|O60610|DIAP1_HUMAN	Protein diaphanous homolog 1 OS=Homo sapiens OX=9606 GN=DIAPH1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|O75439|MPPB_HUMAN	Mitochondrial-processing peptidase subunit beta OS=Homo sapiens OX=9606 GN=PMPCB PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null	389-UNIMOD:4	0.03	24.0	1	1	1
PRT	sp|O75663|TIPRL_HUMAN	TIP41-like protein OS=Homo sapiens OX=9606 GN=TIPRL PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null	87-UNIMOD:4	0.09	24.0	2	2	2
PRT	sp|Q12996|CSTF3_HUMAN	Cleavage stimulation factor subunit 3 OS=Homo sapiens OX=9606 GN=CSTF3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.03	24.0	3	2	1
PRT	sp|P49642|PRI1_HUMAN	DNA primase small subunit OS=Homo sapiens OX=9606 GN=PRIM1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q9Y232|CDYL_HUMAN	Chromodomain Y-like protein OS=Homo sapiens OX=9606 GN=CDYL PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q9P2D1|CHD7_HUMAN	Chromodomain-helicase-DNA-binding protein 7 OS=Homo sapiens OX=9606 GN=CHD7 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	24.0	null		0.01	24.0	2	2	2
PRT	sp|Q8WYP5-2|ELYS_HUMAN	Isoform 2 of Protein ELYS OS=Homo sapiens OX=9606 GN=AHCTF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.01	24.0	2	2	2
PRT	sp|Q9UHD1-2|CHRD1_HUMAN	Isoform 2 of Cysteine and histidine-rich domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CHORDC1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|P51149|RAB7A_HUMAN	Ras-related protein Rab-7a OS=Homo sapiens OX=9606 GN=RAB7A PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.06	24.0	1	1	1
PRT	sp|P17174-2|AATC_HUMAN	Isoform 2 of Aspartate aminotransferase, cytoplasmic OS=Homo sapiens OX=9606 GN=GOT1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.09	24.0	3	3	3
PRT	sp|P49419-2|AL7A1_HUMAN	Isoform 2 of Alpha-aminoadipic semialdehyde dehydrogenase OS=Homo sapiens OX=9606 GN=ALDH7A1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null	494-UNIMOD:4	0.09	24.0	4	4	4
PRT	sp|O75400-2|PR40A_HUMAN	Isoform 2 of Pre-mRNA-processing factor 40 homolog A OS=Homo sapiens OX=9606 GN=PRPF40A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.06	24.0	5	5	5
PRT	sp|P13987|CD59_HUMAN	CD59 glycoprotein OS=Homo sapiens OX=9606 GN=CD59 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null	70-UNIMOD:4	0.17	24.0	3	2	1
PRT	sp|P55084-2|ECHB_HUMAN	Isoform 2 of Trifunctional enzyme subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=HADHB	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.05	24.0	3	2	1
PRT	sp|Q9UKA9-2|PTBP2_HUMAN	Isoform 2 of Polypyrimidine tract-binding protein 2 OS=Homo sapiens OX=9606 GN=PTBP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.02	24.0	2	1	0
PRT	sp|O95394-3|AGM1_HUMAN	Isoform 2 of Phosphoacetylglucosamine mutase OS=Homo sapiens OX=9606 GN=PGM3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null	212-UNIMOD:4,272-UNIMOD:4,273-UNIMOD:4	0.07	24.0	3	3	2
PRT	sp|Q15003|CND2_HUMAN	Condensin complex subunit 2 OS=Homo sapiens OX=9606 GN=NCAPH PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.05	24.0	3	3	3
PRT	sp|Q9BQ69|MACD1_HUMAN	O-acetyl-ADP-ribose deacetylase MACROD1 OS=Homo sapiens OX=9606 GN=MACROD1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null	199-UNIMOD:4	0.04	24.0	1	1	1
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1000663, ProteinPilot, ]	24.0	null		0.02	24.0	1	1	0
PRT	sp|P41091|IF2G_HUMAN	Eukaryotic translation initiation factor 2 subunit 3 OS=Homo sapiens OX=9606 GN=EIF2S3 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null	96-UNIMOD:4,101-UNIMOD:4	0.08	24.0	4	3	2
PRT	sp|Q01995|TAGL_HUMAN	Transgelin OS=Homo sapiens OX=9606 GN=TAGLN PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.16	24.0	5	4	3
PRT	sp|Q5VZK9-2|CARL1_HUMAN	Isoform 2 of F-actin-uncapping protein LRRC16A OS=Homo sapiens OX=9606 GN=CARMIL1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null	708-UNIMOD:4	0.01	24.0	1	1	1
PRT	sp|P36507|MP2K2_HUMAN	Dual specificity mitogen-activated protein kinase kinase 2 OS=Homo sapiens OX=9606 GN=MAP2K2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.06	24.0	2	2	2
PRT	sp|P50995-2|ANX11_HUMAN	Isoform 2 of Annexin A11 OS=Homo sapiens OX=9606 GN=ANXA11	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q8NFH5-2|NUP35_HUMAN	Isoform 2 of Nucleoporin NUP35 OS=Homo sapiens OX=9606 GN=NUP35	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.09	24.0	2	2	2
PRT	sp|O94905|ERLN2_HUMAN	Erlin-2 OS=Homo sapiens OX=9606 GN=ERLIN2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.04	24.0	4	1	0
PRT	sp|O43660-2|PLRG1_HUMAN	Isoform 2 of Pleiotropic regulator 1 OS=Homo sapiens OX=9606 GN=PLRG1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.05	24.0	2	2	2
PRT	sp|Q2KHR3|QSER1_HUMAN	Glutamine and serine-rich protein 1 OS=Homo sapiens OX=9606 GN=QSER1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.02	24.0	2	2	2
PRT	sp|Q9NQC3-4|RTN4_HUMAN	Isoform 4 of Reticulon-4 OS=Homo sapiens OX=9606 GN=RTN4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null	869-UNIMOD:4	0.03	24.0	2	2	2
PRT	sp|Q15398-3|DLGP5_HUMAN	Isoform 3 of Disks large-associated protein 5 OS=Homo sapiens OX=9606 GN=DLGAP5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.02	24.0	2	1	0
PRT	sp|Q9Y285|SYFA_HUMAN	Phenylalanine--tRNA ligase alpha subunit OS=Homo sapiens OX=9606 GN=FARSA PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	24.0	null		0.07	24.0	3	3	3
PRT	sp|Q96P70|IPO9_HUMAN	Importin-9 OS=Homo sapiens OX=9606 GN=IPO9 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.02	24.0	2	2	2
PRT	sp|P46459-2|NSF_HUMAN	Isoform 2 of Vesicle-fusing ATPase OS=Homo sapiens OX=9606 GN=NSF	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|P09493-5|TPM1_HUMAN	Isoform 5 of Tropomyosin alpha-1 chain OS=Homo sapiens OX=9606 GN=TPM1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.05	24.0	1	1	1
PRT	sp|Q16822-2|PCKGM_HUMAN	Isoform 2 of Phosphoenolpyruvate carboxykinase [GTP], mitochondrial OS=Homo sapiens OX=9606 GN=PCK2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null	306-UNIMOD:4	0.06	24.0	2	2	2
PRT	sp|P23919-2|KTHY_HUMAN	Isoform 2 of Thymidylate kinase OS=Homo sapiens OX=9606 GN=DTYMK	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null	31-UNIMOD:4	0.07	24.0	1	1	1
PRT	sp|Q9BY42|RTF2_HUMAN	Protein RTF2 homolog OS=Homo sapiens OX=9606 GN=RTFDC1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.13	24.0	3	3	3
PRT	sp|O43172-2|PRP4_HUMAN	Isoform 2 of U4/U6 small nuclear ribonucleoprotein Prp4 OS=Homo sapiens OX=9606 GN=PRPF4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.05	24.0	2	2	2
PRT	sp|P37837|TALDO_HUMAN	Transaldolase OS=Homo sapiens OX=9606 GN=TALDO1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|Q13243-3|SRSF5_HUMAN	Isoform SRP40-4 of Serine/arginine-rich splicing factor 5 OS=Homo sapiens OX=9606 GN=SRSF5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.06	24.0	2	1	0
PRT	sp|Q9UK59|DBR1_HUMAN	Lariat debranching enzyme OS=Homo sapiens OX=9606 GN=DBR1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null	8-UNIMOD:4,9-UNIMOD:4	0.03	24.0	1	1	1
PRT	sp|Q12797-10|ASPH_HUMAN	Isoform 10 of Aspartyl/asparaginyl beta-hydroxylase OS=Homo sapiens OX=9606 GN=ASPH	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q96GE9-2|DMAC1_HUMAN	Isoform 2 of Distal membrane-arm assembly complex protein 1 OS=Homo sapiens OX=9606 GN=DMAC1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.16	24.0	2	1	0
PRT	sp|P18085|ARF4_HUMAN	ADP-ribosylation factor 4 OS=Homo sapiens OX=9606 GN=ARF4 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.06	24.0	3	1	0
PRT	sp|Q66PJ3-2|AR6P4_HUMAN	Isoform 2 of ADP-ribosylation factor-like protein 6-interacting protein 4 OS=Homo sapiens OX=9606 GN=ARL6IP4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|Q58FF7|H90B3_HUMAN	Putative heat shock protein HSP 90-beta-3 OS=Homo sapiens OX=9606 GN=HSP90AB3P PE=5 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null		0.02	24.0	1	1	0
PRT	sp|Q58FG0|HS905_HUMAN	Putative heat shock protein HSP 90-alpha A5 OS=Homo sapiens OX=9606 GN=HSP90AA5P PE=2 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null		0.03	24.0	1	1	0
PRT	sp|Q93008|USP9X_HUMAN	Probable ubiquitin carboxyl-terminal hydrolase FAF-X OS=Homo sapiens OX=9606 GN=USP9X PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	2293-UNIMOD:4	0.01	24.0	1	1	0
PRT	sp|P78347|GTF2I_HUMAN	General transcription factor II-I OS=Homo sapiens OX=9606 GN=GTF2I PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	24.0	null		0.03	24.0	4	2	1
PRT	sp|P29401|TKT_HUMAN	Transketolase OS=Homo sapiens OX=9606 GN=TKT PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24.0	null	1-UNIMOD:1	0.02	24.0	2	1	0
PRT	sp|Q15233|NONO_HUMAN	Non-POU domain-containing octamer-binding protein OS=Homo sapiens OX=9606 GN=NONO PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q9NTJ3|SMC4_HUMAN	Structural maintenance of chromosomes protein 4 OS=Homo sapiens OX=9606 GN=SMC4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001207, Mascot, ]	24.0	null	916-UNIMOD:4	0.04	24.0	5	5	5
PRT	sp|P68104|EF1A1_HUMAN	Elongation factor 1-alpha 1 OS=Homo sapiens OX=9606 GN=EEF1A1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null		0.02	24.0	1	1	0
PRT	sp|Q13885|TBB2A_HUMAN	Tubulin beta-2A chain OS=Homo sapiens OX=9606 GN=TUBB2A PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	354-UNIMOD:4	0.02	24.0	12	1	0
PRT	sp|Q9Y3F4|STRAP_HUMAN	Serine-threonine kinase receptor-associated protein OS=Homo sapiens OX=9606 GN=STRAP PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null		0.03	24.0	1	1	0
PRT	sp|O43768|ENSA_HUMAN	Alpha-endosulfine OS=Homo sapiens OX=9606 GN=ENSA PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24.0	null	2-UNIMOD:1	0.15	24.0	1	1	1
PRT	sp|P40121|CAPG_HUMAN	Macrophage-capping protein OS=Homo sapiens OX=9606 GN=CAPG PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null		0.04	24.0	2	1	0
PRT	sp|Q8ND56|LS14A_HUMAN	Protein LSM14 homolog A OS=Homo sapiens OX=9606 GN=LSM14A PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24.0	null	2-UNIMOD:1	0.02	24.0	1	1	1
PRT	sp|Q9BS26|ERP44_HUMAN	Endoplasmic reticulum resident protein 44 OS=Homo sapiens OX=9606 GN=ERP44 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	92-UNIMOD:4	0.03	24.0	1	1	1
PRT	sp|Q9NYJ1|COA4_HUMAN	Cytochrome c oxidase assembly factor 4 homolog, mitochondrial OS=Homo sapiens OX=9606 GN=COA4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24.0	null	2-UNIMOD:1	0.16	24.0	1	1	1
PRT	sp|Q96C01|F136A_HUMAN	Protein FAM136A OS=Homo sapiens OX=9606 GN=FAM136A PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null		0.08	24.0	1	1	1
PRT	sp|O00505|IMA4_HUMAN	Importin subunit alpha-4 OS=Homo sapiens OX=9606 GN=KPNA3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001207, Mascot, ]	24.0	null	2-UNIMOD:1	0.04	24.0	2	2	2
PRT	sp|P14618|KPYM_HUMAN	Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q15125|EBP_HUMAN	3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase OS=Homo sapiens OX=9606 GN=EBP PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.06	23.0	1	1	1
PRT	sp|P04406|G3P_HUMAN	Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1001476, X!Tandem, ]	23.0	null	264-UNIMOD:28	0.09	23.0	3	3	3
PRT	sp|O43242|PSMD3_HUMAN	26S proteasome non-ATPase regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PSMD3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.08	23.0	7	4	3
PRT	sp|P42167|LAP2B_HUMAN	Lamina-associated polypeptide 2, isoforms beta/gamma OS=Homo sapiens OX=9606 GN=TMPO PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q9UMY4-2|SNX12_HUMAN	Isoform 2 of Sorting nexin-12 OS=Homo sapiens OX=9606 GN=SNX12	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.07	23.0	1	1	1
PRT	sp|Q14847-2|LASP1_HUMAN	Isoform 2 of LIM and SH3 domain protein 1 OS=Homo sapiens OX=9606 GN=LASP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null	53-UNIMOD:4,29-UNIMOD:4,32-UNIMOD:4,35-UNIMOD:4	0.13	23.0	4	4	3
PRT	sp|P61313|RL15_HUMAN	60S ribosomal protein L15 OS=Homo sapiens OX=9606 GN=RPL15 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	23.0	null		0.24	23.0	7	4	1
PRT	sp|Q9Y5L0-1|TNPO3_HUMAN	Isoform 1 of Transportin-3 OS=Homo sapiens OX=9606 GN=TNPO3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null	668-UNIMOD:4,125-UNIMOD:4	0.03	23.0	2	2	2
PRT	sp|O00330|ODPX_HUMAN	Pyruvate dehydrogenase protein X component, mitochondrial OS=Homo sapiens OX=9606 GN=PDHX PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q15393|SF3B3_HUMAN	Splicing factor 3B subunit 3 OS=Homo sapiens OX=9606 GN=SF3B3 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	23.0	null	1156-UNIMOD:4	0.02	23.0	10	3	1
PRT	sp|Q9Y5B6|PAXB1_HUMAN	PAX3- and PAX7-binding protein 1 OS=Homo sapiens OX=9606 GN=PAXBP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|P51571|SSRD_HUMAN	Translocon-associated protein subunit delta OS=Homo sapiens OX=9606 GN=SSR4 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.06	23.0	1	1	1
PRT	sp|P84085|ARF5_HUMAN	ADP-ribosylation factor 5 OS=Homo sapiens OX=9606 GN=ARF5 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.06	23.0	1	1	1
PRT	sp|Q02447-2|SP3_HUMAN	Isoform 2 of Transcription factor Sp3 OS=Homo sapiens OX=9606 GN=SP3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q99623|PHB2_HUMAN	Prohibitin-2 OS=Homo sapiens OX=9606 GN=PHB2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	23.0	null		0.12	23.0	3	3	3
PRT	sp|P54578-2|UBP14_HUMAN	Isoform 2 of Ubiquitin carboxyl-terminal hydrolase 14 OS=Homo sapiens OX=9606 GN=USP14	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null	222-UNIMOD:4	0.08	23.0	4	3	1
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.07	23.0	5	4	3
PRT	sp|Q8N339|MT1M_HUMAN	Metallothionein-1M OS=Homo sapiens OX=9606 GN=MT1M PE=3 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null	33-UNIMOD:4,34-UNIMOD:4,36-UNIMOD:4,37-UNIMOD:4,41-UNIMOD:4	0.21	23.0	3	1	0
PRT	sp|Q16186|ADRM1_HUMAN	Proteasomal ubiquitin receptor ADRM1 OS=Homo sapiens OX=9606 GN=ADRM1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|P32119|PRDX2_HUMAN	Peroxiredoxin-2 OS=Homo sapiens OX=9606 GN=PRDX2 PE=1 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.22	23.0	7	4	2
PRT	sp|Q9Y262|EIF3L_HUMAN	Eukaryotic translation initiation factor 3 subunit L OS=Homo sapiens OX=9606 GN=EIF3L PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.06	23.0	3	3	3
PRT	sp|Q9BYG3|MK67I_HUMAN	MKI67 FHA domain-interacting nucleolar phosphoprotein OS=Homo sapiens OX=9606 GN=NIFK PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.09	23.0	2	2	2
PRT	sp|Q9HCE1|MOV10_HUMAN	Putative helicase MOV-10 OS=Homo sapiens OX=9606 GN=MOV10 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q12931|TRAP1_HUMAN	Heat shock protein 75 kDa, mitochondrial OS=Homo sapiens OX=9606 GN=TRAP1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null	573-UNIMOD:4	0.03	23.0	3	2	1
PRT	sp|Q14204|DYHC1_HUMAN	Cytoplasmic dynein 1 heavy chain 1 OS=Homo sapiens OX=9606 GN=DYNC1H1 PE=1 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	23.0	null	633-UNIMOD:4	0.03	23.0	14	13	12
PRT	sp|O60313-13|OPA1_HUMAN	Isoform 7 of Dynamin-like 120 kDa protein, mitochondrial OS=Homo sapiens OX=9606 GN=OPA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.02	23.0	2	2	2
PRT	sp|Q9C0J8|WDR33_HUMAN	pre-mRNA 3' end processing protein WDR33 OS=Homo sapiens OX=9606 GN=WDR33 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null	220-UNIMOD:4	0.03	23.0	3	3	3
PRT	sp|Q16891-2|MIC60_HUMAN	Isoform 2 of MICOS complex subunit MIC60 OS=Homo sapiens OX=9606 GN=IMMT	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.08	23.0	6	5	4
PRT	sp|P50402|EMD_HUMAN	Emerin OS=Homo sapiens OX=9606 GN=EMD PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.09	23.0	4	2	0
PRT	sp|Q13015|AF1Q_HUMAN	Protein AF1q OS=Homo sapiens OX=9606 GN=MLLT11 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.14	23.0	1	1	1
PRT	sp|P21741|MK_HUMAN	Midkine OS=Homo sapiens OX=9606 GN=MDK PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null	116-UNIMOD:4	0.08	23.0	2	1	0
PRT	sp|Q96QR8|PURB_HUMAN	Transcriptional activator protein Pur-beta OS=Homo sapiens OX=9606 GN=PURB PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|Q14203-6|DCTN1_HUMAN	Isoform 6 of Dynactin subunit 1 OS=Homo sapiens OX=9606 GN=DCTN1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null	784-UNIMOD:4	0.02	23.0	2	2	2
PRT	sp|Q12983|BNIP3_HUMAN	BCL2/adenovirus E1B 19 kDa protein-interacting protein 3 OS=Homo sapiens OX=9606 GN=BNIP3 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.05	23.0	1	1	1
PRT	sp|P53701|CCHL_HUMAN	Cytochrome c-type heme lyase OS=Homo sapiens OX=9606 GN=HCCS PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null	35-UNIMOD:4,46-UNIMOD:4	0.10	23.0	2	2	2
PRT	sp|Q9Y2L1|RRP44_HUMAN	Exosome complex exonuclease RRP44 OS=Homo sapiens OX=9606 GN=DIS3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q8N8S7|ENAH_HUMAN	Protein enabled homolog OS=Homo sapiens OX=9606 GN=ENAH PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1001476, X!Tandem, ]	23.0	null	2-UNIMOD:1,7-UNIMOD:4	0.07	23.0	4	4	4
PRT	sp|Q9Y2R9|RT07_HUMAN	28S ribosomal protein S7, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS7 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.11	23.0	2	2	2
PRT	sp|Q8WUA2|PPIL4_HUMAN	Peptidyl-prolyl cis-trans isomerase-like 4 OS=Homo sapiens OX=9606 GN=PPIL4 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q68CP9-3|ARID2_HUMAN	Isoform 2 of AT-rich interactive domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ARID2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null	82-UNIMOD:4	0.02	23.0	2	2	2
PRT	sp|Q9NXE4-4|NSMA3_HUMAN	Isoform 4 of Sphingomyelin phosphodiesterase 4 OS=Homo sapiens OX=9606 GN=SMPD4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null	625-UNIMOD:4	0.03	23.0	2	2	2
PRT	sp|P62333|PRS10_HUMAN	26S proteasome regulatory subunit 10B OS=Homo sapiens OX=9606 GN=PSMC6 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.06	23.0	2	2	2
PRT	sp|Q02818|NUCB1_HUMAN	Nucleobindin-1 OS=Homo sapiens OX=9606 GN=NUCB1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.05	23.0	2	2	2
PRT	sp|Q15631|TSN_HUMAN	Translin OS=Homo sapiens OX=9606 GN=TSN PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.05	23.0	1	1	1
PRT	sp|Q9H444|CHM4B_HUMAN	Charged multivesicular body protein 4b OS=Homo sapiens OX=9606 GN=CHMP4B PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.14	23.0	5	3	2
PRT	sp|O95347|SMC2_HUMAN	Structural maintenance of chromosomes protein 2 OS=Homo sapiens OX=9606 GN=SMC2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.04	23.0	4	4	4
PRT	sp|Q9HCJ6|VAT1L_HUMAN	Synaptic vesicle membrane protein VAT-1 homolog-like OS=Homo sapiens OX=9606 GN=VAT1L PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.05	23.0	2	2	2
PRT	sp|Q9Y3P9|RBGP1_HUMAN	Rab GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RABGAP1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null	1026-UNIMOD:4	0.04	23.0	4	4	4
PRT	sp|Q15006|EMC2_HUMAN	ER membrane protein complex subunit 2 OS=Homo sapiens OX=9606 GN=EMC2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.04	23.0	2	1	0
PRT	sp|P05186|PPBT_HUMAN	Alkaline phosphatase, tissue-nonspecific isozyme OS=Homo sapiens OX=9606 GN=ALPL PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.05	23.0	3	2	1
PRT	sp|P35611-2|ADDA_HUMAN	Isoform 2 of Alpha-adducin OS=Homo sapiens OX=9606 GN=ADD1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.09	23.0	5	5	5
PRT	sp|P62995-3|TRA2B_HUMAN	Isoform 3 of Transformer-2 protein homolog beta OS=Homo sapiens OX=9606 GN=TRA2B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.12	23.0	6	3	2
PRT	sp|O94826|TOM70_HUMAN	Mitochondrial import receptor subunit TOM70 OS=Homo sapiens OX=9606 GN=TOMM70 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1001476, X!Tandem, ]	23.0	null		0.04	23.0	2	2	2
PRT	sp|P11940-2|PABP1_HUMAN	Isoform 2 of Polyadenylate-binding protein 1 OS=Homo sapiens OX=9606 GN=PABPC1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.06	23.0	5	3	1
PRT	sp|O75531|BAF_HUMAN	Barrier-to-autointegration factor OS=Homo sapiens OX=9606 GN=BANF1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.15	23.0	1	1	1
PRT	sp|Q9H7Z7|PGES2_HUMAN	Prostaglandin E synthase 2 OS=Homo sapiens OX=9606 GN=PTGES2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.06	23.0	2	2	2
PRT	sp|Q9Y2B0|CNPY2_HUMAN	Protein canopy homolog 2 OS=Homo sapiens OX=9606 GN=CNPY2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.13	23.0	2	2	2
PRT	sp|Q9BUJ2-2|HNRL1_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 OS=Homo sapiens OX=9606 GN=HNRNPUL1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.04	23.0	4	3	2
PRT	sp|Q8TD19|NEK9_HUMAN	Serine/threonine-protein kinase Nek9 OS=Homo sapiens OX=9606 GN=NEK9 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|P12956-2|XRCC6_HUMAN	Isoform 2 of X-ray repair cross-complementing protein 6 OS=Homo sapiens OX=9606 GN=XRCC6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.04	23.0	5	2	0
PRT	sp|Q9NXH9-2|TRM1_HUMAN	Isoform 2 of tRNA (guanine(26)-N(2))-dimethyltransferase OS=Homo sapiens OX=9606 GN=TRMT1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|O43818|U3IP2_HUMAN	U3 small nucleolar RNA-interacting protein 2 OS=Homo sapiens OX=9606 GN=RRP9 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.08	23.0	4	3	2
PRT	sp|B5ME19|EIFCL_HUMAN	Eukaryotic translation initiation factor 3 subunit C-like protein OS=Homo sapiens OX=9606 GN=EIF3CL PE=3 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null	753-UNIMOD:4	0.04	23.0	4	3	1
PRT	sp|P09104-2|ENOG_HUMAN	Isoform 2 of Gamma-enolase OS=Homo sapiens OX=9606 GN=ENO2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.06	23.0	2	2	2
PRT	sp|P30084|ECHM_HUMAN	Enoyl-CoA hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=ECHS1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.07	23.0	8	2	0
PRT	sp|Q9H467|CUED2_HUMAN	CUE domain-containing protein 2 OS=Homo sapiens OX=9606 GN=CUEDC2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|Q99733-2|NP1L4_HUMAN	Isoform 2 of Nucleosome assembly protein 1-like 4 OS=Homo sapiens OX=9606 GN=NAP1L4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q13951-2|PEBB_HUMAN	Isoform 2 of Core-binding factor subunit beta OS=Homo sapiens OX=9606 GN=CBFB	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.10	23.0	1	1	1
PRT	sp|Q8WVJ2|NUDC2_HUMAN	NudC domain-containing protein 2 OS=Homo sapiens OX=9606 GN=NUDCD2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null	45-UNIMOD:4	0.08	23.0	1	1	1
PRT	sp|Q6UXK5|LRRN1_HUMAN	Leucine-rich repeat neuronal protein 1 OS=Homo sapiens OX=9606 GN=LRRN1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null	58-UNIMOD:4	0.02	23.0	1	1	1
PRT	sp|Q9Y2A7-2|NCKP1_HUMAN	Isoform 2 of Nck-associated protein 1 OS=Homo sapiens OX=9606 GN=NCKAP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q8WUM4-2|PDC6I_HUMAN	Isoform 2 of Programmed cell death 6-interacting protein OS=Homo sapiens OX=9606 GN=PDCD6IP	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.03	23.0	2	2	2
PRT	sp|O43278-2|SPIT1_HUMAN	Isoform 2 of Kunitz-type protease inhibitor 1 OS=Homo sapiens OX=9606 GN=SPINT1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null	250-UNIMOD:4	0.02	23.0	1	1	1
PRT	sp|Q9Y5J9|TIM8B_HUMAN	Mitochondrial import inner membrane translocase subunit Tim8 B OS=Homo sapiens OX=9606 GN=TIMM8B PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null	55-UNIMOD:4,59-UNIMOD:4	0.14	23.0	3	1	0
PRT	sp|Q86YP4-2|P66A_HUMAN	Isoform 2 of Transcriptional repressor p66-alpha OS=Homo sapiens OX=9606 GN=GATAD2A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.05	23.0	2	2	2
PRT	sp|P99999|CYC_HUMAN	Cytochrome c OS=Homo sapiens OX=9606 GN=CYCS PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.14	23.0	1	1	1
PRT	sp|Q9UMR2-4|DD19B_HUMAN	Isoform 4 of ATP-dependent RNA helicase DDX19B OS=Homo sapiens OX=9606 GN=DDX19B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.06	23.0	3	2	1
PRT	sp|Q9H501|ESF1_HUMAN	ESF1 homolog OS=Homo sapiens OX=9606 GN=ESF1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|P12109|CO6A1_HUMAN	Collagen alpha-1(VI) chain OS=Homo sapiens OX=9606 GN=COL6A1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|P28347-2|TEAD1_HUMAN	Isoform 2 of Transcriptional enhancer factor TEF-1 OS=Homo sapiens OX=9606 GN=TEAD1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|P43487|RANG_HUMAN	Ran-specific GTPase-activating protein OS=Homo sapiens OX=9606 GN=RANBP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.11	23.0	2	2	2
PRT	sp|Q9UJS0-2|CMC2_HUMAN	Isoform 2 of Calcium-binding mitochondrial carrier protein Aralar2 OS=Homo sapiens OX=9606 GN=SLC25A13	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|P53396|ACLY_HUMAN	ATP-citrate synthase OS=Homo sapiens OX=9606 GN=ACLY PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null	229-UNIMOD:4	0.02	23.0	2	2	2
PRT	sp|P62899|RL31_HUMAN	60S ribosomal protein L31 OS=Homo sapiens OX=9606 GN=RPL31 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.30	23.0	5	4	3
PRT	sp|P61916|NPC2_HUMAN	NPC intracellular cholesterol transporter 2 OS=Homo sapiens OX=9606 GN=NPC2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null	27-UNIMOD:4,99-UNIMOD:4	0.14	23.0	4	2	1
PRT	sp|P07602-2|SAP_HUMAN	Isoform Sap-mu-6 of Prosaposin OS=Homo sapiens OX=9606 GN=PSAP	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null	411-UNIMOD:4,414-UNIMOD:4,484-UNIMOD:4,63-UNIMOD:4,66-UNIMOD:4	0.07	23.0	6	4	3
PRT	sp|P07910-2|HNRPC_HUMAN	Isoform C1 of Heterogeneous nuclear ribonucleoproteins C1/C2 OS=Homo sapiens OX=9606 GN=HNRNPC	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.11	23.0	8	3	1
PRT	sp|P30086|PEBP1_HUMAN	Phosphatidylethanolamine-binding protein 1 OS=Homo sapiens OX=9606 GN=PEBP1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null	133-UNIMOD:4	0.10	23.0	4	2	1
PRT	sp|P19387|RPB3_HUMAN	DNA-directed RNA polymerase II subunit RPB3 OS=Homo sapiens OX=9606 GN=POLR2C PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|P11216|PYGB_HUMAN	Glycogen phosphorylase, brain form OS=Homo sapiens OX=9606 GN=PYGB PE=1 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null	437-UNIMOD:4	0.04	23.0	3	3	3
PRT	sp|O60925|PFD1_HUMAN	Prefoldin subunit 1 OS=Homo sapiens OX=9606 GN=PFDN1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.09	23.0	1	1	1
PRT	sp|Q9UHX1-2|PUF60_HUMAN	Isoform 2 of Poly(U)-binding-splicing factor PUF60 OS=Homo sapiens OX=9606 GN=PUF60	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.04	23.0	3	2	1
PRT	sp|Q9ULU4-19|PKCB1_HUMAN	Isoform 19 of Protein kinase C-binding protein 1 OS=Homo sapiens OX=9606 GN=ZMYND8	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.02	23.0	2	2	2
PRT	sp|Q9Y388|RBMX2_HUMAN	RNA-binding motif protein, X-linked 2 OS=Homo sapiens OX=9606 GN=RBMX2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|Q9BZJ0-3|CRNL1_HUMAN	Isoform 3 of Crooked neck-like protein 1 OS=Homo sapiens OX=9606 GN=CRNKL1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|O60870-2|KIN17_HUMAN	Isoform 2 of DNA/RNA-binding protein KIN17 OS=Homo sapiens OX=9606 GN=KIN	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q14011|CIRBP_HUMAN	Cold-inducible RNA-binding protein OS=Homo sapiens OX=9606 GN=CIRBP PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.07	23.0	2	1	0
PRT	sp|Q13308-6|PTK7_HUMAN	Isoform 6 of Inactive tyrosine-protein kinase 7 OS=Homo sapiens OX=9606 GN=PTK7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null	672-UNIMOD:4,678-UNIMOD:4	0.01	23.0	1	1	1
PRT	sp|P43897-2|EFTS_HUMAN	Isoform 2 of Elongation factor Ts, mitochondrial OS=Homo sapiens OX=9606 GN=TSFM	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null	336-UNIMOD:4	0.04	23.0	1	1	1
PRT	sp|Q9Y2X9-2|ZN281_HUMAN	Isoform 2 of Zinc finger protein 281 OS=Homo sapiens OX=9606 GN=ZNF281	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|P00387-3|NB5R3_HUMAN	Isoform 3 of NADH-cytochrome b5 reductase 3 OS=Homo sapiens OX=9606 GN=CYB5R3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|Q96N67-3|DOCK7_HUMAN	Isoform 3 of Dedicator of cytokinesis protein 7 OS=Homo sapiens OX=9606 GN=DOCK7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|P61619|S61A1_HUMAN	Protein transport protein Sec61 subunit alpha isoform 1 OS=Homo sapiens OX=9606 GN=SEC61A1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.05	23.0	2	2	2
PRT	sp|P25786-2|PSA1_HUMAN	Isoform Long of Proteasome subunit alpha type-1 OS=Homo sapiens OX=9606 GN=PSMA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.09	23.0	2	2	2
PRT	sp|P30876|RPB2_HUMAN	DNA-directed RNA polymerase II subunit RPB2 OS=Homo sapiens OX=9606 GN=POLR2B PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|P0DMV8-2|HS71A_HUMAN	Isoform 2 of Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.06	23.0	5	3	2
PRT	sp|Q14254|FLOT2_HUMAN	Flotillin-2 OS=Homo sapiens OX=9606 GN=FLOT2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|O60508|PRP17_HUMAN	Pre-mRNA-processing factor 17 OS=Homo sapiens OX=9606 GN=CDC40 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.04	23.0	2	2	2
PRT	sp|O75643|U520_HUMAN	U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens OX=9606 GN=SNRNP200 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null	428-UNIMOD:4	0.02	23.0	6	5	4
PRT	sp|Q5JSH3-2|WDR44_HUMAN	Isoform 2 of WD repeat-containing protein 44 OS=Homo sapiens OX=9606 GN=WDR44	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.03	23.0	2	2	2
PRT	sp|A5YKK6-2|CNOT1_HUMAN	Isoform 2 of CCR4-NOT transcription complex subunit 1 OS=Homo sapiens OX=9606 GN=CNOT1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.01	23.0	2	1	0
PRT	sp|Q66K74-2|MAP1S_HUMAN	Isoform 2 of Microtubule-associated protein 1S OS=Homo sapiens OX=9606 GN=MAP1S	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.02	23.0	2	2	2
PRT	sp|Q15583|TGIF1_HUMAN	Homeobox protein TGIF1 OS=Homo sapiens OX=9606 GN=TGIF1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	23.0	null	303-UNIMOD:4	0.07	23.0	2	2	2
PRT	sp|P42566|EPS15_HUMAN	Epidermal growth factor receptor substrate 15 OS=Homo sapiens OX=9606 GN=EPS15 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|O00443|P3C2A_HUMAN	Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha OS=Homo sapiens OX=9606 GN=PIK3C2A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.01	23.0	2	2	2
PRT	sp|Q9NVP1|DDX18_HUMAN	ATP-dependent RNA helicase DDX18 OS=Homo sapiens OX=9606 GN=DDX18 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.05	23.0	5	3	1
PRT	sp|Q07954|LRP1_HUMAN	Prolow-density lipoprotein receptor-related protein 1 OS=Homo sapiens OX=9606 GN=LRP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.01	23.0	2	2	2
PRT	sp|Q9NYL9|TMOD3_HUMAN	Tropomodulin-3 OS=Homo sapiens OX=9606 GN=TMOD3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1001476, X!Tandem, ]	23.0	null	102-UNIMOD:28	0.07	23.0	2	2	2
PRT	sp|P47755|CAZA2_HUMAN	F-actin-capping protein subunit alpha-2 OS=Homo sapiens OX=9606 GN=CAPZA2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null	141-UNIMOD:4	0.08	23.0	4	2	1
PRT	sp|P61009|SPCS3_HUMAN	Signal peptidase complex subunit 3 OS=Homo sapiens OX=9606 GN=SPCS3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.06	23.0	1	1	1
PRT	sp|Q15334|L2GL1_HUMAN	Lethal(2) giant larvae protein homolog 1 OS=Homo sapiens OX=9606 GN=LLGL1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q9Y2X0-2|MED16_HUMAN	Isoform 2 of Mediator of RNA polymerase II transcription subunit 16 OS=Homo sapiens OX=9606 GN=MED16	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q86VM9|ZCH18_HUMAN	Zinc finger CCCH domain-containing protein 18 OS=Homo sapiens OX=9606 GN=ZC3H18 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.01	23.0	2	1	0
PRT	sp|Q9NZW5|MPP6_HUMAN	MAGUK p55 subfamily member 6 OS=Homo sapiens OX=9606 GN=MPP6 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|P35249-2|RFC4_HUMAN	Isoform 2 of Replication factor C subunit 4 OS=Homo sapiens OX=9606 GN=RFC4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|Q9BXJ9|NAA15_HUMAN	N-alpha-acetyltransferase 15, NatA auxiliary subunit OS=Homo sapiens OX=9606 GN=NAA15 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null	721-UNIMOD:4	0.02	23.0	3	2	1
PRT	sp|P16930-2|FAAA_HUMAN	Isoform 2 of Fumarylacetoacetase OS=Homo sapiens OX=9606 GN=FAH	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|Q9Y617|SERC_HUMAN	Phosphoserine aminotransferase OS=Homo sapiens OX=9606 GN=PSAT1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.03	23.0	4	1	0
PRT	sp|Q9NX20|RM16_HUMAN	39S ribosomal protein L16, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL16 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.05	23.0	1	1	1
PRT	sp|Q969X5-2|ERGI1_HUMAN	Isoform 2 of Endoplasmic reticulum-Golgi intermediate compartment protein 1 OS=Homo sapiens OX=9606 GN=ERGIC1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.06	23.0	1	1	1
PRT	sp|P51648-2|AL3A2_HUMAN	Isoform 2 of Fatty aldehyde dehydrogenase OS=Homo sapiens OX=9606 GN=ALDH3A2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q15818|NPTX1_HUMAN	Neuronal pentraxin-1 OS=Homo sapiens OX=9606 GN=NPTX1 PE=2 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|P30153|2AAA_HUMAN	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Homo sapiens OX=9606 GN=PPP2R1A PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null	174-UNIMOD:4	0.06	23.0	3	3	3
PRT	sp|Q8TCT9-2|HM13_HUMAN	Isoform 2 of Minor histocompatibility antigen H13 OS=Homo sapiens OX=9606 GN=HM13	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q9ULZ3-3|ASC_HUMAN	Isoform 3 of Apoptosis-associated speck-like protein containing a CARD OS=Homo sapiens OX=9606 GN=PYCARD	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.09	23.0	1	1	1
PRT	sp|Q15418|KS6A1_HUMAN	Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens OX=9606 GN=RPS6KA1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null	432-UNIMOD:4	0.02	23.0	1	1	1
PRT	sp|Q8IYU8|MICU2_HUMAN	Calcium uptake protein 2, mitochondrial OS=Homo sapiens OX=9606 GN=MICU2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|P55786|PSA_HUMAN	Puromycin-sensitive aminopeptidase OS=Homo sapiens OX=9606 GN=NPEPPS PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.02	23.0	2	1	0
PRT	sp|O94906|PRP6_HUMAN	Pre-mRNA-processing factor 6 OS=Homo sapiens OX=9606 GN=PRPF6 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null	522-UNIMOD:4	0.08	23.0	6	6	6
PRT	sp|Q32P28|P3H1_HUMAN	Prolyl 3-hydroxylase 1 OS=Homo sapiens OX=9606 GN=P3H1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null	282-UNIMOD:4	0.07	23.0	4	4	4
PRT	sp|Q9UBT2|SAE2_HUMAN	SUMO-activating enzyme subunit 2 OS=Homo sapiens OX=9606 GN=UBA2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null	158-UNIMOD:4,161-UNIMOD:4	0.06	23.0	4	3	2
PRT	sp|P11171-5|41_HUMAN	Isoform 5 of Protein 4.1 OS=Homo sapiens OX=9606 GN=EPB41	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.06	23.0	3	3	3
PRT	sp|O95239-2|KIF4A_HUMAN	Isoform 2 of Chromosome-associated kinesin KIF4A OS=Homo sapiens OX=9606 GN=KIF4A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|P05556|ITB1_HUMAN	Integrin beta-1 OS=Homo sapiens OX=9606 GN=ITGB1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null	613-UNIMOD:4,615-UNIMOD:4,618-UNIMOD:4,691-UNIMOD:4	0.05	23.0	3	3	3
PRT	sp|Q9H9A6|LRC40_HUMAN	Leucine-rich repeat-containing protein 40 OS=Homo sapiens OX=9606 GN=LRRC40 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q8NFU3|TSTD1_HUMAN	Thiosulfate:glutathione sulfurtransferase OS=Homo sapiens OX=9606 GN=TSTD1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.10	23.0	1	1	1
PRT	sp|O14936-2|CSKP_HUMAN	Isoform 2 of Peripheral plasma membrane protein CASK OS=Homo sapiens OX=9606 GN=CASK	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q9H0U4|RAB1B_HUMAN	Ras-related protein Rab-1B OS=Homo sapiens OX=9606 GN=RAB1B PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.08	23.0	1	1	1
PRT	sp|Q8NBJ4|GOLM1_HUMAN	Golgi membrane protein 1 OS=Homo sapiens OX=9606 GN=GOLM1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	23.0	null		0.06	23.0	2	2	2
PRT	sp|O96017-13|CHK2_HUMAN	Isoform 13 of Serine/threonine-protein kinase Chk2 OS=Homo sapiens OX=9606 GN=CHEK2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null	10-UNIMOD:4	0.04	23.0	1	1	1
PRT	sp|Q9UQN3|CHM2B_HUMAN	Charged multivesicular body protein 2b OS=Homo sapiens OX=9606 GN=CHMP2B PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.05	23.0	2	1	0
PRT	sp|Q9UKI8-4|TLK1_HUMAN	Isoform 4 of Serine/threonine-protein kinase tousled-like 1 OS=Homo sapiens OX=9606 GN=TLK1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q9BVP2-2|GNL3_HUMAN	Isoform 2 of Guanine nucleotide-binding protein-like 3 OS=Homo sapiens OX=9606 GN=GNL3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q0VDF9|HSP7E_HUMAN	Heat shock 70 kDa protein 14 OS=Homo sapiens OX=9606 GN=HSPA14 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null	492-UNIMOD:4	0.06	23.0	2	2	2
PRT	sp|Q08379|GOGA2_HUMAN	Golgin subfamily A member 2 OS=Homo sapiens OX=9606 GN=GOLGA2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q69YN2|C19L1_HUMAN	CWF19-like protein 1 OS=Homo sapiens OX=9606 GN=CWF19L1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null	511-UNIMOD:4	0.03	23.0	1	1	1
PRT	sp|Q99536-3|VAT1_HUMAN	Isoform 3 of Synaptic vesicle membrane protein VAT-1 homolog OS=Homo sapiens OX=9606 GN=VAT1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.06	23.0	1	1	1
PRT	sp|Q6UW68|TM205_HUMAN	Transmembrane protein 205 OS=Homo sapiens OX=9606 GN=TMEM205 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.11	23.0	2	1	0
PRT	sp|Q02952|AKA12_HUMAN	A-kinase anchor protein 12 OS=Homo sapiens OX=9606 GN=AKAP12 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1000663, ProteinPilot, ]	23.0	null		0.01	23.0	2	2	2
PRT	sp|Q96AE4|FUBP1_HUMAN	Far upstream element-binding protein 1 OS=Homo sapiens OX=9606 GN=FUBP1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null		0.02	23.0	2	1	0
PRT	sp|Q14157|UBP2L_HUMAN	Ubiquitin-associated protein 2-like OS=Homo sapiens OX=9606 GN=UBAP2L PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23.0	null	27-UNIMOD:28	0.01	23.0	1	1	0
PRT	sp|P27824|CALX_HUMAN	Calnexin OS=Homo sapiens OX=9606 GN=CANX PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	23.0	null		0.04	23.0	2	2	1
PRT	sp|P60981|DEST_HUMAN	Destrin OS=Homo sapiens OX=9606 GN=DSTN PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	135-UNIMOD:4	0.08	23.0	1	1	0
PRT	sp|O14744|ANM5_HUMAN	Protein arginine N-methyltransferase 5 OS=Homo sapiens OX=9606 GN=PRMT5 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23.0	null	2-UNIMOD:1	0.02	23.0	1	1	1
PRT	sp|P0DPI2|GAL3A_HUMAN	Glutamine amidotransferase-like class 1 domain-containing protein 3A, mitochondrial OS=Homo sapiens OX=9606 GN=GATD3A PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null		0.06	23.0	1	1	1
PRT	sp|Q5VWZ2|LYPL1_HUMAN	Lysophospholipase-like protein 1 OS=Homo sapiens OX=9606 GN=LYPLAL1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23.0	null	2-UNIMOD:1	0.05	23.0	1	1	1
PRT	sp|P62328|TYB4_HUMAN	Thymosin beta-4 OS=Homo sapiens OX=9606 GN=TMSB4X PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23.0	null	2-UNIMOD:1,7-UNIMOD:35	0.27	23.0	2	1	0
PRT	sp|Q96B54|ZN428_HUMAN	Zinc finger protein 428 OS=Homo sapiens OX=9606 GN=ZNF428 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	114-UNIMOD:4,115-UNIMOD:4	0.10	23.0	1	1	1
PRT	sp|O00255|MEN1_HUMAN	Menin OS=Homo sapiens OX=9606 GN=MEN1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q9UKD2|MRT4_HUMAN	mRNA turnover protein 4 homolog OS=Homo sapiens OX=9606 GN=MRTO4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null		0.05	23.0	2	1	0
PRT	sp|P62913|RL11_HUMAN	60S ribosomal protein L11 OS=Homo sapiens OX=9606 GN=RPL11 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null		0.06	23.0	3	2	1
PRT	sp|P35606|COPB2_HUMAN	Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null		0.02	23.0	2	1	0
PRT	sp|Q92793|CBP_HUMAN	CREB-binding protein OS=Homo sapiens OX=9606 GN=CREBBP PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|P05787|K2C8_HUMAN	Keratin, type II cytoskeletal 8 OS=Homo sapiens OX=9606 GN=KRT8 PE=1 SV=7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null		0.03	23.0	1	1	0
PRT	sp|O75369|FLNB_HUMAN	Filamin-B OS=Homo sapiens OX=9606 GN=FLNB PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null		0.00	23.0	2	1	0
PRT	sp|Q06124|PTN11_HUMAN	Tyrosine-protein phosphatase non-receptor type 11 OS=Homo sapiens OX=9606 GN=PTPN11 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	104-UNIMOD:4	0.02	23.0	1	1	0
PRT	sp|P39019|RS19_HUMAN	40S ribosomal protein S19 OS=Homo sapiens OX=9606 GN=RPS19 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.14	22.0	2	2	2
PRT	sp|P61254|RL26_HUMAN	60S ribosomal protein L26 OS=Homo sapiens OX=9606 GN=RPL26 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.08	22.0	3	1	0
PRT	sp|Q9BQG0-2|MBB1A_HUMAN	Isoform 2 of Myb-binding protein 1A OS=Homo sapiens OX=9606 GN=MYBBP1A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.03	22.0	3	3	3
PRT	sp|Q9UNZ5|L10K_HUMAN	Leydig cell tumor 10 kDa protein homolog OS=Homo sapiens OX=9606 GN=C19orf53 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.10	22.0	1	1	1
PRT	sp|Q02880-2|TOP2B_HUMAN	Isoform Beta-1 of DNA topoisomerase 2-beta OS=Homo sapiens OX=9606 GN=TOP2B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.02	22.0	3	3	3
PRT	sp|Q3ZCQ8|TIM50_HUMAN	Mitochondrial import inner membrane translocase subunit TIM50 OS=Homo sapiens OX=9606 GN=TIMM50 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.09	22.0	2	2	2
PRT	sp|P53007|TXTP_HUMAN	Tricarboxylate transport protein, mitochondrial OS=Homo sapiens OX=9606 GN=SLC25A1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.04	22.0	3	1	0
PRT	sp|P20933|ASPG_HUMAN	N(4)-(beta-N-acetylglucosaminyl)-L-asparaginase OS=Homo sapiens OX=9606 GN=AGA PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|P10599-2|THIO_HUMAN	Isoform 2 of Thioredoxin OS=Homo sapiens OX=9606 GN=TXN	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.12	22.0	1	1	1
PRT	sp|Q14151|SAFB2_HUMAN	Scaffold attachment factor B2 OS=Homo sapiens OX=9606 GN=SAFB2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q9UNH7|SNX6_HUMAN	Sorting nexin-6 OS=Homo sapiens OX=9606 GN=SNX6 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	22.0	null		0.08	22.0	3	3	3
PRT	sp|P40937-2|RFC5_HUMAN	Isoform 2 of Replication factor C subunit 5 OS=Homo sapiens OX=9606 GN=RFC5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|Q9NRL3-3|STRN4_HUMAN	Isoform 3 of Striatin-4 OS=Homo sapiens OX=9606 GN=STRN4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null	569-UNIMOD:4	0.03	22.0	2	2	2
PRT	sp|P00491|PNPH_HUMAN	Purine nucleoside phosphorylase OS=Homo sapiens OX=9606 GN=PNP PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|Q8TDN6|BRX1_HUMAN	Ribosome biogenesis protein BRX1 homolog OS=Homo sapiens OX=9606 GN=BRIX1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.03	22.0	2	1	0
PRT	sp|Q9P0J7|KCMF1_HUMAN	E3 ubiquitin-protein ligase KCMF1 OS=Homo sapiens OX=9606 GN=KCMF1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null	9-UNIMOD:4,12-UNIMOD:4	0.03	22.0	1	1	1
PRT	sp|O96005-4|CLPT1_HUMAN	Isoform 3 of Cleft lip and palate transmembrane protein 1 OS=Homo sapiens OX=9606 GN=CLPTM1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|O60869-3|EDF1_HUMAN	Isoform 3 of Endothelial differentiation-related factor 1 OS=Homo sapiens OX=9606 GN=EDF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.09	22.0	1	1	1
PRT	sp|P83881|RL36A_HUMAN	60S ribosomal protein L36a OS=Homo sapiens OX=9606 GN=RPL36A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null	72-UNIMOD:4,77-UNIMOD:4	0.19	22.0	4	3	2
PRT	sp|Q9H1A4|APC1_HUMAN	Anaphase-promoting complex subunit 1 OS=Homo sapiens OX=9606 GN=ANAPC1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q07866-4|KLC1_HUMAN	Isoform J of Kinesin light chain 1 OS=Homo sapiens OX=9606 GN=KLC1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.05	22.0	3	3	3
PRT	sp|Q96IJ6-2|GMPPA_HUMAN	Isoform 2 of Mannose-1-phosphate guanyltransferase alpha OS=Homo sapiens OX=9606 GN=GMPPA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|P62829|RL23_HUMAN	60S ribosomal protein L23 OS=Homo sapiens OX=9606 GN=RPL23 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.15	22.0	2	2	2
PRT	sp|Q9UBL3-3|ASH2L_HUMAN	Isoform 3 of Set1/Ash2 histone methyltransferase complex subunit ASH2 OS=Homo sapiens OX=9606 GN=ASH2L	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|P26599-2|PTBP1_HUMAN	Isoform 2 of Polypyrimidine tract-binding protein 1 OS=Homo sapiens OX=9606 GN=PTBP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.03	22.0	4	2	1
PRT	sp|Q16555-2|DPYL2_HUMAN	Isoform 2 of Dihydropyrimidinase-related protein 2 OS=Homo sapiens OX=9606 GN=DPYSL2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.02	22.0	2	1	0
PRT	sp|P09012|SNRPA_HUMAN	U1 small nuclear ribonucleoprotein A OS=Homo sapiens OX=9606 GN=SNRPA PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|P82675|RT05_HUMAN	28S ribosomal protein S5, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS5 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|P28799-3|GRN_HUMAN	Isoform 3 of Granulins OS=Homo sapiens OX=9606 GN=GRN	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null	301-UNIMOD:4,302-UNIMOD:4,308-UNIMOD:4	0.03	22.0	1	1	0
PRT	sp|P48643|TCPE_HUMAN	T-complex protein 1 subunit epsilon OS=Homo sapiens OX=9606 GN=CCT5 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.08	22.0	6	4	3
PRT	sp|P49406|RM19_HUMAN	39S ribosomal protein L19, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL19 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|Q10589-2|BST2_HUMAN	Isoform 2 of Bone marrow stromal antigen 2 OS=Homo sapiens OX=9606 GN=BST2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.07	22.0	1	1	1
PRT	sp|P28070|PSB4_HUMAN	Proteasome subunit beta type-4 OS=Homo sapiens OX=9606 GN=PSMB4 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|P61081|UBC12_HUMAN	NEDD8-conjugating enzyme Ubc12 OS=Homo sapiens OX=9606 GN=UBE2M PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.06	22.0	1	1	1
PRT	sp|P05388-2|RLA0_HUMAN	Isoform 2 of 60S acidic ribosomal protein P0 OS=Homo sapiens OX=9606 GN=RPLP0	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.05	22.0	2	1	0
PRT	sp|Q9ULX6|AKP8L_HUMAN	A-kinase anchor protein 8-like OS=Homo sapiens OX=9606 GN=AKAP8L PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null	128-UNIMOD:4	0.02	22.0	1	1	1
PRT	sp|Q14554|PDIA5_HUMAN	Protein disulfide-isomerase A5 OS=Homo sapiens OX=9606 GN=PDIA5 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	22.0	null	465-UNIMOD:4,451-UNIMOD:4,456-UNIMOD:4	0.04	22.0	2	2	2
PRT	sp|O76021|RL1D1_HUMAN	Ribosomal L1 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=RSL1D1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|P02545-3|LMNA_HUMAN	Isoform ADelta10 of Prelamin-A/C OS=Homo sapiens OX=9606 GN=LMNA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.06	22.0	3	3	3
PRT	sp|Q99567|NUP88_HUMAN	Nuclear pore complex protein Nup88 OS=Homo sapiens OX=9606 GN=NUP88 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null	155-UNIMOD:4	0.02	22.0	1	1	1
PRT	sp|Q9GZR7|DDX24_HUMAN	ATP-dependent RNA helicase DDX24 OS=Homo sapiens OX=9606 GN=DDX24 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null	832-UNIMOD:4	0.03	22.0	2	2	2
PRT	sp|Q9BUQ8|DDX23_HUMAN	Probable ATP-dependent RNA helicase DDX23 OS=Homo sapiens OX=9606 GN=DDX23 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null	692-UNIMOD:4	0.02	22.0	1	1	1
PRT	sp|P09972|ALDOC_HUMAN	Fructose-bisphosphate aldolase C OS=Homo sapiens OX=9606 GN=ALDOC PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|P06576|ATPB_HUMAN	ATP synthase subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1B PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.02	22.0	3	1	0
PRT	sp|P52788|SPSY_HUMAN	Spermine synthase OS=Homo sapiens OX=9606 GN=SMS PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|Q8NI36|WDR36_HUMAN	WD repeat-containing protein 36 OS=Homo sapiens OX=9606 GN=WDR36 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.02	22.0	2	2	2
PRT	sp|P60900|PSA6_HUMAN	Proteasome subunit alpha type-6 OS=Homo sapiens OX=9606 GN=PSMA6 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null	47-UNIMOD:4	0.09	22.0	3	2	1
PRT	sp|Q9ULV4-3|COR1C_HUMAN	Isoform 3 of Coronin-1C OS=Homo sapiens OX=9606 GN=CORO1C	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null	243-UNIMOD:4,76-UNIMOD:4	0.04	22.0	3	2	1
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.01	22.0	2	2	2
PRT	sp|P67870|CSK2B_HUMAN	Casein kinase II subunit beta OS=Homo sapiens OX=9606 GN=CSNK2B PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	22.0	null		0.05	22.0	3	1	0
PRT	sp|P14209-3|CD99_HUMAN	Isoform 3 of CD99 antigen OS=Homo sapiens OX=9606 GN=CD99	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.09	22.0	1	1	1
PRT	sp|Q9UBE0|SAE1_HUMAN	SUMO-activating enzyme subunit 1 OS=Homo sapiens OX=9606 GN=SAE1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|O15427|MOT4_HUMAN	Monocarboxylate transporter 4 OS=Homo sapiens OX=9606 GN=SLC16A3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|Q99543|DNJC2_HUMAN	DnaJ homolog subfamily C member 2 OS=Homo sapiens OX=9606 GN=DNAJC2 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q9Y696|CLIC4_HUMAN	Chloride intracellular channel protein 4 OS=Homo sapiens OX=9606 GN=CLIC4 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null	234-UNIMOD:4	0.10	22.0	4	2	1
PRT	sp|P30038-2|AL4A1_HUMAN	Isoform 2 of Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ALDH4A1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.05	22.0	2	2	2
PRT	sp|Q8N5F7|NKAP_HUMAN	NF-kappa-B-activating protein OS=Homo sapiens OX=9606 GN=NKAP PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|P14635-2|CCNB1_HUMAN	Isoform 2 of G2/mitotic-specific cyclin-B1 OS=Homo sapiens OX=9606 GN=CCNB1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|P52657|T2AG_HUMAN	Transcription initiation factor IIA subunit 2 OS=Homo sapiens OX=9606 GN=GTF2A2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.09	22.0	1	1	1
PRT	sp|P49773|HINT1_HUMAN	Histidine triad nucleotide-binding protein 1 OS=Homo sapiens OX=9606 GN=HINT1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null	84-UNIMOD:4	0.08	22.0	2	1	0
PRT	sp|Q9BZE9-2|ASPC1_HUMAN	Isoform 2 of Tether containing UBX domain for GLUT4 OS=Homo sapiens OX=9606 GN=ASPSCR1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|P84243|H33_HUMAN	Histone H3.3 OS=Homo sapiens OX=9606 GN=H3F3A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.07	22.0	7	1	0
PRT	sp|Q9Y3F4-2|STRAP_HUMAN	Isoform 2 of Serine-threonine kinase receptor-associated protein OS=Homo sapiens OX=9606 GN=STRAP	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.07	22.0	3	2	0
PRT	sp|P27144|KAD4_HUMAN	Adenylate kinase 4, mitochondrial OS=Homo sapiens OX=9606 GN=AK4 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.05	22.0	1	1	1
PRT	sp|Q96I24|FUBP3_HUMAN	Far upstream element-binding protein 3 OS=Homo sapiens OX=9606 GN=FUBP3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|Q96G03|PGM2_HUMAN	Phosphoglucomutase-2 OS=Homo sapiens OX=9606 GN=PGM2 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1001476, X!Tandem, ]	22.0	null	2-UNIMOD:1	0.05	22.0	2	2	2
PRT	sp|Q99426-2|TBCB_HUMAN	Isoform 2 of Tubulin-folding cofactor B OS=Homo sapiens OX=9606 GN=TBCB	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.10	22.0	2	2	2
PRT	sp|Q14978-2|NOLC1_HUMAN	Isoform Beta of Nucleolar and coiled-body phosphoprotein 1 OS=Homo sapiens OX=9606 GN=NOLC1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.05	22.0	7	3	1
PRT	sp|Q9NRV9|HEBP1_HUMAN	Heme-binding protein 1 OS=Homo sapiens OX=9606 GN=HEBP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.21	22.0	3	3	3
PRT	sp|Q9NXS2-3|QPCTL_HUMAN	Isoform 2 of Glutaminyl-peptide cyclotransferase-like protein OS=Homo sapiens OX=9606 GN=QPCTL	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|Q86V21|AACS_HUMAN	Acetoacetyl-CoA synthetase OS=Homo sapiens OX=9606 GN=AACS PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q9BZD4|NUF2_HUMAN	Kinetochore protein Nuf2 OS=Homo sapiens OX=9606 GN=NUF2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|P47897-2|SYQ_HUMAN	Isoform 2 of Glutamine--tRNA ligase OS=Homo sapiens OX=9606 GN=QARS	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.03	22.0	7	2	1
PRT	sp|P13645|K1C10_HUMAN	Keratin, type I cytoskeletal 10 OS=Homo sapiens OX=9606 GN=KRT10 PE=1 SV=6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|Q8N7H5-2|PAF1_HUMAN	Isoform 2 of RNA polymerase II-associated factor 1 homolog OS=Homo sapiens OX=9606 GN=PAF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q9NY26-2|S39A1_HUMAN	Isoform 2 of Zinc transporter ZIP1 OS=Homo sapiens OX=9606 GN=SLC39A1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.06	22.0	1	1	1
PRT	sp|Q9UPN9-2|TRI33_HUMAN	Isoform Beta of E3 ubiquitin-protein ligase TRIM33 OS=Homo sapiens OX=9606 GN=TRIM33	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|P53992|SC24C_HUMAN	Protein transport protein Sec24C OS=Homo sapiens OX=9606 GN=SEC24C PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.01	22.0	2	1	0
PRT	sp|P15529-5|MCP_HUMAN	Isoform H of Membrane cofactor protein OS=Homo sapiens OX=9606 GN=CD46	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|P50750-2|CDK9_HUMAN	Isoform 2 of Cyclin-dependent kinase 9 OS=Homo sapiens OX=9606 GN=CDK9	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|Q92499-3|DDX1_HUMAN	Isoform 3 of ATP-dependent RNA helicase DDX1 OS=Homo sapiens OX=9606 GN=DDX1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null	414-UNIMOD:4,416-UNIMOD:4	0.06	22.0	4	3	2
PRT	sp|Q15269|PWP2_HUMAN	Periodic tryptophan protein 2 homolog OS=Homo sapiens OX=9606 GN=PWP2 PE=2 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q99417|MYCBP_HUMAN	c-Myc-binding protein OS=Homo sapiens OX=9606 GN=MYCBP PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	22.0	null		0.23	22.0	2	2	2
PRT	sp|O94973-2|AP2A2_HUMAN	Isoform 2 of AP-2 complex subunit alpha-2 OS=Homo sapiens OX=9606 GN=AP2A2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|P83731|RL24_HUMAN	60S ribosomal protein L24 OS=Homo sapiens OX=9606 GN=RPL24 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null	36-UNIMOD:4	0.06	22.0	2	1	0
PRT	sp|Q9BRD0|BUD13_HUMAN	BUD13 homolog OS=Homo sapiens OX=9606 GN=BUD13 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q16763|UBE2S_HUMAN	Ubiquitin-conjugating enzyme E2 S OS=Homo sapiens OX=9606 GN=UBE2S PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.07	22.0	1	1	1
PRT	sp|Q9Y3B4|SF3B6_HUMAN	Splicing factor 3B subunit 6 OS=Homo sapiens OX=9606 GN=SF3B6 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.08	22.0	3	1	0
PRT	sp|P53597|SUCA_HUMAN	Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=SUCLG1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null	60-UNIMOD:4	0.03	22.0	1	1	1
PRT	sp|O00429-2|DNM1L_HUMAN	Isoform 4 of Dynamin-1-like protein OS=Homo sapiens OX=9606 GN=DNM1L	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q13616|CUL1_HUMAN	Cullin-1 OS=Homo sapiens OX=9606 GN=CUL1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null	291-UNIMOD:4,496-UNIMOD:4	0.05	22.0	4	4	4
PRT	sp|Q99747|SNAG_HUMAN	Gamma-soluble NSF attachment protein OS=Homo sapiens OX=9606 GN=NAPG PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.07	22.0	2	2	2
PRT	sp|P41227-2|NAA10_HUMAN	Isoform 2 of N-alpha-acetyltransferase 10 OS=Homo sapiens OX=9606 GN=NAA10	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.05	22.0	1	1	1
PRT	sp|Q02252-2|MMSA_HUMAN	Isoform 2 of Methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial OS=Homo sapiens OX=9606 GN=ALDH6A1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null	355-UNIMOD:4	0.04	22.0	2	2	2
PRT	sp|Q9P2R3-4|ANFY1_HUMAN	Isoform 4 of Rabankyrin-5 OS=Homo sapiens OX=9606 GN=ANKFY1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|P06733|ENOA_HUMAN	Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	22.0	null		0.07	22.0	9	3	1
PRT	sp|Q9HAU0-6|PKHA5_HUMAN	Isoform 6 of Pleckstrin homology domain-containing family A member 5 OS=Homo sapiens OX=9606 GN=PLEKHA5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q14008-3|CKAP5_HUMAN	Isoform 3 of Cytoskeleton-associated protein 5 OS=Homo sapiens OX=9606 GN=CKAP5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|O14929|HAT1_HUMAN	Histone acetyltransferase type B catalytic subunit OS=Homo sapiens OX=9606 GN=HAT1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null	27-UNIMOD:4	0.03	22.0	2	1	0
PRT	sp|Q99615|DNJC7_HUMAN	DnaJ homolog subfamily C member 7 OS=Homo sapiens OX=9606 GN=DNAJC7 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|P36871|PGM1_HUMAN	Phosphoglucomutase-1 OS=Homo sapiens OX=9606 GN=PGM1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q9BR76|COR1B_HUMAN	Coronin-1B OS=Homo sapiens OX=9606 GN=CORO1B PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null	25-UNIMOD:4	0.02	22.0	1	1	1
PRT	sp|Q99460|PSMD1_HUMAN	26S proteasome non-ATPase regulatory subunit 1 OS=Homo sapiens OX=9606 GN=PSMD1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1000663, ProteinPilot, ]	22.0	null	659-UNIMOD:4,660-UNIMOD:4	0.01	22.0	1	1	1
PRT	sp|Q16204|CCDC6_HUMAN	Coiled-coil domain-containing protein 6 OS=Homo sapiens OX=9606 GN=CCDC6 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.07	22.0	3	3	3
PRT	sp|Q9NPI1-2|BRD7_HUMAN	Isoform 2 of Bromodomain-containing protein 7 OS=Homo sapiens OX=9606 GN=BRD7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null	338-UNIMOD:4	0.02	22.0	1	1	1
PRT	sp|O15305|PMM2_HUMAN	Phosphomannomutase 2 OS=Homo sapiens OX=9606 GN=PMM2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.05	22.0	1	1	1
PRT	sp|Q9NSE4|SYIM_HUMAN	Isoleucine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=IARS2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null	1002-UNIMOD:4	0.02	22.0	2	2	2
PRT	sp|Q8TAF3|WDR48_HUMAN	WD repeat-containing protein 48 OS=Homo sapiens OX=9606 GN=WDR48 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null	225-UNIMOD:4	0.04	22.0	2	2	2
PRT	sp|P82970|HMGN5_HUMAN	High mobility group nucleosome-binding domain-containing protein 5 OS=Homo sapiens OX=9606 GN=HMGN5 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.09	22.0	2	2	2
PRT	sp|P62191|PRS4_HUMAN	26S proteasome regulatory subunit 4 OS=Homo sapiens OX=9606 GN=PSMC1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null	58-UNIMOD:4	0.07	22.0	3	3	3
PRT	sp|Q06323-2|PSME1_HUMAN	Isoform 2 of Proteasome activator complex subunit 1 OS=Homo sapiens OX=9606 GN=PSME1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null	101-UNIMOD:4,106-UNIMOD:4	0.10	22.0	2	2	2
PRT	sp|Q02750|MP2K1_HUMAN	Dual specificity mitogen-activated protein kinase kinase 1 OS=Homo sapiens OX=9606 GN=MAP2K1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|P13637-2|AT1A3_HUMAN	Isoform 2 of Sodium/potassium-transporting ATPase subunit alpha-3 OS=Homo sapiens OX=9606 GN=ATP1A3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null	60-UNIMOD:4	0.01	22.0	1	1	1
PRT	sp|Q9NX02|NALP2_HUMAN	NACHT, LRR and PYD domains-containing protein 2 OS=Homo sapiens OX=9606 GN=NLRP2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.03	22.0	3	3	3
PRT	sp|P62979|RS27A_HUMAN	Ubiquitin-40S ribosomal protein S27a OS=Homo sapiens OX=9606 GN=RPS27A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.13	22.0	5	2	1
PRT	sp|P25685-2|DNJB1_HUMAN	Isoform 2 of DnaJ homolog subfamily B member 1 OS=Homo sapiens OX=9606 GN=DNAJB1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.10	22.0	2	2	2
PRT	sp|P55884-2|EIF3B_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit B OS=Homo sapiens OX=9606 GN=EIF3B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.01	22.0	2	1	0
PRT	sp|P05141|ADT2_HUMAN	ADP/ATP translocase 2 OS=Homo sapiens OX=9606 GN=SLC25A5 PE=1 SV=7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.04	22.0	2	1	0
PRT	sp|Q9HCC0-2|MCCB_HUMAN	Isoform 2 of Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial OS=Homo sapiens OX=9606 GN=MCCC2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.07	22.0	3	3	3
PRT	sp|Q13310-2|PABP4_HUMAN	Isoform 2 of Polyadenylate-binding protein 4 OS=Homo sapiens OX=9606 GN=PABPC4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.03	22.0	2	2	2
PRT	sp|O60684|IMA7_HUMAN	Importin subunit alpha-7 OS=Homo sapiens OX=9606 GN=KPNA6 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q9Y3A5|SBDS_HUMAN	Ribosome maturation protein SBDS OS=Homo sapiens OX=9606 GN=SBDS PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|P46940|IQGA1_HUMAN	Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens OX=9606 GN=IQGAP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null	1534-UNIMOD:4	0.02	22.0	5	4	3
PRT	sp|P05026-2|AT1B1_HUMAN	Isoform 2 of Sodium/potassium-transporting ATPase subunit beta-1 OS=Homo sapiens OX=9606 GN=ATP1B1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|Q9UH65|SWP70_HUMAN	Switch-associated protein 70 OS=Homo sapiens OX=9606 GN=SWAP70 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.05	22.0	3	3	3
PRT	sp|P60228|EIF3E_HUMAN	Eukaryotic translation initiation factor 3 subunit E OS=Homo sapiens OX=9606 GN=EIF3E PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.05	22.0	4	2	0
PRT	sp|O43395|PRPF3_HUMAN	U4/U6 small nuclear ribonucleoprotein Prp3 OS=Homo sapiens OX=9606 GN=PRPF3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001207, Mascot, ]	22.0	null		0.02	22.0	2	1	0
PRT	sp|P34896-2|GLYC_HUMAN	Isoform 2 of Serine hydroxymethyltransferase, cytosolic OS=Homo sapiens OX=9606 GN=SHMT1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null	341-UNIMOD:4,345-UNIMOD:4	0.03	22.0	1	1	1
PRT	sp|Q969U7-2|PSMG2_HUMAN	Isoform 2 of Proteasome assembly chaperone 2 OS=Homo sapiens OX=9606 GN=PSMG2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.06	22.0	1	1	1
PRT	sp|O75955-2|FLOT1_HUMAN	Isoform 2 of Flotillin-1 OS=Homo sapiens OX=9606 GN=FLOT1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.07	22.0	4	2	1
PRT	sp|Q9Y3Z3-4|SAMH1_HUMAN	Isoform 4 of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 OS=Homo sapiens OX=9606 GN=SAMHD1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null	341-UNIMOD:4	0.04	22.0	2	2	2
PRT	sp|Q9BWJ5|SF3B5_HUMAN	Splicing factor 3B subunit 5 OS=Homo sapiens OX=9606 GN=SF3B5 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	22.0	null	76-UNIMOD:4	0.19	22.0	4	1	0
PRT	sp|P53582|MAP11_HUMAN	Methionine aminopeptidase 1 OS=Homo sapiens OX=9606 GN=METAP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null	22-UNIMOD:4,25-UNIMOD:4	0.06	22.0	2	2	2
PRT	sp|O75390|CISY_HUMAN	Citrate synthase, mitochondrial OS=Homo sapiens OX=9606 GN=CS PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.03	22.0	2	1	0
PRT	sp|P20674|COX5A_HUMAN	Cytochrome c oxidase subunit 5A, mitochondrial OS=Homo sapiens OX=9606 GN=COX5A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.07	22.0	2	2	2
PRT	sp|Q99459|CDC5L_HUMAN	Cell division cycle 5-like protein OS=Homo sapiens OX=9606 GN=CDC5L PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001207, Mascot, ]	22.0	null		0.05	22.0	3	3	3
PRT	sp|P46782|RS5_HUMAN	40S ribosomal protein S5 OS=Homo sapiens OX=9606 GN=RPS5 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null	66-UNIMOD:4	0.09	22.0	4	2	0
PRT	sp|P23634-8|AT2B4_HUMAN	Isoform ZD of Plasma membrane calcium-transporting ATPase 4 OS=Homo sapiens OX=9606 GN=ATP2B4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|P08574|CY1_HUMAN	Cytochrome c1, heme protein, mitochondrial OS=Homo sapiens OX=9606 GN=CYC1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null	139-UNIMOD:4	0.04	22.0	1	1	1
PRT	sp|Q9BRG1|VPS25_HUMAN	Vacuolar protein-sorting-associated protein 25 OS=Homo sapiens OX=9606 GN=VPS25 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.06	22.0	1	1	1
PRT	sp|Q5VWZ2-2|LYPL1_HUMAN	Isoform 2 of Lysophospholipase-like protein 1 OS=Homo sapiens OX=9606 GN=LYPLAL1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.05	22.0	1	1	1
PRT	sp|Q96KP4|CNDP2_HUMAN	Cytosolic non-specific dipeptidase OS=Homo sapiens OX=9606 GN=CNDP2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.05	22.0	2	2	2
PRT	sp|Q96HY7|DHTK1_HUMAN	Probable 2-oxoglutarate dehydrogenase E1 component DHKTD1, mitochondrial OS=Homo sapiens OX=9606 GN=DHTKD1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null	383-UNIMOD:4	0.01	22.0	1	1	1
PRT	sp|P49207|RL34_HUMAN	60S ribosomal protein L34 OS=Homo sapiens OX=9606 GN=RPL34 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.09	22.0	1	1	1
PRT	sp|P50336|PPOX_HUMAN	Protoporphyrinogen oxidase OS=Homo sapiens OX=9606 GN=PPOX PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.05	22.0	2	2	2
PRT	sp|Q8IXT5|RB12B_HUMAN	RNA-binding protein 12B OS=Homo sapiens OX=9606 GN=RBM12B PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null	204-UNIMOD:4	0.01	22.0	1	1	1
PRT	sp|Q96ST3|SIN3A_HUMAN	Paired amphipathic helix protein Sin3a OS=Homo sapiens OX=9606 GN=SIN3A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.03	22.0	3	3	3
PRT	sp|O43815-2|STRN_HUMAN	Isoform 2 of Striatin OS=Homo sapiens OX=9606 GN=STRN	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null	691-UNIMOD:4,538-UNIMOD:4	0.03	22.0	2	2	2
PRT	sp|Q8N163|CCAR2_HUMAN	Cell cycle and apoptosis regulator protein 2 OS=Homo sapiens OX=9606 GN=CCAR2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null	754-UNIMOD:4	0.02	22.0	6	2	0
PRT	sp|P55081|MFAP1_HUMAN	Microfibrillar-associated protein 1 OS=Homo sapiens OX=9606 GN=MFAP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.03	22.0	2	1	0
PRT	sp|Q9UK41-2|VPS28_HUMAN	Isoform 2 of Vacuolar protein sorting-associated protein 28 homolog OS=Homo sapiens OX=9606 GN=VPS28	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null	60-UNIMOD:4,70-UNIMOD:4	0.06	22.0	1	1	1
PRT	sp|P16615-4|AT2A2_HUMAN	Isoform 4 of Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Homo sapiens OX=9606 GN=ATP2A2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null	337-UNIMOD:4	0.02	22.0	3	2	1
PRT	sp|Q8IX01-3|SUGP2_HUMAN	Isoform 3 of SURP and G-patch domain-containing protein 2 OS=Homo sapiens OX=9606 GN=SUGP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null	656-UNIMOD:4	0.04	22.0	3	3	3
PRT	sp|Q15031|SYLM_HUMAN	Probable leucine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=LARS2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.02	22.0	2	2	2
PRT	sp|Q96EB6|SIR1_HUMAN	NAD-dependent protein deacetylase sirtuin-1 OS=Homo sapiens OX=9606 GN=SIRT1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null	380-UNIMOD:4	0.03	22.0	2	2	2
PRT	sp|Q14244-7|MAP7_HUMAN	Isoform 7 of Ensconsin OS=Homo sapiens OX=9606 GN=MAP7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q13823|NOG2_HUMAN	Nucleolar GTP-binding protein 2 OS=Homo sapiens OX=9606 GN=GNL2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.04	22.0	2	2	2
PRT	sp|Q9H2P0|ADNP_HUMAN	Activity-dependent neuroprotector homeobox protein OS=Homo sapiens OX=9606 GN=ADNP PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.02	22.0	2	2	2
PRT	sp|Q9NXF1-2|TEX10_HUMAN	Isoform 2 of Testis-expressed protein 10 OS=Homo sapiens OX=9606 GN=TEX10	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q9ULT8|HECD1_HUMAN	E3 ubiquitin-protein ligase HECTD1 OS=Homo sapiens OX=9606 GN=HECTD1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|O60885|BRD4_HUMAN	Bromodomain-containing protein 4 OS=Homo sapiens OX=9606 GN=BRD4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q9BUF5|TBB6_HUMAN	Tubulin beta-6 chain OS=Homo sapiens OX=9606 GN=TUBB6 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.03	22.0	2	1	0
PRT	sp|Q9UL46|PSME2_HUMAN	Proteasome activator complex subunit 2 OS=Homo sapiens OX=9606 GN=PSME2 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	22.0	null		0.12	22.0	3	2	1
PRT	sp|Q96HN2-2|SAHH3_HUMAN	Isoform 2 of Adenosylhomocysteinase 3 OS=Homo sapiens OX=9606 GN=AHCYL2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|P80303-2|NUCB2_HUMAN	Isoform 2 of Nucleobindin-2 OS=Homo sapiens OX=9606 GN=NUCB2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.06	22.0	2	2	2
PRT	sp|Q9NXC5|MIO_HUMAN	GATOR complex protein MIOS OS=Homo sapiens OX=9606 GN=MIOS PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|P53634|CATC_HUMAN	Dipeptidyl peptidase 1 OS=Homo sapiens OX=9606 GN=CTSC PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.02	22.0	2	1	0
PRT	sp|Q96A72|MGN2_HUMAN	Protein mago nashi homolog 2 OS=Homo sapiens OX=9606 GN=MAGOHB PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.07	22.0	3	1	0
PRT	sp|Q9Y376|CAB39_HUMAN	Calcium-binding protein 39 OS=Homo sapiens OX=9606 GN=CAB39 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|Q08378|GOGA3_HUMAN	Golgin subfamily A member 3 OS=Homo sapiens OX=9606 GN=GOLGA3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|P49848-2|TAF6_HUMAN	Isoform 2 of Transcription initiation factor TFIID subunit 6 OS=Homo sapiens OX=9606 GN=TAF6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|O15400-2|STX7_HUMAN	Isoform 2 of Syntaxin-7 OS=Homo sapiens OX=9606 GN=STX7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null	28-UNIMOD:4	0.05	22.0	2	1	0
PRT	sp|Q14694-2|UBP10_HUMAN	Isoform 2 of Ubiquitin carboxyl-terminal hydrolase 10 OS=Homo sapiens OX=9606 GN=USP10	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.02	22.0	2	1	0
PRT	sp|Q99447-3|PCY2_HUMAN	Isoform 3 of Ethanolamine-phosphate cytidylyltransferase OS=Homo sapiens OX=9606 GN=PCYT2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.06	22.0	2	2	2
PRT	sp|Q8IXB1-2|DJC10_HUMAN	Isoform 2 of DnaJ homolog subfamily C member 10 OS=Homo sapiens OX=9606 GN=DNAJC10	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null	682-UNIMOD:4,689-UNIMOD:4	0.02	22.0	1	1	1
PRT	sp|Q6DD87|ZN787_HUMAN	Zinc finger protein 787 OS=Homo sapiens OX=9606 GN=ZNF787 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.04	22.0	2	1	0
PRT	sp|P63096-2|GNAI1_HUMAN	Isoform 2 of Guanine nucleotide-binding protein G(i) subunit alpha-1 OS=Homo sapiens OX=9606 GN=GNAI1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null	14-UNIMOD:4	0.05	22.0	1	1	1
PRT	sp|P49005|DPOD2_HUMAN	DNA polymerase delta subunit 2 OS=Homo sapiens OX=9606 GN=POLD2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|Q8WUX9|CHMP7_HUMAN	Charged multivesicular body protein 7 OS=Homo sapiens OX=9606 GN=CHMP7 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|O43826-2|G6PT1_HUMAN	Isoform 2 of Glucose-6-phosphate exchanger SLC37A4 OS=Homo sapiens OX=9606 GN=SLC37A4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|P53384-2|NUBP1_HUMAN	Isoform 2 of Cytosolic Fe-S cluster assembly factor NUBP1 OS=Homo sapiens OX=9606 GN=NUBP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null	296-UNIMOD:4	0.04	22.0	1	1	1
PRT	sp|P01112-2|RASH_HUMAN	Isoform 2 of GTPase HRas OS=Homo sapiens OX=9606 GN=HRAS	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.07	22.0	1	1	1
PRT	sp|P51654-3|GPC3_HUMAN	Isoform 3 of Glypican-3 OS=Homo sapiens OX=9606 GN=GPC3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q8IZ73-2|RUSD2_HUMAN	Isoform 2 of RNA pseudouridylate synthase domain-containing protein 2 OS=Homo sapiens OX=9606 GN=RPUSD2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null	283-UNIMOD:4	0.02	22.0	1	1	1
PRT	sp|P49902|5NTC_HUMAN	Cytosolic purine 5'-nucleotidase OS=Homo sapiens OX=9606 GN=NT5C2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|P09471-2|GNAO_HUMAN	Isoform Alpha-2 of Guanine nucleotide-binding protein G(o) subunit alpha OS=Homo sapiens OX=9606 GN=GNAO1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|Q16864-2|VATF_HUMAN	Isoform 2 of V-type proton ATPase subunit F OS=Homo sapiens OX=9606 GN=ATP6V1F	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.08	22.0	1	1	1
PRT	sp|Q9H981|ARP8_HUMAN	Actin-related protein 8 OS=Homo sapiens OX=9606 GN=ACTR8 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null	521-UNIMOD:4,522-UNIMOD:4	0.03	22.0	1	1	1
PRT	sp|Q6PJI9|WDR59_HUMAN	GATOR complex protein WDR59 OS=Homo sapiens OX=9606 GN=WDR59 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null	163-UNIMOD:4	0.02	22.0	1	1	1
PRT	sp|Q7Z6Z7|HUWE1_HUMAN	E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens OX=9606 GN=HUWE1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null		0.00	22.0	1	1	0
PRT	sp|Q7Z4V5|HDGR2_HUMAN	Hepatoma-derived growth factor-related protein 2 OS=Homo sapiens OX=9606 GN=HDGFL2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22.0	null	631-UNIMOD:385,631-UNIMOD:4	0.02	22.0	1	1	1
PRT	sp|Q15637|SF01_HUMAN	Splicing factor 1 OS=Homo sapiens OX=9606 GN=SF1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22.0	null	282-UNIMOD:385,282-UNIMOD:4,292-UNIMOD:4	0.02	22.0	1	1	1
PRT	sp|P08133|ANXA6_HUMAN	Annexin A6 OS=Homo sapiens OX=9606 GN=ANXA6 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22.0	null	54-UNIMOD:28,59-UNIMOD:4	0.02	22.0	1	1	1
PRT	sp|Q14103|HNRPD_HUMAN	Heterogeneous nuclear ribonucleoprotein D0 OS=Homo sapiens OX=9606 GN=HNRNPD PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null		0.04	22.0	1	1	0
PRT	sp|Q14847|LASP1_HUMAN	LIM and SH3 domain protein 1 OS=Homo sapiens OX=9606 GN=LASP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22.0	null	76-UNIMOD:28	0.04	22.0	1	1	0
PRT	sp|Q14244|MAP7_HUMAN	Ensconsin OS=Homo sapiens OX=9606 GN=MAP7 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22.0	null	2-UNIMOD:1	0.02	22.0	1	1	1
PRT	sp|P60866|RS20_HUMAN	40S ribosomal protein S20 OS=Homo sapiens OX=9606 GN=RPS20 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null		0.10	22.0	1	1	0
PRT	sp|P54578|UBP14_HUMAN	Ubiquitin carboxyl-terminal hydrolase 14 OS=Homo sapiens OX=9606 GN=USP14 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22.0	null	257-UNIMOD:385,257-UNIMOD:4	0.02	22.0	1	1	0
PRT	sp|Q9H2G2|SLK_HUMAN	STE20-like serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=SLK PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22.0	null	1153-UNIMOD:385,1153-UNIMOD:4	0.01	22.0	1	1	1
PRT	sp|P30626|SORCN_HUMAN	Sorcin OS=Homo sapiens OX=9606 GN=SRI PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null		0.06	22.0	1	1	0
PRT	sp|P08047|SP1_HUMAN	Transcription factor Sp1 OS=Homo sapiens OX=9606 GN=SP1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22.0	null	625-UNIMOD:28,628-UNIMOD:4,633-UNIMOD:4	0.02	22.0	1	1	1
PRT	sp|P62987|RL40_HUMAN	Ubiquitin-60S ribosomal protein L40 OS=Homo sapiens OX=9606 GN=UBA52 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22.0	null	115-UNIMOD:385,115-UNIMOD:4	0.09	22.0	1	1	1
PRT	sp|Q13505|MTX1_HUMAN	Metaxin-1 OS=Homo sapiens OX=9606 GN=MTX1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|Q92797|SYMPK_HUMAN	Symplekin OS=Homo sapiens OX=9606 GN=SYMPK PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|P51970|NDUA8_HUMAN	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 OS=Homo sapiens OX=9606 GN=NDUFA8 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null		0.08	22.0	3	1	0
PRT	sp|Q13643|FHL3_HUMAN	Four and a half LIM domains protein 3 OS=Homo sapiens OX=9606 GN=FHL3 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|P18615|NELFE_HUMAN	Negative elongation factor E OS=Homo sapiens OX=9606 GN=NELFE PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|Q86V81|THOC4_HUMAN	THO complex subunit 4 OS=Homo sapiens OX=9606 GN=ALYREF PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.04	21.0	1	1	1
PRT	sp|P21333|FLNA_HUMAN	Filamin-A OS=Homo sapiens OX=9606 GN=FLNA PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21.0	null		0.02	21.0	5	4	1
PRT	sp|Q6IN85-2|P4R3A_HUMAN	Isoform 2 of Serine/threonine-protein phosphatase 4 regulatory subunit 3A OS=Homo sapiens OX=9606 GN=PPP4R3A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|P41223|BUD31_HUMAN	Protein BUD31 homolog OS=Homo sapiens OX=9606 GN=BUD31 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null	134-UNIMOD:4,137-UNIMOD:4,139-UNIMOD:4	0.08	21.0	1	1	1
PRT	sp|P24539|AT5F1_HUMAN	ATP synthase F(0) complex subunit B1, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5PB PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.05	21.0	1	1	1
PRT	sp|Q92922|SMRC1_HUMAN	SWI/SNF complex subunit SMARCC1 OS=Homo sapiens OX=9606 GN=SMARCC1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.03	21.0	3	3	3
PRT	sp|Q969H8|MYDGF_HUMAN	Myeloid-derived growth factor OS=Homo sapiens OX=9606 GN=MYDGF PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.07	21.0	1	1	1
PRT	sp|Q7L014|DDX46_HUMAN	Probable ATP-dependent RNA helicase DDX46 OS=Homo sapiens OX=9606 GN=DDX46 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.04	21.0	3	3	3
PRT	sp|Q92973-2|TNPO1_HUMAN	Isoform 2 of Transportin-1 OS=Homo sapiens OX=9606 GN=TNPO1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q8N5M9|JAGN1_HUMAN	Protein jagunal homolog 1 OS=Homo sapiens OX=9606 GN=JAGN1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.07	21.0	1	1	1
PRT	sp|O95926|SYF2_HUMAN	Pre-mRNA-splicing factor SYF2 OS=Homo sapiens OX=9606 GN=SYF2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.05	21.0	1	1	1
PRT	sp|Q9UI12-2|VATH_HUMAN	Isoform 2 of V-type proton ATPase subunit H OS=Homo sapiens OX=9606 GN=ATP6V1H	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|O43143|DHX15_HUMAN	Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 OS=Homo sapiens OX=9606 GN=DHX15 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	21.0	null		0.03	21.0	5	2	1
PRT	sp|Q9UBB4|ATX10_HUMAN	Ataxin-10 OS=Homo sapiens OX=9606 GN=ATXN10 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null	65-UNIMOD:4	0.04	21.0	2	2	2
PRT	sp|P17858-2|PFKAL_HUMAN	Isoform 2 of ATP-dependent 6-phosphofructokinase, liver type OS=Homo sapiens OX=9606 GN=PFKL	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.03	21.0	2	2	2
PRT	sp|P61956-2|SUMO2_HUMAN	Isoform 2 of Small ubiquitin-related modifier 2 OS=Homo sapiens OX=9606 GN=SUMO2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.21	21.0	3	2	1
PRT	sp|Q6I9Y2|THOC7_HUMAN	THO complex subunit 7 homolog OS=Homo sapiens OX=9606 GN=THOC7 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1001476, X!Tandem, ]	21.0	null	2-UNIMOD:1	0.11	21.0	2	2	2
PRT	sp|P26368-2|U2AF2_HUMAN	Isoform 2 of Splicing factor U2AF 65 kDa subunit OS=Homo sapiens OX=9606 GN=U2AF2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null	460-UNIMOD:4	0.02	21.0	2	1	0
PRT	sp|Q5JPE7-2|NOMO2_HUMAN	Isoform 2 of Nodal modulator 2 OS=Homo sapiens OX=9606 GN=NOMO2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q96EI5-2|TCAL4_HUMAN	Isoform 2 of Transcription elongation factor A protein-like 4 OS=Homo sapiens OX=9606 GN=TCEAL4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null	177-UNIMOD:4	0.03	21.0	1	1	1
PRT	sp|Q9NUP1|BL1S4_HUMAN	Biogenesis of lysosome-related organelles complex 1 subunit 4 OS=Homo sapiens OX=9606 GN=BLOC1S4 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1000663, ProteinPilot, ]	21.0	null		0.06	21.0	1	1	1
PRT	sp|O14828-2|SCAM3_HUMAN	Isoform 2 of Secretory carrier-associated membrane protein 3 OS=Homo sapiens OX=9606 GN=SCAMP3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.04	21.0	1	1	1
PRT	sp|Q16836-2|HCDH_HUMAN	Isoform 2 of Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=HADH	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|P50897-2|PPT1_HUMAN	Isoform 2 of Palmitoyl-protein thioesterase 1 OS=Homo sapiens OX=9606 GN=PPT1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.05	21.0	1	1	1
PRT	sp|Q92930|RAB8B_HUMAN	Ras-related protein Rab-8B OS=Homo sapiens OX=9606 GN=RAB8B PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.06	21.0	1	1	1
PRT	sp|Q9BPW8|NIPS1_HUMAN	Protein NipSnap homolog 1 OS=Homo sapiens OX=9606 GN=NIPSNAP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.04	21.0	2	1	0
PRT	sp|Q92572|AP3S1_HUMAN	AP-3 complex subunit sigma-1 OS=Homo sapiens OX=9606 GN=AP3S1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.06	21.0	1	1	1
PRT	sp|Q9UDT6|CLIP2_HUMAN	CAP-Gly domain-containing linker protein 2 OS=Homo sapiens OX=9606 GN=CLIP2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.04	21.0	3	3	3
PRT	sp|Q9UKM9-2|RALY_HUMAN	Isoform 1 of RNA-binding protein Raly OS=Homo sapiens OX=9606 GN=RALY	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.07	21.0	3	2	1
PRT	sp|Q9H299|SH3L3_HUMAN	SH3 domain-binding glutamic acid-rich-like protein 3 OS=Homo sapiens OX=9606 GN=SH3BGRL3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.12	21.0	1	1	1
PRT	sp|Q13619|CUL4A_HUMAN	Cullin-4A OS=Homo sapiens OX=9606 GN=CUL4A PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null	138-UNIMOD:4,143-UNIMOD:4	0.04	21.0	3	3	3
PRT	sp|P20073-2|ANXA7_HUMAN	Isoform 2 of Annexin A7 OS=Homo sapiens OX=9606 GN=ANXA7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|P13611|CSPG2_HUMAN	Versican core protein OS=Homo sapiens OX=9606 GN=VCAN PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null	3296-UNIMOD:4	0.01	21.0	1	1	1
PRT	sp|P23921|RIR1_HUMAN	Ribonucleoside-diphosphate reductase large subunit OS=Homo sapiens OX=9606 GN=RRM1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|P21399|ACOC_HUMAN	Cytoplasmic aconitate hydratase OS=Homo sapiens OX=9606 GN=ACO1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null	369-UNIMOD:4,370-UNIMOD:4	0.02	21.0	2	2	2
PRT	sp|O96019|ACL6A_HUMAN	Actin-like protein 6A OS=Homo sapiens OX=9606 GN=ACTL6A PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|O94760|DDAH1_HUMAN	N(G),N(G)-dimethylarginine dimethylaminohydrolase 1 OS=Homo sapiens OX=9606 GN=DDAH1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.04	21.0	1	1	1
PRT	sp|O75947|ATP5H_HUMAN	ATP synthase subunit d, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5PD PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.07	21.0	1	1	1
PRT	sp|Q9UKV8|AGO2_HUMAN	Protein argonaute-2 OS=Homo sapiens OX=9606 GN=AGO2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.04	21.0	3	3	3
PRT	sp|Q7Z478|DHX29_HUMAN	ATP-dependent RNA helicase DHX29 OS=Homo sapiens OX=9606 GN=DHX29 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q16850-2|CP51A_HUMAN	Isoform 2 of Lanosterol 14-alpha demethylase OS=Homo sapiens OX=9606 GN=CYP51A1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.03	21.0	2	1	0
PRT	sp|Q9H857-2|NT5D2_HUMAN	Isoform 2 of 5'-nucleotidase domain-containing protein 2 OS=Homo sapiens OX=9606 GN=NT5DC2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q7L576|CYFP1_HUMAN	Cytoplasmic FMR1-interacting protein 1 OS=Homo sapiens OX=9606 GN=CYFIP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q14451-2|GRB7_HUMAN	Isoform 2 of Growth factor receptor-bound protein 7 OS=Homo sapiens OX=9606 GN=GRB7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null	319-UNIMOD:4	0.02	21.0	1	1	1
PRT	sp|P43686|PRS6B_HUMAN	26S proteasome regulatory subunit 6B OS=Homo sapiens OX=9606 GN=PSMC4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.11	21.0	5	4	3
PRT	sp|O14776-2|TCRG1_HUMAN	Isoform 2 of Transcription elongation regulator 1 OS=Homo sapiens OX=9606 GN=TCERG1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.03	21.0	3	3	3
PRT	sp|Q9Y3B7-2|RM11_HUMAN	Isoform 2 of 39S ribosomal protein L11, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL11	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.08	21.0	1	1	1
PRT	sp|P35222|CTNB1_HUMAN	Catenin beta-1 OS=Homo sapiens OX=9606 GN=CTNNB1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|P84157-2|MXRA7_HUMAN	Isoform 2 of Matrix-remodeling-associated protein 7 OS=Homo sapiens OX=9606 GN=MXRA7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.07	21.0	1	1	1
PRT	sp|P46781|RS9_HUMAN	40S ribosomal protein S9 OS=Homo sapiens OX=9606 GN=RPS9 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.09	21.0	3	2	1
PRT	sp|Q15274|NADC_HUMAN	Nicotinate-nucleotide pyrophosphorylase [carboxylating] OS=Homo sapiens OX=9606 GN=QPRT PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.04	21.0	2	1	0
PRT	sp|P62136|PP1A_HUMAN	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Homo sapiens OX=9606 GN=PPP1CA PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.07	21.0	2	2	2
PRT	sp|Q04837|SSBP_HUMAN	Single-stranded DNA-binding protein, mitochondrial OS=Homo sapiens OX=9606 GN=SSBP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.12	21.0	3	2	1
PRT	sp|Q15059|BRD3_HUMAN	Bromodomain-containing protein 3 OS=Homo sapiens OX=9606 GN=BRD3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.04	21.0	2	2	2
PRT	sp|Q9BZI7-2|REN3B_HUMAN	Isoform 2 of Regulator of nonsense transcripts 3B OS=Homo sapiens OX=9606 GN=UPF3B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|P31153|METK2_HUMAN	S-adenosylmethionine synthase isoform type-2 OS=Homo sapiens OX=9606 GN=MAT2A PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|Q9Y4P3|TBL2_HUMAN	Transducin beta-like protein 2 OS=Homo sapiens OX=9606 GN=TBL2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null	335-UNIMOD:4,108-UNIMOD:4	0.06	21.0	2	2	2
PRT	sp|P08579|RU2B_HUMAN	U2 small nuclear ribonucleoprotein B'' OS=Homo sapiens OX=9606 GN=SNRPB2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.05	21.0	1	1	1
PRT	sp|Q92990|GLMN_HUMAN	Glomulin OS=Homo sapiens OX=9606 GN=GLMN PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q5SNT2|TM201_HUMAN	Transmembrane protein 201 OS=Homo sapiens OX=9606 GN=TMEM201 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|P62753|RS6_HUMAN	40S ribosomal protein S6 OS=Homo sapiens OX=9606 GN=RPS6 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.04	21.0	1	1	1
PRT	sp|Q8WYA6-4|CTBL1_HUMAN	Isoform 4 of Beta-catenin-like protein 1 OS=Homo sapiens OX=9606 GN=CTNNBL1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.02	21.0	2	1	0
PRT	sp|P68402|PA1B2_HUMAN	Platelet-activating factor acetylhydrolase IB subunit beta OS=Homo sapiens OX=9606 GN=PAFAH1B2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.05	21.0	1	1	1
PRT	sp|Q93050-1|VPP1_HUMAN	Isoform 2 of V-type proton ATPase 116 kDa subunit a isoform 1 OS=Homo sapiens OX=9606 GN=ATP6V0A1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|P15924|DESP_HUMAN	Desmoplakin OS=Homo sapiens OX=9606 GN=DSP PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.01	21.0	2	2	2
PRT	sp|P30043|BLVRB_HUMAN	Flavin reductase (NADPH) OS=Homo sapiens OX=9606 GN=BLVRB PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.05	21.0	1	1	1
PRT	sp|Q9UNS2-2|CSN3_HUMAN	Isoform 2 of COP9 signalosome complex subunit 3 OS=Homo sapiens OX=9606 GN=COPS3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.08	21.0	3	3	3
PRT	sp|P13861-2|KAP2_HUMAN	Isoform 2 of cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.06	21.0	2	2	2
PRT	sp|Q6P3W7|SCYL2_HUMAN	SCY1-like protein 2 OS=Homo sapiens OX=9606 GN=SCYL2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q86T03-2|PP4P1_HUMAN	Isoform 2 of Type 1 phosphatidylinositol 4,5-bisphosphate 4-phosphatase OS=Homo sapiens OX=9606 GN=PIP4P1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null	111-UNIMOD:4,114-UNIMOD:4	0.04	21.0	1	1	1
PRT	sp|Q8TEW0-3|PARD3_HUMAN	Isoform 3 of Partitioning defective 3 homolog OS=Homo sapiens OX=9606 GN=PARD3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|O43237|DC1L2_HUMAN	Cytoplasmic dynein 1 light intermediate chain 2 OS=Homo sapiens OX=9606 GN=DYNC1LI2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|Q9Y4W6|AFG32_HUMAN	AFG3-like protein 2 OS=Homo sapiens OX=9606 GN=AFG3L2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.04	21.0	4	3	2
PRT	sp|Q02543|RL18A_HUMAN	60S ribosomal protein L18a OS=Homo sapiens OX=9606 GN=RPL18A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.06	21.0	1	1	1
PRT	sp|Q9P0J0-2|NDUAD_HUMAN	Isoform 2 of NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 OS=Homo sapiens OX=9606 GN=NDUFA13	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.05	21.0	1	1	1
PRT	sp|Q10471|GALT2_HUMAN	Polypeptide N-acetylgalactosaminyltransferase 2 OS=Homo sapiens OX=9606 GN=GALNT2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null	539-UNIMOD:4	0.04	21.0	2	2	2
PRT	sp|P37840-2|SYUA_HUMAN	Isoform 2-4 of Alpha-synuclein OS=Homo sapiens OX=9606 GN=SNCA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.13	21.0	1	1	1
PRT	sp|Q15029-2|U5S1_HUMAN	Isoform 2 of 116 kDa U5 small nuclear ribonucleoprotein component OS=Homo sapiens OX=9606 GN=EFTUD2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null	100-UNIMOD:4	0.04	21.0	3	3	2
PRT	sp|Q8N1G0|ZN687_HUMAN	Zinc finger protein 687 OS=Homo sapiens OX=9606 GN=ZNF687 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|P20042|IF2B_HUMAN	Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.06	21.0	3	2	1
PRT	sp|O14974|MYPT1_HUMAN	Protein phosphatase 1 regulatory subunit 12A OS=Homo sapiens OX=9606 GN=PPP1R12A PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.03	21.0	3	3	3
PRT	sp|P55145|MANF_HUMAN	Mesencephalic astrocyte-derived neurotrophic factor OS=Homo sapiens OX=9606 GN=MANF PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null	117-UNIMOD:4	0.05	21.0	2	1	0
PRT	sp|P25789-2|PSA4_HUMAN	Isoform 2 of Proteasome subunit alpha type-4 OS=Homo sapiens OX=9606 GN=PSMA4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.05	21.0	1	1	1
PRT	sp|Q02040|AK17A_HUMAN	A-kinase anchor protein 17A OS=Homo sapiens OX=9606 GN=AKAP17A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.04	21.0	2	2	2
PRT	sp|Q13451|FKBP5_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Homo sapiens OX=9606 GN=FKBP5 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.05	21.0	2	2	2
PRT	sp|Q8IZQ5|SELH_HUMAN	Selenoprotein H OS=Homo sapiens OX=9606 GN=SELENOH PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.19	21.0	2	2	2
PRT	sp|Q9P2M7|CING_HUMAN	Cingulin OS=Homo sapiens OX=9606 GN=CGN PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.03	21.0	3	3	3
PRT	sp|Q8WUB8-3|PHF10_HUMAN	Isoform 3 of PHD finger protein 10 OS=Homo sapiens OX=9606 GN=PHF10	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q99816-2|TS101_HUMAN	Isoform 2 of Tumor susceptibility gene 101 protein OS=Homo sapiens OX=9606 GN=TSG101	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.08	21.0	2	2	2
PRT	sp|Q14919-2|NC2A_HUMAN	Isoform 2 of Dr1-associated corepressor OS=Homo sapiens OX=9606 GN=DRAP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.05	21.0	1	1	1
PRT	sp|P56937-2|DHB7_HUMAN	Isoform 2 of 3-keto-steroid reductase OS=Homo sapiens OX=9606 GN=HSD17B7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|O00232|PSD12_HUMAN	26S proteasome non-ATPase regulatory subunit 12 OS=Homo sapiens OX=9606 GN=PSMD12 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.04	21.0	3	2	1
PRT	sp|O76024|WFS1_HUMAN	Wolframin OS=Homo sapiens OX=9606 GN=WFS1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q13111-2|CAF1A_HUMAN	Isoform 2 of Chromatin assembly factor 1 subunit A OS=Homo sapiens OX=9606 GN=CHAF1A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q8TB36-2|GDAP1_HUMAN	Isoform 2 of Ganglioside-induced differentiation-associated protein 1 OS=Homo sapiens OX=9606 GN=GDAP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.04	21.0	1	1	1
PRT	sp|P43246|MSH2_HUMAN	DNA mismatch repair protein Msh2 OS=Homo sapiens OX=9606 GN=MSH2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null	404-UNIMOD:4	0.02	21.0	3	2	1
PRT	sp|Q9UM54-2|MYO6_HUMAN	Isoform 2 of Unconventional myosin-VI OS=Homo sapiens OX=9606 GN=MYO6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null	252-UNIMOD:4	0.03	21.0	4	4	4
PRT	sp|O75330-2|HMMR_HUMAN	Isoform 2 of Hyaluronan mediated motility receptor OS=Homo sapiens OX=9606 GN=HMMR	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|P23396-2|RS3_HUMAN	Isoform 2 of 40S ribosomal protein S3 OS=Homo sapiens OX=9606 GN=RPS3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.04	21.0	1	1	1
PRT	sp|P25325-2|THTM_HUMAN	Isoform 2 of 3-mercaptopyruvate sulfurtransferase OS=Homo sapiens OX=9606 GN=MPST	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.04	21.0	1	1	1
PRT	sp|P55001-2|MFAP2_HUMAN	Isoform A' of Microfibrillar-associated protein 2 OS=Homo sapiens OX=9606 GN=MFAP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null	141-UNIMOD:4	0.06	21.0	1	1	1
PRT	sp|O15226-2|NKRF_HUMAN	Isoform 2 of NF-kappa-B-repressing factor OS=Homo sapiens OX=9606 GN=NKRF	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q5TGZ0-2|MIC10_HUMAN	Isoform 2 of MICOS complex subunit MIC10 OS=Homo sapiens OX=9606 GN=MINOS1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null	13-UNIMOD:4	0.38	21.0	2	1	0
PRT	sp|O95801|TTC4_HUMAN	Tetratricopeptide repeat protein 4 OS=Homo sapiens OX=9606 GN=TTC4 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|Q9UKF6|CPSF3_HUMAN	Cleavage and polyadenylation specificity factor subunit 3 OS=Homo sapiens OX=9606 GN=CPSF3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|P28066|PSA5_HUMAN	Proteasome subunit alpha type-5 OS=Homo sapiens OX=9606 GN=PSMA5 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.05	21.0	2	1	0
PRT	sp|P04792|HSPB1_HUMAN	Heat shock protein beta-1 OS=Homo sapiens OX=9606 GN=HSPB1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.05	21.0	1	1	1
PRT	sp|Q9H0A0-2|NAT10_HUMAN	Isoform 2 of RNA cytidine acetyltransferase OS=Homo sapiens OX=9606 GN=NAT10	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.02	21.0	2	2	2
PRT	sp|Q8WUA4|TF3C2_HUMAN	General transcription factor 3C polypeptide 2 OS=Homo sapiens OX=9606 GN=GTF3C2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null	828-UNIMOD:4	0.02	21.0	1	1	1
PRT	sp|Q13330-3|MTA1_HUMAN	Isoform 3 of Metastasis-associated protein MTA1 OS=Homo sapiens OX=9606 GN=MTA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|P54136|SYRC_HUMAN	Arginine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=RARS PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|O95400|CD2B2_HUMAN	CD2 antigen cytoplasmic tail-binding protein 2 OS=Homo sapiens OX=9606 GN=CD2BP2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|P48444|COPD_HUMAN	Coatomer subunit delta OS=Homo sapiens OX=9606 GN=ARCN1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null	479-UNIMOD:4	0.02	21.0	1	1	1
PRT	sp|Q5VT52-3|RPRD2_HUMAN	Isoform 3 of Regulation of nuclear pre-mRNA domain-containing protein 2 OS=Homo sapiens OX=9606 GN=RPRD2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null	196-UNIMOD:4	0.01	21.0	1	1	1
PRT	sp|P57740|NU107_HUMAN	Nuclear pore complex protein Nup107 OS=Homo sapiens OX=9606 GN=NUP107 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.02	21.0	2	1	0
PRT	sp|Q9H2G2-2|SLK_HUMAN	Isoform 2 of STE20-like serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=SLK	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.02	21.0	2	2	2
PRT	sp|Q9NYJ1-2|COA4_HUMAN	Isoform 2 of Cytochrome c oxidase assembly factor 4 homolog, mitochondrial OS=Homo sapiens OX=9606 GN=COA4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null	63-UNIMOD:4	0.11	21.0	1	1	1
PRT	sp|Q06124-2|PTN11_HUMAN	Isoform 2 of Tyrosine-protein phosphatase non-receptor type 11 OS=Homo sapiens OX=9606 GN=PTPN11	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null	104-UNIMOD:4	0.06	21.0	3	3	2
PRT	sp|Q6VMQ6-4|MCAF1_HUMAN	Isoform 3 of Activating transcription factor 7-interacting protein 1 OS=Homo sapiens OX=9606 GN=ATF7IP	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q9UIC8-2|LCMT1_HUMAN	Isoform 2 of Leucine carboxyl methyltransferase 1 OS=Homo sapiens OX=9606 GN=LCMT1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null	273-UNIMOD:4,281-UNIMOD:4	0.03	21.0	1	1	1
PRT	sp|Q9Y676|RT18B_HUMAN	28S ribosomal protein S18b, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS18B PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.04	21.0	1	1	1
PRT	sp|Q9Y3D6|FIS1_HUMAN	Mitochondrial fission 1 protein OS=Homo sapiens OX=9606 GN=FIS1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.09	21.0	1	1	1
PRT	sp|Q93034|CUL5_HUMAN	Cullin-5 OS=Homo sapiens OX=9606 GN=CUL5 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q9ULA0|DNPEP_HUMAN	Aspartyl aminopeptidase OS=Homo sapiens OX=9606 GN=DNPEP PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null	38-UNIMOD:4	0.03	21.0	1	1	1
PRT	sp|P50502|F10A1_HUMAN	Hsc70-interacting protein OS=Homo sapiens OX=9606 GN=ST13 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.04	21.0	1	1	1
PRT	sp|Q9Y3L5|RAP2C_HUMAN	Ras-related protein Rap-2c OS=Homo sapiens OX=9606 GN=RAP2C PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.07	21.0	1	1	1
PRT	sp|Q16531|DDB1_HUMAN	DNA damage-binding protein 1 OS=Homo sapiens OX=9606 GN=DDB1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.01	21.0	2	2	2
PRT	sp|O60566-3|BUB1B_HUMAN	Isoform 3 of Mitotic checkpoint serine/threonine-protein kinase BUB1 beta OS=Homo sapiens OX=9606 GN=BUB1B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q01813|PFKAP_HUMAN	ATP-dependent 6-phosphofructokinase, platelet type OS=Homo sapiens OX=9606 GN=PFKP PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q9BW92|SYTM_HUMAN	Threonine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=TARS2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q9P016-2|THYN1_HUMAN	Isoform 2 of Thymocyte nuclear protein 1 OS=Homo sapiens OX=9606 GN=THYN1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null	89-UNIMOD:4	0.13	21.0	2	2	2
PRT	sp|Q96JB5-4|CK5P3_HUMAN	Isoform 4 of CDK5 regulatory subunit-associated protein 3 OS=Homo sapiens OX=9606 GN=CDK5RAP3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q9Y6D6|BIG1_HUMAN	Brefeldin A-inhibited guanine nucleotide-exchange protein 1 OS=Homo sapiens OX=9606 GN=ARFGEF1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null	1729-UNIMOD:4	0.01	21.0	1	1	1
PRT	sp|P12931-2|SRC_HUMAN	Isoform 2 of Proto-oncogene tyrosine-protein kinase Src OS=Homo sapiens OX=9606 GN=SRC	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|P52948-2|NUP98_HUMAN	Isoform 2 of Nuclear pore complex protein Nup98-Nup96 OS=Homo sapiens OX=9606 GN=NUP98	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null	1644-UNIMOD:4	0.01	21.0	2	2	1
PRT	sp|Q9UEY8|ADDG_HUMAN	Gamma-adducin OS=Homo sapiens OX=9606 GN=ADD3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.03	21.0	2	2	2
PRT	sp|Q9BZF1-2|OSBL8_HUMAN	Isoform 2 of Oxysterol-binding protein-related protein 8 OS=Homo sapiens OX=9606 GN=OSBPL8	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q8N0X7|SPART_HUMAN	Spartin OS=Homo sapiens OX=9606 GN=SPART PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|Q96HY6|DDRGK_HUMAN	DDRGK domain-containing protein 1 OS=Homo sapiens OX=9606 GN=DDRGK1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.11	21.0	2	2	2
PRT	sp|Q15633-2|TRBP2_HUMAN	Isoform 2 of RISC-loading complex subunit TARBP2 OS=Homo sapiens OX=9606 GN=TARBP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.05	21.0	1	1	1
PRT	sp|Q9NTZ6|RBM12_HUMAN	RNA-binding protein 12 OS=Homo sapiens OX=9606 GN=RBM12 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|P50991|TCPD_HUMAN	T-complex protein 1 subunit delta OS=Homo sapiens OX=9606 GN=CCT4 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null	295-UNIMOD:4	0.04	21.0	3	2	1
PRT	sp|Q06330-7|SUH_HUMAN	Isoform 7 of Recombining binding protein suppressor of hairless OS=Homo sapiens OX=9606 GN=RBPJ	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q53H12|AGK_HUMAN	Acylglycerol kinase, mitochondrial OS=Homo sapiens OX=9606 GN=AGK PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null	72-UNIMOD:4	0.03	21.0	1	1	1
PRT	sp|Q9NTI5-2|PDS5B_HUMAN	Isoform 2 of Sister chromatid cohesion protein PDS5 homolog B OS=Homo sapiens OX=9606 GN=PDS5B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.02	21.0	4	4	4
PRT	sp|P09668|CATH_HUMAN	Pro-cathepsin H OS=Homo sapiens OX=9606 GN=CTSH PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.04	21.0	1	1	1
PRT	sp|Q8NI27|THOC2_HUMAN	THO complex subunit 2 OS=Homo sapiens OX=9606 GN=THOC2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|P57105|SYJ2B_HUMAN	Synaptojanin-2-binding protein OS=Homo sapiens OX=9606 GN=SYNJ2BP PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.07	21.0	1	1	1
PRT	sp|P40939|ECHA_HUMAN	Trifunctional enzyme subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=HADHA PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.02	21.0	2	2	2
PRT	sp|P11766|ADHX_HUMAN	Alcohol dehydrogenase class-3 OS=Homo sapiens OX=9606 GN=ADH5 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.05	21.0	2	2	2
PRT	sp|Q9NXG2|THUM1_HUMAN	THUMP domain-containing protein 1 OS=Homo sapiens OX=9606 GN=THUMPD1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null	248-UNIMOD:4,249-UNIMOD:4	0.03	21.0	1	1	1
PRT	sp|Q9NYU2-2|UGGG1_HUMAN	Isoform 2 of UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|P82933|RT09_HUMAN	28S ribosomal protein S9, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS9 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|Q9BTV4|TMM43_HUMAN	Transmembrane protein 43 OS=Homo sapiens OX=9606 GN=TMEM43 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|Q14C86-2|GAPD1_HUMAN	Isoform 2 of GTPase-activating protein and VPS9 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=GAPVD1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q86UA1|PRP39_HUMAN	Pre-mRNA-processing factor 39 OS=Homo sapiens OX=9606 GN=PRPF39 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q8WVV9-5|HNRLL_HUMAN	Isoform 5 of Heterogeneous nuclear ribonucleoprotein L-like OS=Homo sapiens OX=9606 GN=HNRNPLL	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.06	21.0	3	2	1
PRT	sp|P40763-2|STAT3_HUMAN	Isoform Del-701 of Signal transducer and activator of transcription 3 OS=Homo sapiens OX=9606 GN=STAT3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.03	21.0	2	2	2
PRT	sp|O43865|SAHH2_HUMAN	S-adenosylhomocysteine hydrolase-like protein 1 OS=Homo sapiens OX=9606 GN=AHCYL1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null	373-UNIMOD:4	0.02	21.0	1	1	1
PRT	sp|Q01973|ROR1_HUMAN	Inactive tyrosine-protein kinase transmembrane receptor ROR1 OS=Homo sapiens OX=9606 GN=ROR1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null	386-UNIMOD:4,391-UNIMOD:4	0.01	21.0	1	1	1
PRT	sp|Q14789-2|GOGB1_HUMAN	Isoform 2 of Golgin subfamily B member 1 OS=Homo sapiens OX=9606 GN=GOLGB1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.01	21.0	2	2	2
PRT	sp|P55072|TERA_HUMAN	Transitional endoplasmic reticulum ATPase OS=Homo sapiens OX=9606 GN=VCP PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1000663, ProteinPilot, ]	21.0	null		0.03	21.0	3	3	3
PRT	sp|P26358|DNMT1_HUMAN	DNA (cytosine-5)-methyltransferase 1 OS=Homo sapiens OX=9606 GN=DNMT1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|P35658-5|NU214_HUMAN	Isoform 5 of Nuclear pore complex protein Nup214 OS=Homo sapiens OX=9606 GN=NUP214	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.00	21.0	1	1	1
PRT	sp|Q96CT7|CC124_HUMAN	Coiled-coil domain-containing protein 124 OS=Homo sapiens OX=9606 GN=CCDC124 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.09	21.0	2	2	2
PRT	sp|P49959-3|MRE11_HUMAN	Isoform 3 of Double-strand break repair protein MRE11 OS=Homo sapiens OX=9606 GN=MRE11	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q10713|MPPA_HUMAN	Mitochondrial-processing peptidase subunit alpha OS=Homo sapiens OX=9606 GN=PMPCA PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.02	21.0	2	1	0
PRT	sp|P23378|GCSP_HUMAN	Glycine dehydrogenase (decarboxylating), mitochondrial OS=Homo sapiens OX=9606 GN=GLDC PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null	225-UNIMOD:4	0.02	21.0	4	2	0
PRT	sp|Q96AQ6-2|PBIP1_HUMAN	Isoform 2 of Pre-B-cell leukemia transcription factor-interacting protein 1 OS=Homo sapiens OX=9606 GN=PBXIP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.03	21.0	2	2	2
PRT	sp|Q07960|RHG01_HUMAN	Rho GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=ARHGAP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|Q9H2U2-2|IPYR2_HUMAN	Isoform 2 of Inorganic pyrophosphatase 2, mitochondrial OS=Homo sapiens OX=9606 GN=PPA2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.04	21.0	2	1	0
PRT	sp|P26440|IVD_HUMAN	Isovaleryl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=IVD PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|P18887|XRCC1_HUMAN	DNA repair protein XRCC1 OS=Homo sapiens OX=9606 GN=XRCC1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q86U44|MTA70_HUMAN	N6-adenosine-methyltransferase catalytic subunit OS=Homo sapiens OX=9606 GN=METTL3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|Q9Y3Q3-2|TMED3_HUMAN	Isoform 2 of Transmembrane emp24 domain-containing protein 3 OS=Homo sapiens OX=9606 GN=TMED3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null	40-UNIMOD:4	0.08	21.0	1	1	1
PRT	sp|Q99707|METH_HUMAN	Methionine synthase OS=Homo sapiens OX=9606 GN=MTR PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|O95478|NSA2_HUMAN	Ribosome biogenesis protein NSA2 homolog OS=Homo sapiens OX=9606 GN=NSA2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.04	21.0	1	1	1
PRT	sp|O95487-2|SC24B_HUMAN	Isoform 2 of Protein transport protein Sec24B OS=Homo sapiens OX=9606 GN=SEC24B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q9HD33-2|RM47_HUMAN	Isoform 2 of 39S ribosomal protein L47, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL47	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.05	21.0	1	1	1
PRT	sp|Q9Y3A4|RRP7A_HUMAN	Ribosomal RNA-processing protein 7 homolog A OS=Homo sapiens OX=9606 GN=RRP7A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.05	21.0	2	1	0
PRT	sp|P82673|RT35_HUMAN	28S ribosomal protein S35, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS35 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.04	21.0	2	1	0
PRT	sp|Q9ULF5|S39AA_HUMAN	Zinc transporter ZIP10 OS=Homo sapiens OX=9606 GN=SLC39A10 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q9Y2S7|PDIP2_HUMAN	Polymerase delta-interacting protein 2 OS=Homo sapiens OX=9606 GN=POLDIP2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.04	21.0	1	1	1
PRT	sp|Q9NR50|EI2BG_HUMAN	Translation initiation factor eIF-2B subunit gamma OS=Homo sapiens OX=9606 GN=EIF2B3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null	379-UNIMOD:4	0.03	21.0	1	1	1
PRT	sp|P82909|RT36_HUMAN	28S ribosomal protein S36, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS36 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.17	21.0	1	1	1
PRT	sp|A6NKD9|CC85C_HUMAN	Coiled-coil domain-containing protein 85C OS=Homo sapiens OX=9606 GN=CCDC85C PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|Q9NY91|SC5A4_HUMAN	Solute carrier family 5 member 4 OS=Homo sapiens OX=9606 GN=SLC5A4 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q9BUA3|SPNDC_HUMAN	Spindlin interactor and repressor of chromatin-binding protein OS=Homo sapiens OX=9606 GN=SPINDOC PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|Q9NV96-2|CC50A_HUMAN	Isoform 2 of Cell cycle control protein 50A OS=Homo sapiens OX=9606 GN=TMEM30A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.04	21.0	1	1	1
PRT	sp|Q96MC5|CP045_HUMAN	Uncharacterized protein C16orf45 OS=Homo sapiens OX=9606 GN=C16orf45 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null	1-UNIMOD:35	0.08	21.0	1	1	1
PRT	sp|P35580|MYH10_HUMAN	Myosin-10 OS=Homo sapiens OX=9606 GN=MYH10 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21.0	null	164-UNIMOD:4,176-UNIMOD:4	0.02	21.0	2	2	2
PRT	sp|Q15046|SYK_HUMAN	Lysine--tRNA ligase OS=Homo sapiens OX=9606 GN=KARS PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	21.0	null	2-UNIMOD:1	0.02	21.0	2	1	0
PRT	sp|P54886|P5CS_HUMAN	Delta-1-pyrroline-5-carboxylate synthase OS=Homo sapiens OX=9606 GN=ALDH18A1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	21.0	null	139-UNIMOD:28	0.02	21.0	1	1	1
PRT	sp|Q14978|NOLC1_HUMAN	Nucleolar and coiled-body phosphoprotein 1 OS=Homo sapiens OX=9606 GN=NOLC1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q9UKA9|PTBP2_HUMAN	Polypyrimidine tract-binding protein 2 OS=Homo sapiens OX=9606 GN=PTBP2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21.0	null		0.02	21.0	2	1	0
PRT	sp|Q16695|H31T_HUMAN	Histone H3.1t OS=Homo sapiens OX=9606 GN=HIST3H3 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21.0	null		0.07	21.0	1	1	0
PRT	sp|Q9P013|CWC15_HUMAN	Spliceosome-associated protein CWC15 homolog OS=Homo sapiens OX=9606 GN=CWC15 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001207, Mascot, ]	21.0	null	2-UNIMOD:1	0.11	21.0	2	2	2
PRT	sp|Q16543|CDC37_HUMAN	Hsp90 co-chaperone Cdc37 OS=Homo sapiens OX=9606 GN=CDC37 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001207, Mascot, ]	21.0	null		0.03	21.0	2	2	2
PRT	sp|Q7LG56|RIR2B_HUMAN	Ribonucleoside-diphosphate reductase subunit M2 B OS=Homo sapiens OX=9606 GN=RRM2B PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	21.0	null	2-UNIMOD:1	0.05	21.0	1	1	1
PRT	sp|Q12907|LMAN2_HUMAN	Vesicular integral-membrane protein VIP36 OS=Homo sapiens OX=9606 GN=LMAN2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|P56747|CLD6_HUMAN	Claudin-6 OS=Homo sapiens OX=9606 GN=CLDN6 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21.0	null		0.05	21.0	1	1	1
PRT	sp|P63218|GBG5_HUMAN	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5 OS=Homo sapiens OX=9606 GN=GNG5 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	21.0	null	2-UNIMOD:1	0.16	21.0	1	1	1
PRT	sp|Q8IVN3|MSTN1_HUMAN	Musculoskeletal embryonic nuclear protein 1 OS=Homo sapiens OX=9606 GN=MUSTN1 PE=3 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	21.0	null	2-UNIMOD:1	0.15	21.0	1	1	1
PRT	sp|Q9NYF8|BCLF1_HUMAN	Bcl-2-associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|O15084|ANR28_HUMAN	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens OX=9606 GN=ANKRD28 PE=1 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21.0	null	201-UNIMOD:4	0.01	21.0	1	1	1
PRT	sp|O60502|OGA_HUMAN	Protein O-GlcNAcase OS=Homo sapiens OX=9606 GN=OGA PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21.0	null	878-UNIMOD:4	0.01	21.0	1	1	1
PRT	sp|O94776|MTA2_HUMAN	Metastasis-associated protein MTA2 OS=Homo sapiens OX=9606 GN=MTA2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001207, Mascot, ]	21.0	null		0.05	21.0	4	3	2
PRT	sp|O75955|FLOT1_HUMAN	Flotillin-1 OS=Homo sapiens OX=9606 GN=FLOT1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21.0	null		0.03	21.0	1	1	0
PRT	sp|P35251|RFC1_HUMAN	Replication factor C subunit 1 OS=Homo sapiens OX=9606 GN=RFC1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q6P1M3-2|L2GL2_HUMAN	Isoform A of Lethal(2) giant larvae protein homolog 2 OS=Homo sapiens OX=9606 GN=LLGL2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|P49711|CTCF_HUMAN	Transcriptional repressor CTCF OS=Homo sapiens OX=9606 GN=CTCF PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null	577-UNIMOD:4	0.03	20.0	1	1	1
PRT	sp|Q9P2Y4|ZN219_HUMAN	Zinc finger protein 219 OS=Homo sapiens OX=9606 GN=ZNF219 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.05	20.0	2	2	2
PRT	sp|P08708|RS17_HUMAN	40S ribosomal protein S17 OS=Homo sapiens OX=9606 GN=RPS17 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.07	20.0	1	1	1
PRT	sp|Q9UI26-2|IPO11_HUMAN	Isoform 2 of Importin-11 OS=Homo sapiens OX=9606 GN=IPO11	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q12765-2|SCRN1_HUMAN	Isoform 2 of Secernin-1 OS=Homo sapiens OX=9606 GN=SCRN1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null	344-UNIMOD:4	0.06	20.0	2	2	2
PRT	sp|Q9HB71|CYBP_HUMAN	Calcyclin-binding protein OS=Homo sapiens OX=9606 GN=CACYBP PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|Q9BW19|KIFC1_HUMAN	Kinesin-like protein KIFC1 OS=Homo sapiens OX=9606 GN=KIFC1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q96AG4|LRC59_HUMAN	Leucine-rich repeat-containing protein 59 OS=Homo sapiens OX=9606 GN=LRRC59 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null	131-UNIMOD:4	0.03	20.0	1	1	1
PRT	sp|P62266|RS23_HUMAN	40S ribosomal protein S23 OS=Homo sapiens OX=9606 GN=RPS23 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.17	20.0	3	2	1
PRT	sp|P08559-2|ODPA_HUMAN	Isoform 2 of Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial OS=Homo sapiens OX=9606 GN=PDHA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.07	20.0	3	3	3
PRT	sp|Q8ND56-3|LS14A_HUMAN	Isoform 3 of Protein LSM14 homolog A OS=Homo sapiens OX=9606 GN=LSM14A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|P05067-11|A4_HUMAN	Isoform 11 of Amyloid-beta A4 protein OS=Homo sapiens OX=9606 GN=APP	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null	286-UNIMOD:4,295-UNIMOD:4	0.02	20.0	1	1	1
PRT	sp|P52701-3|MSH6_HUMAN	Isoform 3 of DNA mismatch repair protein Msh6 OS=Homo sapiens OX=9606 GN=MSH6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|P61769|B2MG_HUMAN	Beta-2-microglobulin OS=Homo sapiens OX=9606 GN=B2M PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.18	20.0	2	2	2
PRT	sp|P09497-2|CLCB_HUMAN	Isoform Non-brain of Clathrin light chain B OS=Homo sapiens OX=9606 GN=CLTB	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.05	20.0	1	1	1
PRT	sp|Q9NRR5|UBQL4_HUMAN	Ubiquilin-4 OS=Homo sapiens OX=9606 GN=UBQLN4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null	29-UNIMOD:4	0.04	20.0	3	2	1
PRT	sp|Q8N183|NDUF2_HUMAN	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 2 OS=Homo sapiens OX=9606 GN=NDUFAF2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.07	20.0	2	1	0
PRT	sp|Q6GMV2|SMYD5_HUMAN	SET and MYND domain-containing protein 5 OS=Homo sapiens OX=9606 GN=SMYD5 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|Q05048|CSTF1_HUMAN	Cleavage stimulation factor subunit 1 OS=Homo sapiens OX=9606 GN=CSTF1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|P31689-2|DNJA1_HUMAN	Isoform 2 of DnaJ homolog subfamily A member 1 OS=Homo sapiens OX=9606 GN=DNAJA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|P60842-2|IF4A1_HUMAN	Isoform 2 of Eukaryotic initiation factor 4A-I OS=Homo sapiens OX=9606 GN=EIF4A1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|Q96T88|UHRF1_HUMAN	E3 ubiquitin-protein ligase UHRF1 OS=Homo sapiens OX=9606 GN=UHRF1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q9Y5J7|TIM9_HUMAN	Mitochondrial import inner membrane translocase subunit Tim9 OS=Homo sapiens OX=9606 GN=TIMM9 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null	48-UNIMOD:4,52-UNIMOD:4	0.19	20.0	1	1	1
PRT	sp|P25705-3|ATPA_HUMAN	Isoform 3 of ATP synthase subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.04	20.0	4	3	2
PRT	sp|P19174-2|PLCG1_HUMAN	Isoform 2 of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 OS=Homo sapiens OX=9606 GN=PLCG1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.02	20.0	2	2	2
PRT	sp|O75691|UTP20_HUMAN	Small subunit processome component 20 homolog OS=Homo sapiens OX=9606 GN=UTP20 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.00	20.0	1	1	1
PRT	sp|Q14997|PSME4_HUMAN	Proteasome activator complex subunit 4 OS=Homo sapiens OX=9606 GN=PSME4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|O95782-2|AP2A1_HUMAN	Isoform B of AP-2 complex subunit alpha-1 OS=Homo sapiens OX=9606 GN=AP2A1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q8N6H7|ARFG2_HUMAN	ADP-ribosylation factor GTPase-activating protein 2 OS=Homo sapiens OX=9606 GN=ARFGAP2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q9H7C9|AAMDC_HUMAN	Mth938 domain-containing protein OS=Homo sapiens OX=9606 GN=AAMDC PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.14	20.0	1	1	1
PRT	sp|P11413-2|G6PD_HUMAN	Isoform Long of Glucose-6-phosphate 1-dehydrogenase OS=Homo sapiens OX=9606 GN=G6PD	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q99661|KIF2C_HUMAN	Kinesin-like protein KIF2C OS=Homo sapiens OX=9606 GN=KIF2C PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null	344-UNIMOD:4	0.04	20.0	2	2	2
PRT	sp|Q00059-2|TFAM_HUMAN	Isoform 2 of Transcription factor A, mitochondrial OS=Homo sapiens OX=9606 GN=TFAM	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|Q8TEM1|PO210_HUMAN	Nuclear pore membrane glycoprotein 210 OS=Homo sapiens OX=9606 GN=NUP210 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q9NRH3|TBG2_HUMAN	Tubulin gamma-2 chain OS=Homo sapiens OX=9606 GN=TUBG2 PE=2 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|P08243-2|ASNS_HUMAN	Isoform 2 of Asparagine synthetase [glutamine-hydrolyzing] OS=Homo sapiens OX=9606 GN=ASNS	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.02	20.0	2	1	0
PRT	sp|O75083|WDR1_HUMAN	WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=WDR1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null	325-UNIMOD:4	0.02	20.0	1	1	1
PRT	sp|Q14232|EI2BA_HUMAN	Translation initiation factor eIF-2B subunit alpha OS=Homo sapiens OX=9606 GN=EIF2B1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|Q01804|OTUD4_HUMAN	OTU domain-containing protein 4 OS=Homo sapiens OX=9606 GN=OTUD4 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q9Y383|LC7L2_HUMAN	Putative RNA-binding protein Luc7-like 2 OS=Homo sapiens OX=9606 GN=LUC7L2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null	348-UNIMOD:4	0.03	20.0	1	1	1
PRT	sp|P49903-2|SPS1_HUMAN	Isoform 2 of Selenide, water dikinase 1 OS=Homo sapiens OX=9606 GN=SEPHS1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.03	20.0	2	1	0
PRT	sp|O75396|SC22B_HUMAN	Vesicle-trafficking protein SEC22b OS=Homo sapiens OX=9606 GN=SEC22B PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.05	20.0	1	1	1
PRT	sp|Q99832-3|TCPH_HUMAN	Isoform 3 of T-complex protein 1 subunit eta OS=Homo sapiens OX=9606 GN=CCT7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null	114-UNIMOD:4	0.04	20.0	2	2	2
PRT	sp|Q8IXQ4-2|GPAM1_HUMAN	Isoform 2 of GPALPP motifs-containing protein 1 OS=Homo sapiens OX=9606 GN=GPALPP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.07	20.0	1	1	1
PRT	sp|O95777|LSM8_HUMAN	U6 snRNA-associated Sm-like protein LSm8 OS=Homo sapiens OX=9606 GN=LSM8 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.11	20.0	2	1	0
PRT	sp|Q8WY07|CTR3_HUMAN	Cationic amino acid transporter 3 OS=Homo sapiens OX=9606 GN=SLC7A3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|O95551-3|TYDP2_HUMAN	Isoform 3 of Tyrosyl-DNA phosphodiesterase 2 OS=Homo sapiens OX=9606 GN=TDP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|P06396-2|GELS_HUMAN	Isoform 2 of Gelsolin OS=Homo sapiens OX=9606 GN=GSN	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.03	20.0	2	2	2
PRT	sp|Q9H4A3-2|WNK1_HUMAN	Isoform 2 of Serine/threonine-protein kinase WNK1 OS=Homo sapiens OX=9606 GN=WNK1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q16625-2|OCLN_HUMAN	Isoform 2 of Occludin OS=Homo sapiens OX=9606 GN=OCLN	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|Q14692|BMS1_HUMAN	Ribosome biogenesis protein BMS1 homolog OS=Homo sapiens OX=9606 GN=BMS1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.02	20.0	2	2	2
PRT	sp|P14923|PLAK_HUMAN	Junction plakoglobin OS=Homo sapiens OX=9606 GN=JUP PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|O00461|GOLI4_HUMAN	Golgi integral membrane protein 4 OS=Homo sapiens OX=9606 GN=GOLIM4 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|P02786|TFR1_HUMAN	Transferrin receptor protein 1 OS=Homo sapiens OX=9606 GN=TFRC PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|P16455|MGMT_HUMAN	Methylated-DNA--protein-cysteine methyltransferase OS=Homo sapiens OX=9606 GN=MGMT PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.05	20.0	1	1	1
PRT	sp|O14561|ACPM_HUMAN	Acyl carrier protein, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFAB1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.06	20.0	1	1	1
PRT	sp|P68036|UB2L3_HUMAN	Ubiquitin-conjugating enzyme E2 L3 OS=Homo sapiens OX=9606 GN=UBE2L3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.13	20.0	3	2	1
PRT	sp|Q96J01|THOC3_HUMAN	THO complex subunit 3 OS=Homo sapiens OX=9606 GN=THOC3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null	65-UNIMOD:4	0.03	20.0	2	1	0
PRT	sp|Q8IXI1|MIRO2_HUMAN	Mitochondrial Rho GTPase 2 OS=Homo sapiens OX=9606 GN=RHOT2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null	185-UNIMOD:4	0.02	20.0	1	1	1
PRT	sp|P42765|THIM_HUMAN	3-ketoacyl-CoA thiolase, mitochondrial OS=Homo sapiens OX=9606 GN=ACAA2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|P09496-2|CLCA_HUMAN	Isoform Non-brain of Clathrin light chain A OS=Homo sapiens OX=9606 GN=CLTA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.05	20.0	1	1	1
PRT	sp|P60983|GMFB_HUMAN	Glia maturation factor beta OS=Homo sapiens OX=9606 GN=GMFB PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.15	20.0	3	2	1
PRT	sp|Q9Y244|POMP_HUMAN	Proteasome maturation protein OS=Homo sapiens OX=9606 GN=POMP PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.06	20.0	1	1	1
PRT	sp|P28161|GSTM2_HUMAN	Glutathione S-transferase Mu 2 OS=Homo sapiens OX=9606 GN=GSTM2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.05	20.0	1	1	1
PRT	sp|Q13445|TMED1_HUMAN	Transmembrane emp24 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=TMED1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|Q9NVI1|FANCI_HUMAN	Fanconi anemia group I protein OS=Homo sapiens OX=9606 GN=FANCI PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q96AC1-2|FERM2_HUMAN	Isoform 2 of Fermitin family homolog 2 OS=Homo sapiens OX=9606 GN=FERMT2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.06	20.0	3	3	3
PRT	sp|Q99442|SEC62_HUMAN	Translocation protein SEC62 OS=Homo sapiens OX=9606 GN=SEC62 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null	82-UNIMOD:4	0.03	20.0	1	1	1
PRT	sp|Q8WXH0-2|SYNE2_HUMAN	Isoform 2 of Nesprin-2 OS=Homo sapiens OX=9606 GN=SYNE2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.00	20.0	1	1	1
PRT	sp|Q14257-2|RCN2_HUMAN	Isoform 2 of Reticulocalbin-2 OS=Homo sapiens OX=9606 GN=RCN2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|Q15833-2|STXB2_HUMAN	Isoform 2 of Syntaxin-binding protein 2 OS=Homo sapiens OX=9606 GN=STXBP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|P62760|VISL1_HUMAN	Visinin-like protein 1 OS=Homo sapiens OX=9606 GN=VSNL1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.06	20.0	1	1	1
PRT	sp|Q96T23-2|RSF1_HUMAN	Isoform 2 of Remodeling and spacing factor 1 OS=Homo sapiens OX=9606 GN=RSF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q9Y496|KIF3A_HUMAN	Kinesin-like protein KIF3A OS=Homo sapiens OX=9606 GN=KIF3A PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.03	20.0	2	2	2
PRT	sp|Q9BVW5|TIPIN_HUMAN	TIMELESS-interacting protein OS=Homo sapiens OX=9606 GN=TIPIN PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|P07942|LAMB1_HUMAN	Laminin subunit beta-1 OS=Homo sapiens OX=9606 GN=LAMB1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.01	20.0	2	2	2
PRT	sp|Q14258|TRI25_HUMAN	E3 ubiquitin/ISG15 ligase TRIM25 OS=Homo sapiens OX=9606 GN=TRIM25 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null	107-UNIMOD:4,110-UNIMOD:4	0.03	20.0	1	1	1
PRT	sp|P62081|RS7_HUMAN	40S ribosomal protein S7 OS=Homo sapiens OX=9606 GN=RPS7 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	20.0	null		0.10	20.0	2	2	2
PRT	sp|Q86X55-1|CARM1_HUMAN	Isoform 1 of Histone-arginine methyltransferase CARM1 OS=Homo sapiens OX=9606 GN=CARM1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|P06493|CDK1_HUMAN	Cyclin-dependent kinase 1 OS=Homo sapiens OX=9606 GN=CDK1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|O14980|XPO1_HUMAN	Exportin-1 OS=Homo sapiens OX=9606 GN=XPO1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.01	20.0	2	1	0
PRT	sp|Q14318-2|FKBP8_HUMAN	Isoform 2 of Peptidyl-prolyl cis-trans isomerase FKBP8 OS=Homo sapiens OX=9606 GN=FKBP8	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.06	20.0	3	2	1
PRT	sp|Q9BV79-2|MECR_HUMAN	Isoform 2 of Enoyl-[acyl-carrier-protein] reductase, mitochondrial OS=Homo sapiens OX=9606 GN=MECR	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null	187-UNIMOD:4	0.03	20.0	1	1	1
PRT	sp|A1X283|SPD2B_HUMAN	SH3 and PX domain-containing protein 2B OS=Homo sapiens OX=9606 GN=SH3PXD2B PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.03	20.0	2	2	2
PRT	sp|Q5JTH9|RRP12_HUMAN	RRP12-like protein OS=Homo sapiens OX=9606 GN=RRP12 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|P12429|ANXA3_HUMAN	Annexin A3 OS=Homo sapiens OX=9606 GN=ANXA3 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|P51532-2|SMCA4_HUMAN	Isoform 2 of Transcription activator BRG1 OS=Homo sapiens OX=9606 GN=SMARCA4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.01	20.0	2	2	2
PRT	sp|P41208|CETN2_HUMAN	Centrin-2 OS=Homo sapiens OX=9606 GN=CETN2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.06	20.0	1	1	1
PRT	sp|O14964|HGS_HUMAN	Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null	185-UNIMOD:4,190-UNIMOD:4,212-UNIMOD:4,215-UNIMOD:4	0.04	20.0	3	3	3
PRT	sp|P13473-2|LAMP2_HUMAN	Isoform LAMP-2B of Lysosome-associated membrane glycoprotein 2 OS=Homo sapiens OX=9606 GN=LAMP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null	153-UNIMOD:4	0.02	20.0	1	1	1
PRT	sp|O60934|NBN_HUMAN	Nibrin OS=Homo sapiens OX=9606 GN=NBN PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q96RG2-2|PASK_HUMAN	Isoform 2 of PAS domain-containing serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=PASK	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|O75131|CPNE3_HUMAN	Copine-3 OS=Homo sapiens OX=9606 GN=CPNE3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null	54-UNIMOD:4	0.02	20.0	1	1	1
PRT	sp|Q9Y3A2|UTP11_HUMAN	Probable U3 small nucleolar RNA-associated protein 11 OS=Homo sapiens OX=9606 GN=UTP11 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null	201-UNIMOD:4	0.08	20.0	2	2	2
PRT	sp|Q14315-2|FLNC_HUMAN	Isoform 2 of Filamin-C OS=Homo sapiens OX=9606 GN=FLNC	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null	2646-UNIMOD:4	0.00	20.0	1	1	1
PRT	sp|P50395|GDIB_HUMAN	Rab GDP dissociation inhibitor beta OS=Homo sapiens OX=9606 GN=GDI2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.07	20.0	3	3	3
PRT	sp|Q03154-4|ACY1_HUMAN	Isoform 4 of Aminoacylase-1 OS=Homo sapiens OX=9606 GN=ACY1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.06	20.0	2	2	2
PRT	sp|O14732-2|IMPA2_HUMAN	Isoform 2 of Inositol monophosphatase 2 OS=Homo sapiens OX=9606 GN=IMPA2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.05	20.0	1	1	1
PRT	sp|O15511-2|ARPC5_HUMAN	Isoform 2 of Actin-related protein 2/3 complex subunit 5 OS=Homo sapiens OX=9606 GN=ARPC5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.07	20.0	1	1	1
PRT	sp|Q08174-2|PCDH1_HUMAN	Isoform 2 of Protocadherin-1 OS=Homo sapiens OX=9606 GN=PCDH1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q9BRX2|PELO_HUMAN	Protein pelota homolog OS=Homo sapiens OX=9606 GN=PELO PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null	258-UNIMOD:4	0.06	20.0	2	2	2
PRT	sp|Q9NXR1-1|NDE1_HUMAN	Isoform 2 of Nuclear distribution protein nudE homolog 1 OS=Homo sapiens OX=9606 GN=NDE1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|O94842-2|TOX4_HUMAN	Isoform 2 of TOX high mobility group box family member 4 OS=Homo sapiens OX=9606 GN=TOX4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q9UBR2|CATZ_HUMAN	Cathepsin Z OS=Homo sapiens OX=9606 GN=CTSZ PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null	170-UNIMOD:4,173-UNIMOD:4	0.04	20.0	1	1	1
PRT	sp|P17480|UBF1_HUMAN	Nucleolar transcription factor 1 OS=Homo sapiens OX=9606 GN=UBTF PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q99497|PARK7_HUMAN	Protein/nucleic acid deglycase DJ-1 OS=Homo sapiens OX=9606 GN=PARK7 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.05	20.0	1	1	1
PRT	sp|Q4V328-4|GRAP1_HUMAN	Isoform 4 of GRIP1-associated protein 1 OS=Homo sapiens OX=9606 GN=GRIPAP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.03	20.0	2	2	2
PRT	sp|Q9UPN6-2|SCAF8_HUMAN	Isoform 2 of Protein SCAF8 OS=Homo sapiens OX=9606 GN=SCAF8	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q6UB35|C1TM_HUMAN	Monofunctional C1-tetrahydrofolate synthase, mitochondrial OS=Homo sapiens OX=9606 GN=MTHFD1L PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null	198-UNIMOD:4	0.01	20.0	1	1	1
PRT	sp|O43633|CHM2A_HUMAN	Charged multivesicular body protein 2a OS=Homo sapiens OX=9606 GN=CHMP2A PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.05	20.0	1	1	1
PRT	sp|Q9NX40|OCAD1_HUMAN	OCIA domain-containing protein 1 OS=Homo sapiens OX=9606 GN=OCIAD1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.05	20.0	1	1	1
PRT	sp|Q96SZ5|AEDO_HUMAN	2-aminoethanethiol dioxygenase OS=Homo sapiens OX=9606 GN=ADO PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|Q8WWM7|ATX2L_HUMAN	Ataxin-2-like protein OS=Homo sapiens OX=9606 GN=ATXN2L PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.02	20.0	2	2	2
PRT	sp|Q9UBQ7|GRHPR_HUMAN	Glyoxylate reductase/hydroxypyruvate reductase OS=Homo sapiens OX=9606 GN=GRHPR PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|Q9H0U3|MAGT1_HUMAN	Magnesium transporter protein 1 OS=Homo sapiens OX=9606 GN=MAGT1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	20.0	null		0.03	20.0	2	1	0
PRT	sp|O60341-2|KDM1A_HUMAN	Isoform 2 of Lysine-specific histone demethylase 1A OS=Homo sapiens OX=9606 GN=KDM1A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null	515-UNIMOD:4	0.04	20.0	3	3	3
PRT	sp|Q9Y2Q5-2|LTOR2_HUMAN	Isoform 2 of Ragulator complex protein LAMTOR2 OS=Homo sapiens OX=9606 GN=LAMTOR2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.09	20.0	1	1	1
PRT	sp|Q9BY44-3|EIF2A_HUMAN	Isoform 3 of Eukaryotic translation initiation factor 2A OS=Homo sapiens OX=9606 GN=EIF2A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|Q12888-2|TP53B_HUMAN	Isoform 2 of TP53-binding protein 1 OS=Homo sapiens OX=9606 GN=TP53BP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q02539|H11_HUMAN	Histone H1.1 OS=Homo sapiens OX=9606 GN=HIST1H1A PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	20.0	null		0.12	20.0	2	2	2
PRT	sp|O95749-2|GGPPS_HUMAN	Isoform 2 of Geranylgeranyl pyrophosphate synthase OS=Homo sapiens OX=9606 GN=GGPS1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.05	20.0	1	1	1
PRT	sp|P48556|PSMD8_HUMAN	26S proteasome non-ATPase regulatory subunit 8 OS=Homo sapiens OX=9606 GN=PSMD8 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.03	20.0	2	1	0
PRT	sp|O15083|ERC2_HUMAN	ERC protein 2 OS=Homo sapiens OX=9606 GN=ERC2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q9NWT1|PK1IP_HUMAN	p21-activated protein kinase-interacting protein 1 OS=Homo sapiens OX=9606 GN=PAK1IP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|Q5TZA2|CROCC_HUMAN	Rootletin OS=Homo sapiens OX=9606 GN=CROCC PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.00	20.0	1	1	1
PRT	sp|Q7Z3B4-3|NUP54_HUMAN	Isoform 3 of Nucleoporin p54 OS=Homo sapiens OX=9606 GN=NUP54	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|Q92542-2|NICA_HUMAN	Isoform 2 of Nicastrin OS=Homo sapiens OX=9606 GN=NCSTN	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|P0CG13|CTF8_HUMAN	Chromosome transmission fidelity protein 8 homolog OS=Homo sapiens OX=9606 GN=CHTF8 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.08	20.0	1	1	1
PRT	sp|P28482|MK01_HUMAN	Mitogen-activated protein kinase 1 OS=Homo sapiens OX=9606 GN=MAPK1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|Q92793-2|CBP_HUMAN	Isoform 2 of CREB-binding protein OS=Homo sapiens OX=9606 GN=CREBBP	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null	1737-UNIMOD:4,1745-UNIMOD:4,1747-UNIMOD:4	0.01	20.0	1	1	1
PRT	sp|P35606-2|COPB2_HUMAN	Isoform 2 of Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q9UG63-2|ABCF2_HUMAN	Isoform 2 of ATP-binding cassette sub-family F member 2 OS=Homo sapiens OX=9606 GN=ABCF2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|O95793-2|STAU1_HUMAN	Isoform Short of Double-stranded RNA-binding protein Staufen homolog 1 OS=Homo sapiens OX=9606 GN=STAU1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q9H9A5-6|CNO10_HUMAN	Isoform 6 of CCR4-NOT transcription complex subunit 10 OS=Homo sapiens OX=9606 GN=CNOT10	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q9Y324|FCF1_HUMAN	rRNA-processing protein FCF1 homolog OS=Homo sapiens OX=9606 GN=FCF1 PE=2 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null	144-UNIMOD:4	0.06	20.0	1	1	1
PRT	sp|Q5TAX3|TUT4_HUMAN	Terminal uridylyltransferase 4 OS=Homo sapiens OX=9606 GN=TUT4 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q9UBS4|DJB11_HUMAN	DnaJ homolog subfamily B member 11 OS=Homo sapiens OX=9606 GN=DNAJB11 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|Q53H82|LACB2_HUMAN	Endoribonuclease LACTB2 OS=Homo sapiens OX=9606 GN=LACTB2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null	100-UNIMOD:4	0.04	20.0	1	1	1
PRT	sp|P49454|CENPF_HUMAN	Centromere protein F OS=Homo sapiens OX=9606 GN=CENPF PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.00	20.0	1	1	1
PRT	sp|Q9NR46-2|SHLB2_HUMAN	Isoform 2 of Endophilin-B2 OS=Homo sapiens OX=9606 GN=SH3GLB2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null	271-UNIMOD:4	0.05	20.0	2	2	2
PRT	sp|Q8TAD8|SNIP1_HUMAN	Smad nuclear-interacting protein 1 OS=Homo sapiens OX=9606 GN=SNIP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null	299-UNIMOD:4	0.04	20.0	1	1	1
PRT	sp|P07951-2|TPM2_HUMAN	Isoform 2 of Tropomyosin beta chain OS=Homo sapiens OX=9606 GN=TPM2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|A4UGR9-8|XIRP2_HUMAN	Isoform 8 of Xin actin-binding repeat-containing protein 2 OS=Homo sapiens OX=9606 GN=XIRP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.00	20.0	1	1	1
PRT	sp|Q13642-1|FHL1_HUMAN	Isoform 1 of Four and a half LIM domains protein 1 OS=Homo sapiens OX=9606 GN=FHL1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.05	20.0	1	1	1
PRT	sp|Q6PKG0|LARP1_HUMAN	La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.02	20.0	2	2	2
PRT	sp|Q92576-2|PHF3_HUMAN	Isoform 2 of PHD finger protein 3 OS=Homo sapiens OX=9606 GN=PHF3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.03	20.0	4	4	4
PRT	sp|Q15042|RB3GP_HUMAN	Rab3 GTPase-activating protein catalytic subunit OS=Homo sapiens OX=9606 GN=RAB3GAP1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q15120-2|PDK3_HUMAN	Isoform 2 of [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 3, mitochondrial OS=Homo sapiens OX=9606 GN=PDK3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|P09936|UCHL1_HUMAN	Ubiquitin carboxyl-terminal hydrolase isozyme L1 OS=Homo sapiens OX=9606 GN=UCHL1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null	152-UNIMOD:4	0.13	20.0	3	2	1
PRT	sp|Q9UKE5-3|TNIK_HUMAN	Isoform 3 of TRAF2 and NCK-interacting protein kinase OS=Homo sapiens OX=9606 GN=TNIK	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q8TBA6-2|GOGA5_HUMAN	Isoform 2 of Golgin subfamily A member 5 OS=Homo sapiens OX=9606 GN=GOLGA5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q6PJT7-2|ZC3HE_HUMAN	Isoform 2 of Zinc finger CCCH domain-containing protein 14 OS=Homo sapiens OX=9606 GN=ZC3H14	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.04	20.0	2	2	2
PRT	sp|P41229-2|KDM5C_HUMAN	Isoform 2 of Lysine-specific demethylase 5C OS=Homo sapiens OX=9606 GN=KDM5C	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|P46977-2|STT3A_HUMAN	Isoform 2 of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A OS=Homo sapiens OX=9606 GN=STT3A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q9UBD5-2|ORC3_HUMAN	Isoform 2 of Origin recognition complex subunit 3 OS=Homo sapiens OX=9606 GN=ORC3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null	483-UNIMOD:4	0.02	20.0	1	1	1
PRT	sp|Q76NI1-3|KNDC1_HUMAN	Isoform 3 of Kinase non-catalytic C-lobe domain-containing protein 1 OS=Homo sapiens OX=9606 GN=KNDC1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|O75569|PRKRA_HUMAN	Interferon-inducible double-stranded RNA-dependent protein kinase activator A OS=Homo sapiens OX=9606 GN=PRKRA PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|Q6YN16-2|HSDL2_HUMAN	Isoform 2 of Hydroxysteroid dehydrogenase-like protein 2 OS=Homo sapiens OX=9606 GN=HSDL2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|Q9UPV0-2|CE164_HUMAN	Isoform 2 of Centrosomal protein of 164 kDa OS=Homo sapiens OX=9606 GN=CEP164	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|O15372|EIF3H_HUMAN	Eukaryotic translation initiation factor 3 subunit H OS=Homo sapiens OX=9606 GN=EIF3H PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.06	20.0	2	2	2
PRT	sp|Q8WWK9-6|CKAP2_HUMAN	Isoform 4 of Cytoskeleton-associated protein 2 OS=Homo sapiens OX=9606 GN=CKAP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|Q4G0J3|LARP7_HUMAN	La-related protein 7 OS=Homo sapiens OX=9606 GN=LARP7 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q15773|MLF2_HUMAN	Myeloid leukemia factor 2 OS=Homo sapiens OX=9606 GN=MLF2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.05	20.0	2	1	0
PRT	sp|Q9NWY4|HPF1_HUMAN	Histone PARylation factor 1 OS=Homo sapiens OX=9606 GN=HPF1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|Q9GZU8|PIP30_HUMAN	PSME3-interacting protein OS=Homo sapiens OX=9606 GN=FAM192A PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.05	20.0	1	1	1
PRT	sp|Q9NRA8-3|4ET_HUMAN	Isoform 3 of Eukaryotic translation initiation factor 4E transporter OS=Homo sapiens OX=9606 GN=EIF4ENIF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null	125-UNIMOD:4	0.02	20.0	1	1	1
PRT	sp|Q96PC5|MIA2_HUMAN	Melanoma inhibitory activity protein 2 OS=Homo sapiens OX=9606 GN=MIA2 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null	739-UNIMOD:4	0.01	20.0	1	1	1
PRT	sp|Q06481-2|APLP2_HUMAN	Isoform 2 of Amyloid-like protein 2 OS=Homo sapiens OX=9606 GN=APLP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q14739|LBR_HUMAN	Lamin-B receptor OS=Homo sapiens OX=9606 GN=LBR PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q00765|REEP5_HUMAN	Receptor expression-enhancing protein 5 OS=Homo sapiens OX=9606 GN=REEP5 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.06	20.0	1	1	1
PRT	sp|O15294-3|OGT1_HUMAN	Isoform 1 of UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Homo sapiens OX=9606 GN=OGT	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|P53794|SC5A3_HUMAN	Sodium/myo-inositol cotransporter OS=Homo sapiens OX=9606 GN=SLC5A3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null	346-UNIMOD:4	0.02	20.0	1	1	1
PRT	sp|Q96F86|EDC3_HUMAN	Enhancer of mRNA-decapping protein 3 OS=Homo sapiens OX=9606 GN=EDC3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|P61244|MAX_HUMAN	Protein max OS=Homo sapiens OX=9606 GN=MAX PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.08	20.0	1	1	1
PRT	sp|Q9BYN8|RT26_HUMAN	28S ribosomal protein S26, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS26 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.06	20.0	1	1	1
PRT	sp|Q9H3P2|NELFA_HUMAN	Negative elongation factor A OS=Homo sapiens OX=9606 GN=NELFA PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	20.0	null		0.04	20.0	2	2	2
PRT	sp|Q68E01-3|INT3_HUMAN	Isoform 3 of Integrator complex subunit 3 OS=Homo sapiens OX=9606 GN=INTS3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q9HCU5|PREB_HUMAN	Prolactin regulatory element-binding protein OS=Homo sapiens OX=9606 GN=PREB PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|Q6FIF0-2|ZFAN6_HUMAN	Isoform 2 of AN1-type zinc finger protein 6 OS=Homo sapiens OX=9606 GN=ZFAND6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null	169-UNIMOD:4	0.07	20.0	1	1	1
PRT	sp|Q13126-2|MTAP_HUMAN	Isoform 2 of S-methyl-5'-thioadenosine phosphorylase OS=Homo sapiens OX=9606 GN=MTAP	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|Q16825|PTN21_HUMAN	Tyrosine-protein phosphatase non-receptor type 21 OS=Homo sapiens OX=9606 GN=PTPN21 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|P37088-2|SCNNA_HUMAN	Isoform 2 of Amiloride-sensitive sodium channel subunit alpha OS=Homo sapiens OX=9606 GN=SCNN1A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q16637-2|SMN_HUMAN	Isoform SMN-delta5 of Survival motor neuron protein OS=Homo sapiens OX=9606 GN=SMN1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.05	20.0	1	1	1
PRT	sp|P63302|SELW_HUMAN	Selenoprotein W OS=Homo sapiens OX=9606 GN=SELENOW PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.11	20.0	1	1	1
PRT	sp|Q9UH73-2|COE1_HUMAN	Isoform 2 of Transcription factor COE1 OS=Homo sapiens OX=9606 GN=EBF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null	339-UNIMOD:4	0.04	20.0	1	1	0
PRT	sp|Q13085|ACACA_HUMAN	Acetyl-CoA carboxylase 1 OS=Homo sapiens OX=9606 GN=ACACA PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null		0.01	20.0	1	1	0
PRT	sp|Q8IWS0|PHF6_HUMAN	PHD finger protein 6 OS=Homo sapiens OX=9606 GN=PHF6 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null		0.05	20.0	1	1	0
PRT	sp|Q16643|DREB_HUMAN	Drebrin OS=Homo sapiens OX=9606 GN=DBN1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20.0	null	239-UNIMOD:28	0.02	20.0	1	1	1
PRT	sp|P32322|P5CR1_HUMAN	Pyrroline-5-carboxylate reductase 1, mitochondrial OS=Homo sapiens OX=9606 GN=PYCR1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|Q9UIG0|BAZ1B_HUMAN	Tyrosine-protein kinase BAZ1B OS=Homo sapiens OX=9606 GN=BAZ1B PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|O95394|AGM1_HUMAN	Phosphoacetylglucosamine mutase OS=Homo sapiens OX=9606 GN=PGM3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null		0.03	20.0	1	1	0
PRT	sp|P0DME0|SETLP_HUMAN	Protein SETSIP OS=Homo sapiens OX=9606 GN=SETSIP PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null		0.05	20.0	2	1	0
PRT	sp|Q5T8P6|RBM26_HUMAN	RNA-binding protein 26 OS=Homo sapiens OX=9606 GN=RBM26 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20.0	null		0.01	20.0	1	1	0
PRT	sp|P60660|MYL6_HUMAN	Myosin light polypeptide 6 OS=Homo sapiens OX=9606 GN=MYL6 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null		0.09	20.0	1	1	0
PRT	sp|P62273|RS29_HUMAN	40S ribosomal protein S29 OS=Homo sapiens OX=9606 GN=RPS29 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20.0	null		0.21	20.0	1	1	0
PRT	sp|Q2NL82|TSR1_HUMAN	Pre-rRNA-processing protein TSR1 homolog OS=Homo sapiens OX=9606 GN=TSR1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q6FIF0|ZFAN6_HUMAN	AN1-type zinc finger protein 6 OS=Homo sapiens OX=9606 GN=ZFAND6 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20.0	null	165-UNIMOD:385,165-UNIMOD:4,170-UNIMOD:4	0.05	20.0	1	1	1
PRT	sp|Q9NW64|RBM22_HUMAN	Pre-mRNA-splicing factor RBM22 OS=Homo sapiens OX=9606 GN=RBM22 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20.0	null	2-UNIMOD:1	0.03	20.0	1	1	1
PRT	sp|O15270|SPTC2_HUMAN	Serine palmitoyltransferase 2 OS=Homo sapiens OX=9606 GN=SPTLC2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null	438-UNIMOD:4	0.02	20.0	1	1	1
PRT	sp|P36543|VATE1_HUMAN	V-type proton ATPase subunit E 1 OS=Homo sapiens OX=9606 GN=ATP6V1E1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20.0	null	2-UNIMOD:1	0.04	20.0	1	1	1
PRT	sp|Q9NZJ0|DTL_HUMAN	Denticleless protein homolog OS=Homo sapiens OX=9606 GN=DTL PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null	136-UNIMOD:4	0.01	20.0	1	1	1
PRT	sp|O00764|PDXK_HUMAN	Pyridoxal kinase OS=Homo sapiens OX=9606 GN=PDXK PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|P47897|SYQ_HUMAN	Glutamine--tRNA ligase OS=Homo sapiens OX=9606 GN=QARS PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q15436|SC23A_HUMAN	Protein transport protein Sec23A OS=Homo sapiens OX=9606 GN=SEC23A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q9BX40|LS14B_HUMAN	Protein LSM14 homolog B OS=Homo sapiens OX=9606 GN=LSM14B PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	20.0	null	2-UNIMOD:1	0.07	20.0	2	2	2
PRT	sp|Q8N684|CPSF7_HUMAN	Cleavage and polyadenylation specificity factor subunit 7 OS=Homo sapiens OX=9606 GN=CPSF7 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|P14735|IDE_HUMAN	Insulin-degrading enzyme OS=Homo sapiens OX=9606 GN=IDE PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q7L311|ARMX2_HUMAN	Armadillo repeat-containing X-linked protein 2 OS=Homo sapiens OX=9606 GN=ARMCX2 PE=2 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q8NEV1|CSK23_HUMAN	Casein kinase II subunit alpha 3 OS=Homo sapiens OX=9606 GN=CSNK2A3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q9UJY4|GGA2_HUMAN	ADP-ribosylation factor-binding protein GGA2 OS=Homo sapiens OX=9606 GN=GGA2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|P11388|TOP2A_HUMAN	DNA topoisomerase 2-alpha OS=Homo sapiens OX=9606 GN=TOP2A PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q9BQE3|TBA1C_HUMAN	Tubulin alpha-1C chain OS=Homo sapiens OX=9606 GN=TUBA1C PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q5SRE5|NU188_HUMAN	Nucleoporin NUP188 homolog OS=Homo sapiens OX=9606 GN=NUP188 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q9NWB6|ARGL1_HUMAN	Arginine and glutamate-rich protein 1 OS=Homo sapiens OX=9606 GN=ARGLU1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q92667|AKAP1_HUMAN	A-kinase anchor protein 1, mitochondrial OS=Homo sapiens OX=9606 GN=AKAP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q2TAY7|SMU1_HUMAN	WD40 repeat-containing protein SMU1 OS=Homo sapiens OX=9606 GN=SMU1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null	383-UNIMOD:4	0.02	19.0	1	1	1
PRT	sp|Q7Z4W1|DCXR_HUMAN	L-xylulose reductase OS=Homo sapiens OX=9606 GN=DCXR PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.05	19.0	2	1	0
PRT	sp|P62244|RS15A_HUMAN	40S ribosomal protein S15a OS=Homo sapiens OX=9606 GN=RPS15A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null	30-UNIMOD:4	0.08	19.0	1	1	1
PRT	sp|P50148|GNAQ_HUMAN	Guanine nucleotide-binding protein G(q) subunit alpha OS=Homo sapiens OX=9606 GN=GNAQ PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.04	19.0	1	1	1
PRT	sp|Q8TC07-2|TBC15_HUMAN	Isoform 2 of TBC1 domain family member 15 OS=Homo sapiens OX=9606 GN=TBC1D15	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null	197-UNIMOD:4	0.02	19.0	1	1	1
PRT	sp|P09543|CN37_HUMAN	2',3'-cyclic-nucleotide 3'-phosphodiesterase OS=Homo sapiens OX=9606 GN=CNP PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|P47756-2|CAPZB_HUMAN	Isoform 2 of F-actin-capping protein subunit beta OS=Homo sapiens OX=9606 GN=CAPZB	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q9UBB6-2|NCDN_HUMAN	Isoform 2 of Neurochondrin OS=Homo sapiens OX=9606 GN=NCDN	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q9NPD3|EXOS4_HUMAN	Exosome complex component RRP41 OS=Homo sapiens OX=9606 GN=EXOSC4 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.04	19.0	1	1	1
PRT	sp|Q9H0E3|SP130_HUMAN	Histone deacetylase complex subunit SAP130 OS=Homo sapiens OX=9606 GN=SAP130 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|P16435|NCPR_HUMAN	NADPH--cytochrome P450 reductase OS=Homo sapiens OX=9606 GN=POR PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.03	19.0	2	2	2
PRT	sp|Q86X76-4|NIT1_HUMAN	Isoform 5 of Deaminated glutathione amidase OS=Homo sapiens OX=9606 GN=NIT1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q9NXV6|CARF_HUMAN	CDKN2A-interacting protein OS=Homo sapiens OX=9606 GN=CDKN2AIP PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q08AM6|VAC14_HUMAN	Protein VAC14 homolog OS=Homo sapiens OX=9606 GN=VAC14 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q9BXW9-1|FACD2_HUMAN	Isoform 1 of Fanconi anemia group D2 protein OS=Homo sapiens OX=9606 GN=FANCD2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null	113-UNIMOD:4,117-UNIMOD:4	0.01	19.0	2	2	2
PRT	sp|Q7L0J3-2|SV2A_HUMAN	Isoform 2 of Synaptic vesicle glycoprotein 2A OS=Homo sapiens OX=9606 GN=SV2A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|O43432-3|IF4G3_HUMAN	Isoform 3 of Eukaryotic translation initiation factor 4 gamma 3 OS=Homo sapiens OX=9606 GN=EIF4G3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q15785|TOM34_HUMAN	Mitochondrial import receptor subunit TOM34 OS=Homo sapiens OX=9606 GN=TOMM34 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.04	19.0	1	1	1
PRT	sp|Q9P035|HACD3_HUMAN	Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 3 OS=Homo sapiens OX=9606 GN=HACD3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|P40429|RL13A_HUMAN	60S ribosomal protein L13a OS=Homo sapiens OX=9606 GN=RPL13A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.04	19.0	2	1	0
PRT	sp|Q9Y6Y0|NS1BP_HUMAN	Influenza virus NS1A-binding protein OS=Homo sapiens OX=9606 GN=IVNS1ABP PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null	32-UNIMOD:4	0.01	19.0	1	1	1
PRT	sp|Q96FV9|THOC1_HUMAN	THO complex subunit 1 OS=Homo sapiens OX=9606 GN=THOC1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q9NX14-2|NDUBB_HUMAN	Isoform 2 of NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFB11	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.07	19.0	1	1	1
PRT	sp|P19525|E2AK2_HUMAN	Interferon-induced, double-stranded RNA-activated protein kinase OS=Homo sapiens OX=9606 GN=EIF2AK2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|P30154-2|2AAB_HUMAN	Isoform 2 of Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform OS=Homo sapiens OX=9606 GN=PPP2R1B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q8NHH9-2|ATLA2_HUMAN	Isoform 2 of Atlastin-2 OS=Homo sapiens OX=9606 GN=ATL2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q14126|DSG2_HUMAN	Desmoglein-2 OS=Homo sapiens OX=9606 GN=DSG2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q8NFQ8|TOIP2_HUMAN	Torsin-1A-interacting protein 2 OS=Homo sapiens OX=9606 GN=TOR1AIP2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|O14602|IF1AY_HUMAN	Eukaryotic translation initiation factor 1A, Y-chromosomal OS=Homo sapiens OX=9606 GN=EIF1AY PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.08	19.0	1	1	1
PRT	sp|Q16881-3|TRXR1_HUMAN	Isoform 3 of Thioredoxin reductase 1, cytoplasmic OS=Homo sapiens OX=9606 GN=TXNRD1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|P51116|FXR2_HUMAN	Fragile X mental retardation syndrome-related protein 2 OS=Homo sapiens OX=9606 GN=FXR2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null	282-UNIMOD:4	0.02	19.0	1	1	1
PRT	sp|Q9H3U1-2|UN45A_HUMAN	Isoform 2 of Protein unc-45 homolog A OS=Homo sapiens OX=9606 GN=UNC45A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null	648-UNIMOD:4,208-UNIMOD:4	0.03	19.0	2	2	2
PRT	sp|Q9H3K2|GHITM_HUMAN	Growth hormone-inducible transmembrane protein OS=Homo sapiens OX=9606 GN=GHITM PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.07	19.0	2	2	2
PRT	sp|Q8IWZ8|SUGP1_HUMAN	SURP and G-patch domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SUGP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|P46776|RL27A_HUMAN	60S ribosomal protein L27a OS=Homo sapiens OX=9606 GN=RPL27A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.06	19.0	2	1	0
PRT	sp|O95372|LYPA2_HUMAN	Acyl-protein thioesterase 2 OS=Homo sapiens OX=9606 GN=LYPLA2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.04	19.0	1	1	1
PRT	sp|P15927-3|RFA2_HUMAN	Isoform 3 of Replication protein A 32 kDa subunit OS=Homo sapiens OX=9606 GN=RPA2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q9NSD9|SYFB_HUMAN	Phenylalanine--tRNA ligase beta subunit OS=Homo sapiens OX=9606 GN=FARSB PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|O94874|UFL1_HUMAN	E3 UFM1-protein ligase 1 OS=Homo sapiens OX=9606 GN=UFL1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null	32-UNIMOD:4	0.01	19.0	1	1	1
PRT	sp|Q13576|IQGA2_HUMAN	Ras GTPase-activating-like protein IQGAP2 OS=Homo sapiens OX=9606 GN=IQGAP2 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|O00291-4|HIP1_HUMAN	Isoform 4 of Huntingtin-interacting protein 1 OS=Homo sapiens OX=9606 GN=HIP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|P51665|PSMD7_HUMAN	26S proteasome non-ATPase regulatory subunit 7 OS=Homo sapiens OX=9606 GN=PSMD7 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|P49189|AL9A1_HUMAN	4-trimethylaminobutyraldehyde dehydrogenase OS=Homo sapiens OX=9606 GN=ALDH9A1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null	45-UNIMOD:4	0.04	19.0	2	2	2
PRT	sp|Q8WVB6-2|CTF18_HUMAN	Isoform 2 of Chromosome transmission fidelity protein 18 homolog OS=Homo sapiens OX=9606 GN=CHTF18	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|P98175|RBM10_HUMAN	RNA-binding protein 10 OS=Homo sapiens OX=9606 GN=RBM10 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|P62993|GRB2_HUMAN	Growth factor receptor-bound protein 2 OS=Homo sapiens OX=9606 GN=GRB2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.05	19.0	1	1	1
PRT	sp|Q15054|DPOD3_HUMAN	DNA polymerase delta subunit 3 OS=Homo sapiens OX=9606 GN=POLD3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q99613|EIF3C_HUMAN	Eukaryotic translation initiation factor 3 subunit C OS=Homo sapiens OX=9606 GN=EIF3C PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19.0	null		0.01	19.0	1	1	0
PRT	sp|Q12872-2|SFSWA_HUMAN	Isoform 2 of Splicing factor, suppressor of white-apricot homolog OS=Homo sapiens OX=9606 GN=SFSWAP	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null	110-UNIMOD:4	0.01	19.0	1	1	1
PRT	sp|O75190-3|DNJB6_HUMAN	Isoform C of DnaJ homolog subfamily B member 6 OS=Homo sapiens OX=9606 GN=DNAJB6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|P51784|UBP11_HUMAN	Ubiquitin carboxyl-terminal hydrolase 11 OS=Homo sapiens OX=9606 GN=USP11 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null	894-UNIMOD:4	0.01	19.0	1	1	1
PRT	sp|Q9UHY1|NRBP_HUMAN	Nuclear receptor-binding protein OS=Homo sapiens OX=9606 GN=NRBP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.05	19.0	2	2	2
PRT	sp|Q5HYK3|COQ5_HUMAN	2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial OS=Homo sapiens OX=9606 GN=COQ5 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.04	19.0	1	1	1
PRT	sp|Q00341|VIGLN_HUMAN	Vigilin OS=Homo sapiens OX=9606 GN=HDLBP PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.01	19.0	2	2	2
PRT	sp|P12004|PCNA_HUMAN	Proliferating cell nuclear antigen OS=Homo sapiens OX=9606 GN=PCNA PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q9HAV7|GRPE1_HUMAN	GrpE protein homolog 1, mitochondrial OS=Homo sapiens OX=9606 GN=GRPEL1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.05	19.0	1	1	1
PRT	sp|O43657|TSN6_HUMAN	Tetraspanin-6 OS=Homo sapiens OX=9606 GN=TSPAN6 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null	197-UNIMOD:4	0.04	19.0	1	1	1
PRT	sp|O00203-3|AP3B1_HUMAN	Isoform 2 of AP-3 complex subunit beta-1 OS=Homo sapiens OX=9606 GN=AP3B1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q96A57-2|TM230_HUMAN	Isoform 1 of Transmembrane protein 230 OS=Homo sapiens OX=9606 GN=TMEM230	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.07	19.0	1	1	1
PRT	sp|Q6VEQ5|WASH2_HUMAN	WAS protein family homolog 2 OS=Homo sapiens OX=9606 GN=WASH2P PE=2 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q9H974-4|QTRT2_HUMAN	Isoform 4 of Queuine tRNA-ribosyltransferase accessory subunit 2 OS=Homo sapiens OX=9606 GN=QTRT2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q92878-2|RAD50_HUMAN	Isoform 2 of DNA repair protein RAD50 OS=Homo sapiens OX=9606 GN=RAD50	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null	1302-UNIMOD:4	0.02	19.0	2	2	2
PRT	sp|Q8IUI8-2|CRLF3_HUMAN	Isoform 2 of Cytokine receptor-like factor 3 OS=Homo sapiens OX=9606 GN=CRLF3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|O43768-3|ENSA_HUMAN	Isoform 3 of Alpha-endosulfine OS=Homo sapiens OX=9606 GN=ENSA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.09	19.0	1	1	1
PRT	sp|Q9NPL8|TIDC1_HUMAN	Complex I assembly factor TIMMDC1, mitochondrial OS=Homo sapiens OX=9606 GN=TIMMDC1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.06	19.0	1	1	1
PRT	sp|P30533|AMRP_HUMAN	Alpha-2-macroglobulin receptor-associated protein OS=Homo sapiens OX=9606 GN=LRPAP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q9H6R3|ACSS3_HUMAN	Acyl-CoA synthetase short-chain family member 3, mitochondrial OS=Homo sapiens OX=9606 GN=ACSS3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q9BW91|NUDT9_HUMAN	ADP-ribose pyrophosphatase, mitochondrial OS=Homo sapiens OX=9606 GN=NUDT9 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|P16104|H2AX_HUMAN	Histone H2AX OS=Homo sapiens OX=9606 GN=H2AFX PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.06	19.0	8	1	0
PRT	sp|Q6UW02-2|CP20A_HUMAN	Isoform 2 of Cytochrome P450 20A1 OS=Homo sapiens OX=9606 GN=CYP20A1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null	299-UNIMOD:4,304-UNIMOD:4	0.03	19.0	1	1	1
PRT	sp|Q16762|THTR_HUMAN	Thiosulfate sulfurtransferase OS=Homo sapiens OX=9606 GN=TST PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.06	19.0	2	1	0
PRT	sp|O43181|NDUS4_HUMAN	NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFS4 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.06	19.0	1	1	1
PRT	sp|Q05D32-2|CTSL2_HUMAN	Isoform 2 of CTD small phosphatase-like protein 2 OS=Homo sapiens OX=9606 GN=CTDSPL2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null	307-UNIMOD:4,309-UNIMOD:4	0.03	19.0	1	1	1
PRT	sp|O15371-2|EIF3D_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit D OS=Homo sapiens OX=9606 GN=EIF3D	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q9NT62-2|ATG3_HUMAN	Isoform 2 of Ubiquitin-like-conjugating enzyme ATG3 OS=Homo sapiens OX=9606 GN=ATG3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.05	19.0	1	1	1
PRT	sp|P07099|HYEP_HUMAN	Epoxide hydrolase 1 OS=Homo sapiens OX=9606 GN=EPHX1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|O95602|RPA1_HUMAN	DNA-directed RNA polymerase I subunit RPA1 OS=Homo sapiens OX=9606 GN=POLR1A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|P42696|RBM34_HUMAN	RNA-binding protein 34 OS=Homo sapiens OX=9606 GN=RBM34 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q15555-3|MARE2_HUMAN	Isoform 3 of Microtubule-associated protein RP/EB family member 2 OS=Homo sapiens OX=9606 GN=MAPRE2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q15652|JHD2C_HUMAN	Probable JmjC domain-containing histone demethylation protein 2C OS=Homo sapiens OX=9606 GN=JMJD1C PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null	1814-UNIMOD:4	0.00	19.0	1	1	1
PRT	sp|Q9HBK9|AS3MT_HUMAN	Arsenite methyltransferase OS=Homo sapiens OX=9606 GN=AS3MT PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q9H4A4|AMPB_HUMAN	Aminopeptidase B OS=Homo sapiens OX=9606 GN=RNPEP PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|O95782|AP2A1_HUMAN	AP-2 complex subunit alpha-1 OS=Homo sapiens OX=9606 GN=AP2A1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q15738|NSDHL_HUMAN	Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating OS=Homo sapiens OX=9606 GN=NSDHL PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null	104-UNIMOD:4	0.08	19.0	2	2	2
PRT	sp|Q8WX92|NELFB_HUMAN	Negative elongation factor B OS=Homo sapiens OX=9606 GN=NELFB PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null	23-UNIMOD:4	0.02	19.0	1	1	1
PRT	sp|Q8TF01|PNISR_HUMAN	Arginine/serine-rich protein PNISR OS=Homo sapiens OX=9606 GN=PNISR PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|P61224-2|RAP1B_HUMAN	Isoform 2 of Ras-related protein Rap-1b OS=Homo sapiens OX=9606 GN=RAP1B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.09	19.0	1	1	1
PRT	sp|P46783|RS10_HUMAN	40S ribosomal protein S10 OS=Homo sapiens OX=9606 GN=RPS10 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.06	19.0	1	1	1
PRT	sp|Q9H8Y1|VRTN_HUMAN	Vertnin OS=Homo sapiens OX=9606 GN=VRTN PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q99848|EBP2_HUMAN	Probable rRNA-processing protein EBP2 OS=Homo sapiens OX=9606 GN=EBNA1BP2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.04	19.0	2	1	0
PRT	sp|O75844|FACE1_HUMAN	CAAX prenyl protease 1 homolog OS=Homo sapiens OX=9606 GN=ZMPSTE24 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q9GZP4-2|PITH1_HUMAN	Isoform 2 of PITH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PITHD1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.06	19.0	1	1	1
PRT	sp|P54819|KAD2_HUMAN	Adenylate kinase 2, mitochondrial OS=Homo sapiens OX=9606 GN=AK2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null	92-UNIMOD:4	0.04	19.0	1	1	1
PRT	sp|Q9H7Z6-2|KAT8_HUMAN	Isoform 2 of Histone acetyltransferase KAT8 OS=Homo sapiens OX=9606 GN=KAT8	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|O95758-4|PTBP3_HUMAN	Isoform 4 of Polypyrimidine tract-binding protein 3 OS=Homo sapiens OX=9606 GN=PTBP3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q86WR0|CCD25_HUMAN	Coiled-coil domain-containing protein 25 OS=Homo sapiens OX=9606 GN=CCDC25 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.05	19.0	1	1	1
PRT	sp|Q9HD20-2|AT131_HUMAN	Isoform B of Manganese-transporting ATPase 13A1 OS=Homo sapiens OX=9606 GN=ATP13A1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|P49593-2|PPM1F_HUMAN	Isoform 2 of Protein phosphatase 1F OS=Homo sapiens OX=9606 GN=PPM1F	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q9UN81|LORF1_HUMAN	LINE-1 retrotransposable element ORF1 protein OS=Homo sapiens OX=9606 GN=L1RE1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null	76-UNIMOD:4	0.03	19.0	1	1	1
PRT	sp|Q9UKR5|ERG28_HUMAN	Probable ergosterol biosynthetic protein 28 OS=Homo sapiens OX=9606 GN=ERG28 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.06	19.0	1	1	1
PRT	sp|P49721|PSB2_HUMAN	Proteasome subunit beta type-2 OS=Homo sapiens OX=9606 GN=PSMB2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.05	19.0	1	1	1
PRT	sp|Q96AY3|FKB10_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP10 OS=Homo sapiens OX=9606 GN=FKBP10 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|O75420|GGYF1_HUMAN	GRB10-interacting GYF protein 1 OS=Homo sapiens OX=9606 GN=GIGYF1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null	944-UNIMOD:4	0.01	19.0	1	1	1
PRT	sp|P21283|VATC1_HUMAN	V-type proton ATPase subunit C 1 OS=Homo sapiens OX=9606 GN=ATP6V1C1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|O14777|NDC80_HUMAN	Kinetochore protein NDC80 homolog OS=Homo sapiens OX=9606 GN=NDC80 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null	342-UNIMOD:4	0.02	19.0	1	1	1
PRT	sp|Q14137|BOP1_HUMAN	Ribosome biogenesis protein BOP1 OS=Homo sapiens OX=9606 GN=BOP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q8IXM3|RM41_HUMAN	39S ribosomal protein L41, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL41 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.08	19.0	1	1	1
PRT	sp|P18583-3|SON_HUMAN	Isoform B of Protein SON OS=Homo sapiens OX=9606 GN=SON	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.00	19.0	1	1	1
PRT	sp|P07686|HEXB_HUMAN	Beta-hexosaminidase subunit beta OS=Homo sapiens OX=9606 GN=HEXB PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|P40123-2|CAP2_HUMAN	Isoform 2 of Adenylyl cyclase-associated protein 2 OS=Homo sapiens OX=9606 GN=CAP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null	314-UNIMOD:4	0.03	19.0	1	1	1
PRT	sp|P62140|PP1B_HUMAN	Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Homo sapiens OX=9606 GN=PPP1CB PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q8WVT3|TPC12_HUMAN	Trafficking protein particle complex subunit 12 OS=Homo sapiens OX=9606 GN=TRAPPC12 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null	731-UNIMOD:4	0.02	19.0	1	1	1
PRT	sp|Q7L5N1|CSN6_HUMAN	COP9 signalosome complex subunit 6 OS=Homo sapiens OX=9606 GN=COPS6 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null	299-UNIMOD:4	0.04	19.0	1	1	1
PRT	sp|P22059|OSBP1_HUMAN	Oxysterol-binding protein 1 OS=Homo sapiens OX=9606 GN=OSBP PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q7Z417|NUFP2_HUMAN	Nuclear fragile X mental retardation-interacting protein 2 OS=Homo sapiens OX=9606 GN=NUFIP2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q5JWF2-2|GNAS1_HUMAN	Isoform XLas-2 of Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas OS=Homo sapiens OX=9606 GN=GNAS	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q09666|AHNK_HUMAN	Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|P52789|HXK2_HUMAN	Hexokinase-2 OS=Homo sapiens OX=9606 GN=HK2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q9H0D6|XRN2_HUMAN	5'-3' exoribonuclease 2 OS=Homo sapiens OX=9606 GN=XRN2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.03	19.0	3	3	3
PRT	sp|Q15813-2|TBCE_HUMAN	Isoform 2 of Tubulin-specific chaperone E OS=Homo sapiens OX=9606 GN=TBCE	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q96DA6-2|TIM14_HUMAN	Isoform 2 of Mitochondrial import inner membrane translocase subunit TIM14 OS=Homo sapiens OX=9606 GN=DNAJC19	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.11	19.0	1	1	1
PRT	sp|O76041|NEBL_HUMAN	Nebulette OS=Homo sapiens OX=9606 GN=NEBL PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q8NBJ5|GT251_HUMAN	Procollagen galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=COLGALT1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null	369-UNIMOD:4	0.02	19.0	1	1	1
PRT	sp|Q15154-2|PCM1_HUMAN	Isoform 2 of Pericentriolar material 1 protein OS=Homo sapiens OX=9606 GN=PCM1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q8IVW6-4|ARI3B_HUMAN	Isoform 4 of AT-rich interactive domain-containing protein 3B OS=Homo sapiens OX=9606 GN=ARID3B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q8N3U4-2|STAG2_HUMAN	Isoform 2 of Cohesin subunit SA-2 OS=Homo sapiens OX=9606 GN=STAG2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null	632-UNIMOD:4	0.01	19.0	1	1	1
PRT	sp|Q8NFW8|NEUA_HUMAN	N-acylneuraminate cytidylyltransferase OS=Homo sapiens OX=9606 GN=CMAS PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null	394-UNIMOD:4	0.04	19.0	1	1	1
PRT	sp|P13693-2|TCTP_HUMAN	Isoform 2 of Translationally-controlled tumor protein OS=Homo sapiens OX=9606 GN=TPT1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.06	19.0	2	1	0
PRT	sp|Q9Y508-2|RN114_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase RNF114 OS=Homo sapiens OX=9606 GN=RNF114	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null	160-UNIMOD:4	0.07	19.0	1	1	1
PRT	sp|O75122|CLAP2_HUMAN	CLIP-associating protein 2 OS=Homo sapiens OX=9606 GN=CLASP2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|P51003|PAPOA_HUMAN	Poly(A) polymerase alpha OS=Homo sapiens OX=9606 GN=PAPOLA PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null	677-UNIMOD:4	0.03	19.0	1	1	1
PRT	sp|P07305|H10_HUMAN	Histone H1.0 OS=Homo sapiens OX=9606 GN=H1F0 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.05	19.0	1	1	1
PRT	sp|P30048-2|PRDX3_HUMAN	Isoform 2 of Thioredoxin-dependent peroxide reductase, mitochondrial OS=Homo sapiens OX=9606 GN=PRDX3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.05	19.0	1	1	1
PRT	sp|Q69YN4-3|VIR_HUMAN	Isoform 3 of Protein virilizer homolog OS=Homo sapiens OX=9606 GN=VIRMA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|P20337|RAB3B_HUMAN	Ras-related protein Rab-3B OS=Homo sapiens OX=9606 GN=RAB3B PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null	184-UNIMOD:4	0.04	19.0	1	1	1
PRT	sp|P78310|CXAR_HUMAN	Coxsackievirus and adenovirus receptor OS=Homo sapiens OX=9606 GN=CXADR PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	19.0	null	223-UNIMOD:4,41-UNIMOD:4	0.06	19.0	2	2	2
PRT	sp|Q5R372-8|RBG1L_HUMAN	Isoform 8 of Rab GTPase-activating protein 1-like OS=Homo sapiens OX=9606 GN=RABGAP1L	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q7L2J0|MEPCE_HUMAN	7SK snRNA methylphosphate capping enzyme OS=Homo sapiens OX=9606 GN=MEPCE PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null	153-UNIMOD:4	0.02	19.0	1	1	1
PRT	sp|Q92766-2|RREB1_HUMAN	Isoform 2 of Ras-responsive element-binding protein 1 OS=Homo sapiens OX=9606 GN=RREB1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q8N3X1-2|FNBP4_HUMAN	Isoform 2 of Formin-binding protein 4 OS=Homo sapiens OX=9606 GN=FNBP4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q9BVC3|DCC1_HUMAN	Sister chromatid cohesion protein DCC1 OS=Homo sapiens OX=9606 GN=DSCC1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q9BWS9-3|CHID1_HUMAN	Isoform 3 of Chitinase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CHID1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q8N806|UBR7_HUMAN	Putative E3 ubiquitin-protein ligase UBR7 OS=Homo sapiens OX=9606 GN=UBR7 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q9BV20|MTNA_HUMAN	Methylthioribose-1-phosphate isomerase OS=Homo sapiens OX=9606 GN=MRI1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|P56211-2|ARP19_HUMAN	Isoform ARPP-16 of cAMP-regulated phosphoprotein 19 OS=Homo sapiens OX=9606 GN=ARPP19	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.10	19.0	1	1	1
PRT	sp|P52888|THOP1_HUMAN	Thimet oligopeptidase OS=Homo sapiens OX=9606 GN=THOP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q15645|PCH2_HUMAN	Pachytene checkpoint protein 2 homolog OS=Homo sapiens OX=9606 GN=TRIP13 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|O15347|HMGB3_HUMAN	High mobility group protein B3 OS=Homo sapiens OX=9606 GN=HMGB3 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.05	19.0	1	1	1
PRT	sp|Q8N9T8|KRI1_HUMAN	Protein KRI1 homolog OS=Homo sapiens OX=9606 GN=KRI1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q96BR5|COA7_HUMAN	Cytochrome c oxidase assembly factor 7 OS=Homo sapiens OX=9606 GN=COA7 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.04	19.0	1	1	1
PRT	sp|Q96RS0|TGS1_HUMAN	Trimethylguanosine synthase OS=Homo sapiens OX=9606 GN=TGS1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q6RFH5-2|WDR74_HUMAN	Isoform 2 of WD repeat-containing protein 74 OS=Homo sapiens OX=9606 GN=WDR74	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null	201-UNIMOD:4	0.03	19.0	1	1	1
PRT	sp|O60840-2|CAC1F_HUMAN	Isoform 2 of Voltage-dependent L-type calcium channel subunit alpha-1F OS=Homo sapiens OX=9606 GN=CACNA1F	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q3MHD2-2|LSM12_HUMAN	Isoform 2 of Protein LSM12 homolog OS=Homo sapiens OX=9606 GN=LSM12	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.05	19.0	1	1	1
PRT	sp|P29590-11|PML_HUMAN	Isoform PML-11 of Protein PML OS=Homo sapiens OX=9606 GN=PML	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q96S52|PIGS_HUMAN	GPI transamidase component PIG-S OS=Homo sapiens OX=9606 GN=PIGS PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q9NQT5-2|EXOS3_HUMAN	Isoform 2 of Exosome complex component RRP40 OS=Homo sapiens OX=9606 GN=EXOSC3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.07	19.0	1	1	1
PRT	sp|A6NHG4|DDTL_HUMAN	D-dopachrome decarboxylase-like protein OS=Homo sapiens OX=9606 GN=DDTL PE=2 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.07	19.0	1	1	1
PRT	sp|Q9BV40|VAMP8_HUMAN	Vesicle-associated membrane protein 8 OS=Homo sapiens OX=9606 GN=VAMP8 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.15	19.0	1	1	1
PRT	sp|P20338|RAB4A_HUMAN	Ras-related protein Rab-4A OS=Homo sapiens OX=9606 GN=RAB4A PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.05	19.0	1	1	1
PRT	sp|O00512|BCL9_HUMAN	B-cell CLL/lymphoma 9 protein OS=Homo sapiens OX=9606 GN=BCL9 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q8N3J9|ZN664_HUMAN	Zinc finger protein 664 OS=Homo sapiens OX=9606 GN=ZNF664 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null	187-UNIMOD:4	0.11	19.0	1	1	1
PRT	sp|O43709-3|BUD23_HUMAN	Isoform 3 of Probable 18S rRNA (guanine-N(7))-methyltransferase OS=Homo sapiens OX=9606 GN=BUD23	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.04	19.0	1	1	1
PRT	sp|Q96S19-2|MTL26_HUMAN	Isoform 2 of Methyltransferase-like 26 OS=Homo sapiens OX=9606 GN=METTL26	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.12	19.0	1	1	1
PRT	sp|P22680|CP7A1_HUMAN	Cholesterol 7-alpha-monooxygenase OS=Homo sapiens OX=9606 GN=CYP7A1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q9BTU6|P4K2A_HUMAN	Phosphatidylinositol 4-kinase type 2-alpha OS=Homo sapiens OX=9606 GN=PI4K2A PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|P15374|UCHL3_HUMAN	Ubiquitin carboxyl-terminal hydrolase isozyme L3 OS=Homo sapiens OX=9606 GN=UCHL3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.09	19.0	1	1	1
PRT	sp|Q9UHG2|PCSK1_HUMAN	ProSAAS OS=Homo sapiens OX=9606 GN=PCSK1N PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null	1-UNIMOD:35	0.05	19.0	1	1	1
PRT	sp|Q12906|ILF3_HUMAN	Interleukin enhancer-binding factor 3 OS=Homo sapiens OX=9606 GN=ILF3 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19.0	null		0.02	19.0	1	1	0
PRT	sp|Q5T4S7|UBR4_HUMAN	E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19.0	null		0.00	19.0	1	1	1
PRT	sp|P55265|DSRAD_HUMAN	Double-stranded RNA-specific adenosine deaminase OS=Homo sapiens OX=9606 GN=ADAR PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q13428|TCOF_HUMAN	Treacle protein OS=Homo sapiens OX=9606 GN=TCOF1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|O15164|TIF1A_HUMAN	Transcription intermediary factor 1-alpha OS=Homo sapiens OX=9606 GN=TRIM24 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19.0	null	246-UNIMOD:4	0.01	19.0	1	1	1
PRT	sp|Q07866|KLC1_HUMAN	Kinesin light chain 1 OS=Homo sapiens OX=9606 GN=KLC1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q96EP5|DAZP1_HUMAN	DAZ-associated protein 1 OS=Homo sapiens OX=9606 GN=DAZAP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	19.0	null	1-UNIMOD:1	0.03	19.0	1	1	1
PRT	sp|Q96BP3|PPWD1_HUMAN	Peptidylprolyl isomerase domain and WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=PPWD1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	19.0	null	2-UNIMOD:1	0.02	19.0	1	1	1
PRT	sp|P05166|PCCB_HUMAN	Propionyl-CoA carboxylase beta chain, mitochondrial OS=Homo sapiens OX=9606 GN=PCCB PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q9BV86|NTM1A_HUMAN	N-terminal Xaa-Pro-Lys N-methyltransferase 1 OS=Homo sapiens OX=9606 GN=NTMT1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	19.0	null	2-UNIMOD:1	0.04	19.0	1	1	1
PRT	sp|P13674-2|P4HA1_HUMAN	Isoform 2 of Prolyl 4-hydroxylase subunit alpha-1 OS=Homo sapiens OX=9606 GN=P4HA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	19.0	null	328-UNIMOD:28	0.02	19.0	1	1	1
PRT	sp|P52948|NUP98_HUMAN	Nuclear pore complex protein Nup98-Nup96 OS=Homo sapiens OX=9606 GN=NUP98 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	19.0	null		0.01	19.0	2	2	1
PRT	sp|O15294|OGT1_HUMAN	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Homo sapiens OX=9606 GN=OGT PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|O14519|CDKA1_HUMAN	Cyclin-dependent kinase 2-associated protein 1 OS=Homo sapiens OX=9606 GN=CDK2AP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19.0	null		0.10	19.0	1	1	1
PRT	sp|P78417|GSTO1_HUMAN	Glutathione S-transferase omega-1 OS=Homo sapiens OX=9606 GN=GSTO1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19.0	null		0.06	19.0	1	1	1
PRT	sp|Q5ZPR3|CD276_HUMAN	CD276 antigen OS=Homo sapiens OX=9606 GN=CD276 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|P08240|SRPRA_HUMAN	Signal recognition particle receptor subunit alpha OS=Homo sapiens OX=9606 GN=SRPRA PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q9GZT3|SLIRP_HUMAN	SRA stem-loop-interacting RNA-binding protein, mitochondrial OS=Homo sapiens OX=9606 GN=SLIRP PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19.0	null		0.10	19.0	1	1	1
PRT	sp|Q99598|TSNAX_HUMAN	Translin-associated protein X OS=Homo sapiens OX=9606 GN=TSNAX PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19.0	null	257-UNIMOD:4	0.03	19.0	1	1	1
PRT	sp|Q9BPY3|F118B_HUMAN	Protein FAM118B OS=Homo sapiens OX=9606 GN=FAM118B PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19.0	null		0.05	19.0	1	1	1
PRT	sp|P84101|SERF2_HUMAN	Small EDRK-rich factor 2 OS=Homo sapiens OX=9606 GN=SERF2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	19.0	null	38-UNIMOD:28	0.19	19.0	1	1	1
PRT	sp|P00519|ABL1_HUMAN	Tyrosine-protein kinase ABL1 OS=Homo sapiens OX=9606 GN=ABL1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|P07108|ACBP_HUMAN	Acyl-CoA-binding protein OS=Homo sapiens OX=9606 GN=DBI PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	19.0	null	2-UNIMOD:1	0.09	19.0	1	1	1
PRT	sp|Q9UJ83|HACL1_HUMAN	2-hydroxyacyl-CoA lyase 1 OS=Homo sapiens OX=9606 GN=HACL1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	19.0	null	261-UNIMOD:4	0.03	19.0	1	1	1
PRT	sp|Q9ULQ0|STRP2_HUMAN	Striatin-interacting protein 2 OS=Homo sapiens OX=9606 GN=STRIP2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	19.0	null	704-UNIMOD:35	0.01	19.0	1	1	1
PRT	sp|P10644|KAP0_HUMAN	cAMP-dependent protein kinase type I-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR1A PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q96Q05|TPPC9_HUMAN	Trafficking protein particle complex subunit 9 OS=Homo sapiens OX=9606 GN=TRAPPC9 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q9BXP5|SRRT_HUMAN	Serrate RNA effector molecule homolog OS=Homo sapiens OX=9606 GN=SRRT PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19.0	null	412-UNIMOD:4	0.01	19.0	1	1	1
PRT	sp|P06746|DPOLB_HUMAN	DNA polymerase beta OS=Homo sapiens OX=9606 GN=POLB PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|P62736|ACTA_HUMAN	Actin, aortic smooth muscle OS=Homo sapiens OX=9606 GN=ACTA2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19.0	null		0.03	19.0	1	1	0
PRT	sp|Q9ULH0|KDIS_HUMAN	Kinase D-interacting substrate of 220 kDa OS=Homo sapiens OX=9606 GN=KIDINS220 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|P54725|RD23A_HUMAN	UV excision repair protein RAD23 homolog A OS=Homo sapiens OX=9606 GN=RAD23A PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q9HAU0|PKHA5_HUMAN	Pleckstrin homology domain-containing family A member 5 OS=Homo sapiens OX=9606 GN=PLEKHA5 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19.0	null	473-UNIMOD:4	0.02	19.0	1	1	1
PRT	sp|Q9NYC9|DYH9_HUMAN	Dynein heavy chain 9, axonemal OS=Homo sapiens OX=9606 GN=DNAH9 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19.0	null	3832-UNIMOD:4	0.00	19.0	1	1	1
PRT	sp|Q92806|KCNJ9_HUMAN	G protein-activated inward rectifier potassium channel 3 OS=Homo sapiens OX=9606 GN=KCNJ9 PE=2 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|P62491|RB11A_HUMAN	Ras-related protein Rab-11A OS=Homo sapiens OX=9606 GN=RAB11A PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19.0	null		0.05	19.0	1	1	1
PRT	sp|Q92609|TBCD5_HUMAN	TBC1 domain family member 5 OS=Homo sapiens OX=9606 GN=TBC1D5 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q7Z2Z2|EFL1_HUMAN	Elongation factor-like GTPase 1 OS=Homo sapiens OX=9606 GN=EFL1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q99856|ARI3A_HUMAN	AT-rich interactive domain-containing protein 3A OS=Homo sapiens OX=9606 GN=ARID3A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|P06753|TPM3_HUMAN	Tropomyosin alpha-3 chain OS=Homo sapiens OX=9606 GN=TPM3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19.0	null		0.05	19.0	2	2	2
PRT	sp|Q05519|SRS11_HUMAN	Serine/arginine-rich splicing factor 11 OS=Homo sapiens OX=9606 GN=SRSF11 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q96RP9|EFGM_HUMAN	Elongation factor G, mitochondrial OS=Homo sapiens OX=9606 GN=GFM1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19.0	null		0.02	19.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	GGGGPGGGGPGGGSAGGPSQPPGGGGPGIR	1	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	53		ms_run[1]:scan=1.1.8711.11	97.81572	3	2269.0540	2269.0585	R	K	41	71
PSM	APKPDGPGGGPGGSHMGGNYGDDR	2	sp|P35637-2|FUS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	51		ms_run[1]:scan=1.1.7869.9	75.6541	4	2251.9681	2251.9665	K	R	448	472
PSM	SSGSPYGGGYGSGGGSGGYGSR	3	sp|P51991|ROA3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	51		ms_run[1]:scan=1.1.8979.11	104.9256	2	1909.7792	1909.7827	R	R	355	377
PSM	SSGSPYGGGYGSGGGSGGYGSR	4	sp|P51991|ROA3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	51		ms_run[1]:scan=1.1.8960.11	104.4193	2	1909.7792	1909.7827	R	R	355	377
PSM	SSGSPYGGGYGSGGGSGGYGSR	5	sp|P51991|ROA3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	49		ms_run[1]:scan=1.1.8998.11	105.4262	2	1909.7792	1909.7827	R	R	355	377
PSM	TDNAGDQHGGGGGGGGGAGAAGGGGGGENYDDPHK	6	sp|P14866|HNRPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	48		ms_run[1]:scan=1.1.7101.11	55.29805	4	2980.2013	2980.1953	K	T	63	98
PSM	SLAGSSGPGASSGTSGDHGELVVR	7	sp|P29692-2|EF1D_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	48		ms_run[1]:scan=1.1.9516.10	119.1802	3	2184.0337	2184.0407	K	I	426	450
PSM	GAEAANVTGPGGVPVQGSK	8	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	46		ms_run[1]:scan=1.1.8931.11	103.6442	2	1694.8554	1694.8588	K	Y	119	138
PSM	ATCAPQHGAPGPGPADASK	9	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	45	3-UNIMOD:4	ms_run[1]:scan=1.1.7058.9	54.13818	3	1788.8260	1788.8213	K	V	2533	2552
PSM	AAEAAAAPAESAAPAAGEEPSKEEGEPK	10	sp|P80723|BASP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	45		ms_run[1]:scan=1.1.8518.11	92.67677	3	2635.2202	2635.2248	K	K	122	150
PSM	SLAGSSGPGASSGTSGDHGELVVR	11	sp|P29692|EF1D_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	45		ms_run[1]:scan=1.1.9504.7	118.8527	4	2183.042894	2184.040703	K	I	60	84
PSM	SGEENPASKPTPVQDVQGDGR	12	sp|Q15102|PA1B3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	45	1-UNIMOD:1	ms_run[1]:scan=1.1.9314.11	113.7879	3	2209.0181	2209.0242	M	W	2	23
PSM	PAASITSKPATLTTTSATSK	13	sp|O43670-2|ZN207_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	44		ms_run[1]:scan=1.1.8796.10	100.1032	3	1933.0333	1933.0368	K	L	328	348
PSM	AGNEKEEGETADTVGCCSLR	14	sp|P11387|TOP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	44	16-UNIMOD:4,17-UNIMOD:4	ms_run[1]:scan=1.1.8644.11	96.01338	3	2181.9232	2181.9267	R	V	489	509
PSM	TDNAGDQHGGGGGGGGGAGAAGGGGGGENYDDPHK	15	sp|P14866|HNRPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	43		ms_run[1]:scan=1.1.7120.11	55.81728	4	2980.2013	2980.1953	K	T	63	98
PSM	GEAAAERPGEAAVASSPSK	16	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	43		ms_run[1]:scan=1.1.7405.10	63.37338	3	1783.8718	1783.8700	K	A	12	31
PSM	PAETPVATSPTATDSTSGDSSR	17	sp|P54727|RD23B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	43		ms_run[1]:scan=1.1.8039.11	80.11057	3	2133.9685	2133.9662	K	S	152	174
PSM	PAEKPAETPVATSPTATDSTSGDSSR	18	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	43		ms_run[1]:scan=1.1.7911.11	76.75008	3	2559.1945	2559.1936	K	S	148	174
PSM	TTHFVEGGDAGNREDQINR	19	sp|P18124|RL7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	43		ms_run[1]:scan=1.1.8262.8	85.87646	4	2114.9729	2114.9730	K	L	224	243
PSM	GPGASGEQPEPGEAAAGGAAEEAR	20	sp|Q9H3P7|GCP60_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	43		ms_run[1]:scan=1.1.8817.10	100.67	3	2164.9573	2164.9621	R	R	50	74
PSM	KQPPVSPGTALVGSQK	21	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	43		ms_run[1]:scan=1.1.8811.10	100.5078	3	1592.8891	1592.8886	R	E	31	47
PSM	AAEAAAAPAESAAPAAGEEPSKEEGEPK	22	sp|P80723|BASP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	43		ms_run[1]:scan=1.1.8537.11	93.17963	3	2635.2202	2635.2248	K	K	122	150
PSM	FGIVTSSAGTGTTEDTEAKK	23	sp|P82979|SARNP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	43		ms_run[1]:scan=1.1.9536.8	119.7128	3	1998.9697	1998.9746	R	R	181	201
PSM	IVAERPGTNSTGPAPMAPPR	24	sp|Q13263-2|TIF1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	43		ms_run[1]:scan=1.1.9341.10	114.4951	3	2018.0320	2018.0367	K	A	326	346
PSM	NQGGYGGSSSSSSYGSGR	25	sp|P09651-2|ROA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	42		ms_run[1]:scan=1.1.7320.11	61.1075	2	1693.6930	1693.6928	R	R	301	319
PSM	GGSGGSYGGGGSGGGYGGGSGSR	26	sp|P35527|K1C9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	42		ms_run[1]:scan=1.1.7211.11	58.29393	2	1790.7212	1790.7205	R	G	491	514
PSM	VSQGSKDPAEGDGAQPEETPR	27	sp|Q14697|GANAB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	42		ms_run[1]:scan=1.1.7289.4	60.31382	3	2153.9815	2153.9825	R	D	186	207
PSM	GEAAAERPGEAAVASSPSK	28	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	42		ms_run[1]:scan=1.1.7424.10	63.88813	3	1783.8718	1783.8700	K	A	12	31
PSM	GEGAGQPSTSAQGQPAAPAPQK	29	sp|P52926|HMGA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	42		ms_run[1]:scan=1.1.7376.11	62.59143	3	2033.9803	2033.9766	R	R	5	27
PSM	GAEAANVTGPGGVPVQGSK	30	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	42		ms_run[1]:scan=1.1.8931.9	103.6408	3	1694.8567	1694.8588	K	Y	119	138
PSM	SLAGSSGPGASSGTSGDHGELVVR	31	sp|P29692-2|EF1D_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	42		ms_run[1]:scan=1.1.9497.10	118.6702	3	2184.0337	2184.0407	K	I	426	450
PSM	LSVEESEAAGDGVDTK	32	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	42		ms_run[1]:scan=1.1.9491.11	118.5104	2	1605.7336	1605.7370	K	V	427	443
PSM	GGGGGQDNGLEGLGNDSR	33	sp|P08621|RU17_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	42		ms_run[1]:scan=1.1.9387.11	115.7208	2	1658.7184	1658.7245	R	D	394	412
PSM	EELQANGSAPAADKEEPAAAGSGAASPSAAEK	34	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	42		ms_run[1]:scan=1.1.9110.11	108.3881	3	2982.363371	2981.385017	K	G	56	88
PSM	AAEAAAAPAESAAPAAGEEPSKEEGEPK	35	sp|P80723|BASP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	42		ms_run[1]:scan=1.1.8549.10	93.50076	4	2636.226094	2635.224934	K	K	122	150
PSM	NQGGYGGSSSSSSYGSGR	36	sp|P09651-2|ROA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	41		ms_run[1]:scan=1.1.7300.7	60.59258	2	1693.6930	1693.6928	R	R	301	319
PSM	TDNAGDQHGGGGGGGGGAGAAGGGGGGENYDDPHK	37	sp|P14866|HNRPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	41		ms_run[1]:scan=1.1.7106.11	55.4345	5	2980.2016	2980.1953	K	T	63	98
PSM	SEGEGEAASADDGSLNTSGAGPK	38	sp|Q9NWV8|BABA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	41		ms_run[1]:scan=1.1.8466.11	91.30313	3	2105.8978	2105.8985	R	S	49	72
PSM	LRGDAAAGPGPGAGAGAAAEPEPR	39	sp|Q6DKJ4|NXN_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	41		ms_run[1]:scan=1.1.8297.10	86.80932	3	2115.0226	2115.0457	R	R	60	84
PSM	KQPPVSPGTALVGSQK	40	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	41		ms_run[1]:scan=1.1.8739.9	98.56519	3	1592.8894	1592.8886	R	E	31	47
PSM	KQPPVSPGTALVGSQK	41	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	41		ms_run[1]:scan=1.1.8792.9	99.99437	3	1592.8876	1592.8886	R	E	31	47
PSM	EDLPAENGETKTEESPASDEAGEK	42	sp|P05114|HMGN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	41		ms_run[1]:scan=1.1.8562.11	93.8527	3	2532.0940	2532.0987	K	E	72	96
PSM	KQPPVSPGTALVGSQK	43	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	41		ms_run[1]:scan=1.1.8869.8	102.0376	3	1592.8867	1592.8886	R	E	31	47
PSM	SADGSAPAGEGEGVTLQR	44	sp|Q01650|LAT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	41		ms_run[1]:scan=1.1.9012.9	105.7954	3	1700.7934	1700.7966	K	N	31	49
PSM	SGGNSYGSGGASYNPGSHGGYGGGSGGGSSYQGK	45	sp|Q12906-7|ILF3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	41		ms_run[1]:scan=1.1.9182.11	110.2888	3	3011.2216	3011.2303	R	Q	820	854
PSM	GHAAFTSDPKPTIEVSGK	46	sp|P00390-3|GSHR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	41		ms_run[1]:scan=1.1.9374.5	115.3603	4	1840.9341	1840.9319	R	K	172	190
PSM	FGIVTSSAGTGTTEDTEAKK	47	sp|P82979|SARNP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	41		ms_run[1]:scan=1.1.9517.9	119.2054	3	1998.9697	1998.9746	R	R	181	201
PSM	SGGNSYGSGGASYNPGSHGGYGGGSGGGSSYQGK	48	sp|Q12906-7|ILF3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	41		ms_run[1]:scan=1.1.9207.11	110.9482	3	3011.2210	3011.2303	R	Q	820	854
PSM	RVQDLSAGGQGSLTDSGPER	49	sp|P40222|TXLNA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	41		ms_run[1]:scan=1.1.9437.9	117.0515	3	2028.9802	2028.9825	K	R	484	504
PSM	KQPPVSPGTALVGSQK	50	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	41		ms_run[1]:scan=1.1.8754.11	98.97353	2	1593.886447	1592.888606	R	E	31	47
PSM	KQPPVSPGTALVGSQK	51	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	40		ms_run[1]:scan=1.1.8830.10	101.0176	3	1592.8885	1592.8886	R	E	31	47
PSM	KQPPVSPGTALVGSQK	52	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	40		ms_run[1]:scan=1.1.8735.11	98.46048	2	1592.8846	1592.8886	R	E	31	47
PSM	KQPPVSPGTALVGSQK	53	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	40		ms_run[1]:scan=1.1.8850.9	101.5364	3	1592.8882	1592.8886	R	E	31	47
PSM	YGDGGSTFQSTTGHCVHMR	54	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	40	15-UNIMOD:4	ms_run[1]:scan=1.1.9368.9	115.2062	4	2096.8765	2096.8793	R	G	276	295
PSM	IKGEHPGLSIGDVAK	55	sp|P09429|HMGB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	40		ms_run[1]:scan=1.1.9508.11	118.9669	2	1519.8306	1519.8358	K	K	113	128
PSM	VVQVSAGDSHTAALTDDGR	56	sp|P18754-2|RCC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	40		ms_run[1]:scan=1.1.9290.11	113.1421	3	1897.9081	1897.9130	K	V	152	171
PSM	KCEAEEAEPPAATQPQTSETQTSHLPESER	57	sp|Q9UKV3-5|ACINU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	40	2-UNIMOD:4	ms_run[1]:scan=1.1.9391.10	115.8269	4	3337.4901	3337.5004	K	I	732	762
PSM	NQGGYGGSSSSSSYGSGR	58	sp|P09651-2|ROA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39		ms_run[1]:scan=1.1.7280.11	60.08318	2	1693.6930	1693.6928	R	R	301	319
PSM	APVQPQQSPAAAPGGTDEKPSGK	59	sp|Q13200|PSMD2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39		ms_run[1]:scan=1.1.7491.11	65.69778	3	2217.1021	2217.1026	K	E	9	32
PSM	HGTCAAQVDALNSQK	60	sp|O00584|RNT2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39	4-UNIMOD:4	ms_run[1]:scan=1.1.7727.11	72.00978	2	1598.7384	1598.7471	K	K	118	133
PSM	PSETPQAEVGPTGCPHR	61	sp|P0DN79|CBSL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39	14-UNIMOD:4	ms_run[1]:scan=1.1.7863.11	75.49695	3	1818.8326	1818.8319	M	S	2	19
PSM	AADPPAENSSAPEAEQGGAE	62	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39		ms_run[1]:scan=1.1.7786.11	73.5057	2	1896.7972	1896.7973	K	-	305	325
PSM	PAEKPAETPVATSPTATDSTSGDSSR	63	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39		ms_run[1]:scan=1.1.7931.11	77.2765	3	2559.1945	2559.1936	K	S	148	174
PSM	SREDAGDNDDTEGAIGVR	64	sp|Q9H0S4-2|DDX47_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39		ms_run[1]:scan=1.1.8174.11	83.63285	3	1875.8182	1875.8195	R	N	375	393
PSM	TGVHHYSGNNIELGTACGK	65	sp|P62888|RL30_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39	17-UNIMOD:4	ms_run[1]:scan=1.1.8610.8	95.09465	4	2013.9301	2013.9327	K	Y	69	88
PSM	KQPPVSPGTALVGSQK	66	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39		ms_run[1]:scan=1.1.8758.10	99.08017	3	1592.8894	1592.8886	R	E	31	47
PSM	GGGGPGGGGPGGGSAGGPSQPPGGGGPGIR	67	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39		ms_run[1]:scan=1.1.8692.11	97.304	3	2269.0540	2269.0585	R	K	41	71
PSM	KQPPVSPGTALVGSQK	68	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39		ms_run[1]:scan=1.1.8932.8	103.6657	3	1592.8873	1592.8886	R	E	31	47
PSM	HHLQPENPGPGGAAPSLEQNR	69	sp|Q14684|RRP1B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39		ms_run[1]:scan=1.1.8880.10	102.3252	4	2205.0661	2205.0675	K	G	407	428
PSM	EELQANGSAPAADKEEPAAAGSGAASPSAAEK	70	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39		ms_run[1]:scan=1.1.8874.11	102.1724	4	2981.3781	2981.3849	K	G	56	88
PSM	GAEAANVTGPGGVPVQGSK	71	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39		ms_run[1]:scan=1.1.8911.11	103.1221	2	1694.8554	1694.8588	K	Y	119	138
PSM	LPNQTHPDVPVGDESQAR	72	sp|Q9NP81|SYSM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39		ms_run[1]:scan=1.1.9133.4	108.9826	3	1958.9374	1958.9446	K	V	170	188
PSM	IKGEHPGLSIGDVAK	73	sp|P09429|HMGB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39		ms_run[1]:scan=1.1.9527.7	119.471	3	1519.8331	1519.8358	K	K	113	128
PSM	IGSCTQQDVELHVQK	74	sp|P14868|SYDC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39	4-UNIMOD:4	ms_run[1]:scan=1.1.9276.8	112.7662	3	1740.8443	1740.8465	K	I	127	142
PSM	MREDYDSVEQDGDEPGPQR	75	sp|Q9Y5S9|RBM8A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39		ms_run[1]:scan=1.1.9347.11	114.6532	3	2221.9126	2221.9182	R	S	50	69
PSM	SGEENPASKPTPVQDVQGDGR	76	sp|Q15102|PA1B3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	39	1-UNIMOD:1	ms_run[1]:scan=1.1.9295.11	113.2766	3	2209.0181	2209.0242	M	W	2	23
PSM	QHGEQLGGGGSGGGGYNNSK	77	sp|Q14671-2|PUM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38		ms_run[1]:scan=1.1.7059.10	54.16725	3	1859.8174	1859.8147	R	H	88	108
PSM	HPSKPDPSGECNPDLR	78	sp|Q09028-2|RBBP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38	11-UNIMOD:4	ms_run[1]:scan=1.1.7349.9	61.86514	3	1804.8196	1804.8162	K	L	156	172
PSM	SEENEEPMETDQNAKEEEK	79	sp|P34932|HSP74_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38		ms_run[1]:scan=1.1.7507.11	66.11957	3	2264.9212	2264.9226	K	M	503	522
PSM	HSGPNSADSANDGFVR	80	sp|P52597|HNRPF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38		ms_run[1]:scan=1.1.7827.5	74.56863	3	1629.7141	1629.7132	K	L	99	115
PSM	GTSFDAAATSGGSASSEK	81	sp|P13804|ETFA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38		ms_run[1]:scan=1.1.8023.11	79.6811	2	1629.7136	1629.7118	R	A	170	188
PSM	GGGGGGYGSGGSSYGSGGGSYGSGGGGGGGR	82	sp|P04264|K2C1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38		ms_run[1]:scan=1.1.8216.8	84.71167	2	2382.9494	2382.9447	R	G	519	550
PSM	EGATVYATGTHAQVEDGR	83	sp|P32322-3|P5CR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38		ms_run[1]:scan=1.1.8436.10	90.49516	3	1860.8563	1860.8602	R	L	157	175
PSM	EQSICAAEEQPAEDGQGETNK	84	sp|Q9UGP8|SEC63_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38	5-UNIMOD:4	ms_run[1]:scan=1.1.8654.11	96.28207	3	2289.9604	2289.9655	K	N	486	507
PSM	QLQQAQAAGAEQEVEK	85	sp|P39748|FEN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38		ms_run[1]:scan=1.1.8702.11	97.574	2	1726.8446	1726.8486	K	F	110	126
PSM	SCSGVEFSTSGSSNTDTGK	86	sp|P45880-1|VDAC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38	2-UNIMOD:4	ms_run[1]:scan=1.1.8649.11	96.14796	2	1906.7794	1906.7851	K	V	61	80
PSM	SQSSIVPEEEQAANKGEEK	87	sp|Q969G3-2|SMCE1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38		ms_run[1]:scan=1.1.8656.10	96.334	3	2058.9670	2058.9705	R	K	314	333
PSM	SSGSPYGGGYGSGGGSGGYGSR	88	sp|P51991|ROA3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38		ms_run[1]:scan=1.1.8941.11	103.9104	2	1909.7792	1909.7827	R	R	355	377
PSM	VNLEESSGVENSPAGARPK	89	sp|Q8WVM8|SCFD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38		ms_run[1]:scan=1.1.9112.11	108.4398	3	1939.9507	1939.9599	R	R	292	311
PSM	SLAGSSGPGASSGTSGDHGELVVR	90	sp|P29692-2|EF1D_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38		ms_run[1]:scan=1.1.9518.11	119.2357	4	2184.0421	2184.0407	K	I	426	450
PSM	NSSYVHGGLDSNGKPADAVYGQK	91	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38		ms_run[1]:scan=1.1.9531.10	119.5836	4	2363.1097	2363.1142	K	E	37	60
PSM	PGNQNTQVTEAWNK	92	sp|Q9UQ80|PA2G4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38		ms_run[1]:scan=1.1.9373.11	115.3435	2	1585.7456	1585.7485	K	V	159	173
PSM	VPEPNENVGDAVQTK	93	sp|Q7Z3K3-2|POGZ_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38		ms_run[1]:scan=1.1.9245.11	111.9623	2	1595.7704	1595.7791	K	L	397	412
PSM	NDIASHPPVEGSYAPR	94	sp|Q7KZF4|SND1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38		ms_run[1]:scan=1.1.9469.7	117.9117	3	1708.8121	1708.8169	R	R	716	732
PSM	SEEAHAEDSVMDHHFR	95	sp|Q8NC51-3|PAIRB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38		ms_run[1]:scan=1.1.9444.10	117.2421	3	1895.7811	1895.7857	K	K	315	331
PSM	QVQQHQGNLDASGPAR	96	sp|Q96SQ9|CP2S1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	38	1-UNIMOD:28	ms_run[1]:scan=1.1.8128.5	82.45103	2	1687.8043	1687.8021	R	D	251	267
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEK	97	sp|P06748|NPM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37		ms_run[1]:scan=1.1.5545.2	29.99298	3	3722.2072	3722.1951	K	A	158	190
PSM	NQGGYGGSSSSSSYGSGR	98	sp|P09651-2|ROA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37		ms_run[1]:scan=1.1.7282.11	60.13525	3	1693.6939	1693.6928	R	R	301	319
PSM	AEGDSAGTAGTPGGTPAGDK	99	sp|Q92925-2|SMRD2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37		ms_run[1]:scan=1.1.7049.11	53.89612	2	1715.7632	1715.7599	K	V	186	206
PSM	TDNAGDQHGGGGGGGGGAGAAGGGGGGENYDDPHK	100	sp|P14866|HNRPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37		ms_run[1]:scan=1.1.7082.11	54.79705	4	2980.2013	2980.1953	K	T	63	98
PSM	STSSHGTDEMESSSYR	101	sp|Q8IWS0-3|PHF6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37		ms_run[1]:scan=1.1.7501.9	65.9581	3	1759.6978	1759.6955	R	D	180	196
PSM	LINDCHGSVSEASSEQK	102	sp|P50851|LRBA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37	5-UNIMOD:4	ms_run[1]:scan=1.1.7573.11	67.89177	3	1859.8321	1859.8319	K	I	1224	1241
PSM	TPSPKEEDEEPESPPEK	103	sp|Q9H1E3-2|NUCKS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37		ms_run[1]:scan=1.1.7444.9	64.42758	3	1923.8596	1923.8585	K	K	162	179
PSM	VDCTAHSDVCSAQGVR	104	sp|Q8NBS9|TXND5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37	3-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.7531.11	66.76154	3	1760.7574	1760.7570	K	G	119	135
PSM	APEQEQAAPGPAAGGEAPK	105	sp|P80723|BASP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37		ms_run[1]:scan=1.1.7530.11	66.7347	2	1774.8506	1774.8486	K	A	103	122
PSM	AAEEAPEEAPEDAAR	106	sp|Q9H9Z2|LN28A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37		ms_run[1]:scan=1.1.7858.10	75.36508	2	1554.6808	1554.6797	K	A	16	31
PSM	GGGGPGGGGPGGGSAGGPSQPPGGGGPGIRK	107	sp|Q92945|FUBP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37		ms_run[1]:scan=1.1.7847.11	75.08199	3	2397.1585	2397.1535	R	D	41	72
PSM	DPSASPGDAGEQAIR	108	sp|P18206|VINC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37		ms_run[1]:scan=1.1.8455.11	91.00694	2	1469.6716	1469.6746	R	Q	286	301
PSM	AVTEQGAELSNEER	109	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37		ms_run[1]:scan=1.1.8264.11	85.93307	2	1531.7098	1531.7114	K	N	28	42
PSM	GEPAAAAAPEAGASPVEK	110	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37		ms_run[1]:scan=1.1.8393.11	89.36864	2	1621.7906	1621.7947	K	E	88	106
PSM	GEPAAAAAPEAGASPVEK	111	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37		ms_run[1]:scan=1.1.8355.11	88.3518	2	1621.7906	1621.7947	K	E	88	106
PSM	GEPAAAAAPEAGASPVEK	112	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37		ms_run[1]:scan=1.1.8374.11	88.8607	2	1621.7906	1621.7947	K	E	88	106
PSM	AASAAGAAGSAGGSSGAAGAAGGGAGAGTRPGDGGTASAGAAGPGAATK	113	sp|Q9UKY7-2|CDV3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37		ms_run[1]:scan=1.1.8316.11	87.3174	4	3668.7069	3668.7123	R	A	28	77
PSM	TGVHHYSGNNIELGTACGK	114	sp|P62888|RL30_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37	17-UNIMOD:4	ms_run[1]:scan=1.1.8630.7	95.63013	4	2013.9301	2013.9327	K	Y	69	88
PSM	AAEAAAAPAESAAPAAGEEPSKEEGEPK	115	sp|P80723|BASP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37		ms_run[1]:scan=1.1.8528.11	92.93961	4	2635.2225	2635.2248	K	K	122	150
PSM	IKADPDGPEAQAEACSGER	116	sp|Q9NX24|NHP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37	15-UNIMOD:4	ms_run[1]:scan=1.1.8668.9	96.65338	3	1999.8916	1999.8905	K	T	4	23
PSM	KQPPVSPGTALVGSQK	117	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37		ms_run[1]:scan=1.1.8773.11	99.48645	2	1592.8840	1592.8886	R	E	31	47
PSM	GAEAANVTGPGGVPVQGSK	118	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37		ms_run[1]:scan=1.1.8950.10	104.1497	3	1694.8567	1694.8588	K	Y	119	138
PSM	CTGGEVGATSALAPK	119	sp|P30050-2|RL12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37	1-UNIMOD:4	ms_run[1]:scan=1.1.8960.10	104.4176	2	1417.6842	1417.6871	R	I	17	32
PSM	HLCQQLQAEQAAAEK	120	sp|Q14980-2|NUMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37	3-UNIMOD:4	ms_run[1]:scan=1.1.9061.11	107.1085	2	1723.8272	1723.8311	K	R	1365	1380
PSM	YGDGGSTFQSTTGHCVHMR	121	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37	15-UNIMOD:4	ms_run[1]:scan=1.1.9387.7	115.7141	4	2096.8765	2096.8793	R	G	276	295
PSM	KTTTLSGTAPAAGVVPSR	122	sp|P27816-6|MAP4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37		ms_run[1]:scan=1.1.9276.7	112.7645	3	1712.9389	1712.9421	K	V	871	889
PSM	AAAQLLQSQAQQSGAQQTK	123	sp|Q9NVA2-2|SEP11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37		ms_run[1]:scan=1.1.9244.11	111.9357	3	1955.9968	1956.0024	K	K	410	429
PSM	TSPADHGGSVGSESGGSAVDSVAGEHSVSGR	124	sp|Q5T4S7-2|UBR4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37		ms_run[1]:scan=1.1.9336.10	114.3641	4	2839.2513	2839.2605	R	S	2884	2915
PSM	LSVEESEAAGDGVDTK	125	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37		ms_run[1]:scan=1.1.9510.11	119.0204	2	1605.7336	1605.7370	K	V	427	443
PSM	GGSDDSSKDPIDVNYEK	126	sp|P09874|PARP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37		ms_run[1]:scan=1.1.9504.10	118.8577	3	1824.7969	1824.8014	R	L	780	797
PSM	ATQQQHDFTLTQTADGR	127	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37		ms_run[1]:scan=1.1.9454.9	117.5106	3	1916.8933	1916.8977	R	S	2637	2654
PSM	VDCTQHYELCSGNQVR	128	sp|Q8NBS9|TXND5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37	3-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.9264.10	112.4561	3	1964.8387	1964.8469	K	G	245	261
PSM	AGAAGGPEEEAEKPVK	129	sp|Q8WW12|PCNP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36		ms_run[1]:scan=1.1.7308.9	60.79519	2	1538.7564	1538.7576	R	T	17	33
PSM	HADHSSLTLGSGSSTTR	130	sp|Q7Z6Z7-2|HUWE1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36		ms_run[1]:scan=1.1.7502.10	65.98652	3	1712.8090	1712.8078	R	L	2522	2539
PSM	HPAKPDPSGECNPDLR	131	sp|Q16576-2|RBBP7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36	11-UNIMOD:4	ms_run[1]:scan=1.1.7367.10	62.34983	3	1788.8257	1788.8213	K	L	200	216
PSM	GEGAGQPSTSAQGQPAAPAPQK	132	sp|P52926|HMGA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36		ms_run[1]:scan=1.1.7357.11	62.08427	3	2033.9803	2033.9766	R	R	5	27
PSM	AISVHSTPEGCSSACK	133	sp|Q9NZI8|IF2B1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36	11-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=1.1.7455.8	64.72337	3	1689.7480	1689.7451	K	M	243	259
PSM	AEAGEAGQATAEAECHR	134	sp|O95671-2|ASML_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36	15-UNIMOD:4	ms_run[1]:scan=1.1.7689.10	70.99422	3	1756.7437	1756.7434	K	T	244	261
PSM	GEGAGQPSTSAQGQPAAPAPQK	135	sp|P52926|HMGA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36		ms_run[1]:scan=1.1.7395.11	63.1049	3	2033.9782	2033.9766	R	R	5	27
PSM	AQELGHSQSALASAQR	136	sp|Q14980-2|NUMA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36		ms_run[1]:scan=1.1.7873.9	75.76125	3	1652.8237	1652.8230	K	E	1175	1191
PSM	GDVTAEEAAGASPAK	137	sp|P49006|MRP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36		ms_run[1]:scan=1.1.7766.11	72.98727	2	1372.6468	1372.6470	R	A	11	26
PSM	GDVTAEEAAGASPAK	138	sp|P49006|MRP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36		ms_run[1]:scan=1.1.7746.8	72.47725	2	1372.6468	1372.6470	R	A	11	26
PSM	NIIHGSDSVESAEK	139	sp|P15531-2|NDKA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36		ms_run[1]:scan=1.1.7973.6	78.37875	3	1484.7106	1484.7107	R	E	140	154
PSM	AAEEAPEEAPEDAAR	140	sp|Q9H9Z2|LN28A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36		ms_run[1]:scan=1.1.7838.8	74.85222	2	1554.6808	1554.6797	K	A	16	31
PSM	TADDSATSDYCPAPK	141	sp|Q9UBC3-2|DNM3B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36	11-UNIMOD:4	ms_run[1]:scan=1.1.7890.11	76.21115	2	1597.6576	1597.6566	R	R	363	378
PSM	HSLNSSSASTTEPDFQK	142	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36		ms_run[1]:scan=1.1.8394.10	89.39332	3	1834.8310	1834.8333	K	D	1021	1038
PSM	FGQGGAGPVGGQGPR	143	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36		ms_run[1]:scan=1.1.8248.7	85.52422	2	1340.6560	1340.6586	R	G	667	682
PSM	HTGPNSPDTANDGFVR	144	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36		ms_run[1]:scan=1.1.8385.9	89.15195	3	1683.7597	1683.7601	K	L	99	115
PSM	SCVEEPEPEPEAAEGDGDKK	145	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36	2-UNIMOD:4	ms_run[1]:scan=1.1.8233.9	85.14375	3	2171.9125	2171.9164	K	G	107	127
PSM	SCVEEPEPEPEAAEGDGDKK	146	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36	2-UNIMOD:4	ms_run[1]:scan=1.1.8213.8	84.63515	3	2171.9125	2171.9164	K	G	107	127
PSM	LGIKPESVQPHRPTTNPNTSK	147	sp|Q16527|CSRP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36		ms_run[1]:scan=1.1.8336.7	87.84396	5	2300.2266	2300.2237	R	F	88	109
PSM	SVTEQGAELSNEER	148	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36		ms_run[1]:scan=1.1.8529.11	92.9661	2	1547.7036	1547.7063	K	N	28	42
PSM	VQAAVGTSAAPVPSDNH	149	sp|P02649|APOE_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36		ms_run[1]:scan=1.1.8579.7	94.2966	2	1619.7866	1619.7904	K	-	301	318
PSM	RQAVTNPNNTFYATK	150	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36		ms_run[1]:scan=1.1.8692.8	97.299	3	1723.8652	1723.8642	K	R	107	122
PSM	EELQANGSAPAADKEEPAAAGSGAASPSAAEK	151	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36		ms_run[1]:scan=1.1.8855.11	101.6707	4	2981.3781	2981.3849	K	G	56	88
PSM	LNFSHGTHEYHAETIK	152	sp|P14618-2|KPYM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36		ms_run[1]:scan=1.1.9030.11	106.2799	3	1882.8937	1882.8962	R	N	74	90
PSM	DQSSWQNSDASQEVGGHQER	153	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36		ms_run[1]:scan=1.1.9153.11	109.5099	3	2243.9377	2243.9428	R	Q	1044	1064
PSM	EGEEPTVYSDEEEPKDESAR	154	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36		ms_run[1]:scan=1.1.9006.11	105.6387	3	2294.9626	2294.9662	K	K	121	141
PSM	VNEAAPEKPQDDSGTAGGISSTSASVNR	155	sp|Q5T4S7-2|UBR4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36		ms_run[1]:scan=1.1.8914.11	103.2	3	2744.2735	2744.2849	K	Y	3767	3795
PSM	VHTECCHGDLLECADDR	156	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36	5-UNIMOD:4,6-UNIMOD:4,13-UNIMOD:4	ms_run[1]:scan=1.1.9359.10	114.9675	3	2085.8248	2085.8303	K	A	265	282
PSM	VHTECCHGDLLECADDR	157	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36	5-UNIMOD:4,6-UNIMOD:4,13-UNIMOD:4	ms_run[1]:scan=1.1.9360.8	114.9908	3	2085.8248	2085.8303	K	A	265	282
PSM	KATDAEADVASLNR	158	sp|P09493-3|TPM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36		ms_run[1]:scan=1.1.9265.11	112.4839	2	1459.7224	1459.7267	K	R	77	91
PSM	SYCAEIAHNVSSK	159	sp|P62910|RL32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36	3-UNIMOD:4	ms_run[1]:scan=1.1.9247.11	112.0153	2	1464.6628	1464.6667	K	N	94	107
PSM	HGSYEDAVHSGALND	160	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36		ms_run[1]:scan=1.1.9294.11	113.2495	2	1570.6592	1570.6648	K	-	542	557
PSM	NDIASHPPVEGSYAPR	161	sp|Q7KZF4|SND1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36		ms_run[1]:scan=1.1.9488.8	118.4248	3	1708.8121	1708.8169	R	R	716	732
PSM	RAQGGDGVLDATGEEANSNAENPK	162	sp|Q6P158|DHX57_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36		ms_run[1]:scan=1.1.9096.11	108.0273	3	2399.0866	2399.0949	K	L	1188	1212
PSM	SASAPAAEGEGTPTQPASEK	163	sp|P35659|DEK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	36	1-UNIMOD:1	ms_run[1]:scan=1.1.8378.10	88.96658	3	1927.8792	1926.8802	M	E	2	22
PSM	EAGEGGEAEAPAAEGGK	164	sp|P29966|MARCS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35		ms_run[1]:scan=1.1.7033.11	53.45743	2	1528.6672	1528.6641	K	D	177	194
PSM	AGNASKDEIDSAVK	165	sp|P23381|SYWC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35		ms_run[1]:scan=1.1.7543.7	67.07745	3	1403.6923	1403.6892	K	M	28	42
PSM	VAEAHENIIHGSGATGK	166	sp|Q08257|QOR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35		ms_run[1]:scan=1.1.7376.10	62.58977	3	1689.8461	1689.8434	K	M	308	325
PSM	DAQDVQASQAEADQQQTR	167	sp|Q9P2E9|RRBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35		ms_run[1]:scan=1.1.7701.11	71.31765	2	1987.8826	1987.8831	R	L	971	989
PSM	KGDSNANSDVCAAALR	168	sp|Q8IZL8|PELP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35	11-UNIMOD:4	ms_run[1]:scan=1.1.8086.10	81.36697	3	1647.7633	1647.7635	R	G	512	528
PSM	NIIHGSDSVESAEK	169	sp|P15531-2|NDKA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35		ms_run[1]:scan=1.1.7954.11	77.87881	2	1484.7094	1484.7107	R	E	140	154
PSM	KEDGSEVGVGGAQVTGSNTR	170	sp|Q13618-2|CUL3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35		ms_run[1]:scan=1.1.7945.11	77.64032	3	1946.9287	1946.9294	K	K	545	565
PSM	TTHFVEGGDAGNREDQINR	171	sp|P18124|RL7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35		ms_run[1]:scan=1.1.8294.10	86.73027	4	2114.9729	2114.9730	K	L	224	243
PSM	HTGPNSPDTANDGFVR	172	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35		ms_run[1]:scan=1.1.8209.7	84.52638	3	1683.7603	1683.7601	K	L	99	115
PSM	FGQGGAGPVGGQGPR	173	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35		ms_run[1]:scan=1.1.8228.6	85.01352	2	1340.6560	1340.6586	R	G	667	682
PSM	IIAEGANGPTTPEADK	174	sp|P00367|DHE3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35		ms_run[1]:scan=1.1.8381.11	89.04842	2	1582.7810	1582.7838	K	I	400	416
PSM	HTGPNSPDTANDGFVR	175	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35		ms_run[1]:scan=1.1.8366.9	88.64272	3	1683.7597	1683.7601	K	L	99	115
PSM	ALVSGKPAESSAVAATEK	176	sp|O95182|NDUA7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35		ms_run[1]:scan=1.1.8441.8	90.62595	3	1714.9069	1714.9101	K	K	75	93
PSM	DEGEGAAGAGDHKDPSLGAGEAASK	177	sp|Q02952-2|AKA12_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35		ms_run[1]:scan=1.1.8384.11	89.12856	3	2295.9793	2296.0203	K	E	106	131
PSM	LPAAGGGAAGEPLK	178	sp|Q2Q1W2|LIN41_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35		ms_run[1]:scan=1.1.8613.10	95.1784	2	1207.6546	1207.6561	R	L	75	89
PSM	AGGAAVVITEPEHTK	179	sp|Q9P258|RCC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35		ms_run[1]:scan=1.1.8508.8	92.40835	3	1478.7742	1478.7729	K	E	78	93
PSM	RSGVAYIAAPSGSAADK	180	sp|P31939-2|PUR9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35		ms_run[1]:scan=1.1.8788.10	99.88862	3	1619.8258	1619.8267	K	V	552	569
PSM	QQLAQYQQQQSQASAPSTSR	181	sp|Q15007|FL2D_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35		ms_run[1]:scan=1.1.8553.10	93.60865	3	2234.0665	2234.0676	R	T	234	254
PSM	GGGGPGGGGPGGGSAGGPSQPPGGGGPGIR	182	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35		ms_run[1]:scan=1.1.8730.10	98.324	3	2269.0540	2269.0585	R	K	41	71
PSM	VGMVETNSQDRPVDDVK	183	sp|Q9Y3C6|PPIL1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35		ms_run[1]:scan=1.1.9113.10	108.4641	3	1887.8953	1887.8997	R	I	142	159
PSM	GGGGGGPGEGFDVAK	184	sp|Q9Y295|DRG1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35		ms_run[1]:scan=1.1.9048.10	106.7593	2	1260.5714	1260.5735	K	T	47	62
PSM	ITHQIVDRPGQQTSVIGR	185	sp|O00541-2|PESC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35		ms_run[1]:scan=1.1.8987.8	105.1301	4	2004.0849	2004.0865	R	C	368	386
PSM	YGDGGSTFQSTTGHCVHMR	186	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35	15-UNIMOD:4	ms_run[1]:scan=1.1.9349.7	114.6986	4	2096.8765	2096.8793	R	G	276	295
PSM	KLDPGSEETQTLVR	187	sp|P26641-2|EF1G_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35		ms_run[1]:scan=1.1.9525.8	119.4189	3	1571.8123	1571.8155	R	E	451	465
PSM	TDNAGDQHGGGGGGGGGAGAAGGGGGGENYDDPHKTPASPVVHIR	188	sp|P14866|HNRPL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35		ms_run[1]:scan=1.1.9419.10	116.5741	6	4037.7859	4037.7986	K	G	63	108
PSM	LASGVEGSDIPDDGK	189	sp|O95747|OXSR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35		ms_run[1]:scan=1.1.9230.10	111.5605	2	1458.6792	1458.6838	K	L	503	518
PSM	IATGHGQQGVTQVVLK	190	sp|P51610-2|HCFC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35		ms_run[1]:scan=1.1.9233.11	111.6429	3	1634.9065	1634.9104	K	G	752	768
PSM	GGSDDSSKDPIDVNYEK	191	sp|P09874|PARP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35		ms_run[1]:scan=1.1.9509.11	118.9937	2	1824.7964	1824.8014	R	L	780	797
PSM	DAQDVQASQAEADQQQTR	192	sp|Q9P2E9|RRBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35		ms_run[1]:scan=1.1.7707.10	71.47687	3	1987.8826	1987.8831	R	L	971	989
PSM	KASSEGGTAAGAGLDSLHK	193	sp|O15143|ARC1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35		ms_run[1]:scan=1.1.8175.8	83.65442	4	1755.8737	1755.8751	K	N	308	327
PSM	VDEVPDGAVKPPTNK	194	sp|O75475|PSIP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=1.1.8753.9	98.9433	3	1565.809571	1564.809687	R	L	25	40
PSM	SETAPAAPAAAPPAEK	195	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	35	1-UNIMOD:1	ms_run[1]:scan=1.1.8878.11	102.2754	2	1519.7483	1519.7513	M	A	2	18
PSM	IVAERPGTNSTGPAPMAPPR	196	sp|Q13263|TIF1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=1.1.9321.10	113.9707	3	2019.033371	2018.036744	K	A	408	428
PSM	TGVHHYSGNNIELGTACGK	197	sp|P62888|RL30_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	35	17-UNIMOD:4	ms_run[1]:scan=1.1.8649.9	96.14463	3	2014.930871	2013.932673	K	Y	69	88
PSM	PVSSAASVYAGAGGSGSR	198	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=1.1.8942.11	103.9371	2	1579.755247	1579.759048	R	I	28	46
PSM	NQGGYGGSSSSSSYGSGR	199	sp|P09651-2|ROA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.7325.9	61.23642	3	1693.6954	1693.6928	R	R	301	319
PSM	TVEAEAAHGTVTR	200	sp|O75874|IDHC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.7273.9	59.9031	2	1340.6670	1340.6684	K	H	302	315
PSM	HSEAATAQREEWK	201	sp|Q14103-3|HNRPD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.7334.8	61.46362	3	1541.7223	1541.7222	R	M	86	99
PSM	LQQQQRPEDAEDGAEGGGK	202	sp|Q08J23|NSUN2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.7088.11	54.95385	3	2011.9216	2011.9195	R	R	10	29
PSM	AISVHSTPEGCSSACK	203	sp|Q9NZI8|IF2B1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34	11-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=1.1.7436.9	64.21085	3	1689.7480	1689.7451	K	M	243	259
PSM	SASSGAEGDVSSEREP	204	sp|Q8TEA8|DTD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.7619.11	69.12997	2	1563.6650	1563.6649	R	-	194	210
PSM	TGQCECQPGITGQHCER	205	sp|P11047|LAMC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34	4-UNIMOD:4,6-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=1.1.7361.9	62.18805	3	2016.8206	2016.8201	R	C	951	968
PSM	RAAVGQESPGGLEAGNAK	206	sp|Q29RF7|PDS5A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.7718.10	71.76968	3	1710.8659	1710.8649	K	A	1298	1316
PSM	TPCNAGTFSQPEK	207	sp|O43684-2|BUB3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34	3-UNIMOD:4	ms_run[1]:scan=1.1.7991.7	78.85055	2	1435.6398	1435.6402	R	V	127	140
PSM	GTQGATAGASSELDASK	208	sp|O76094|SRP72_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.7788.11	73.557	2	1549.7234	1549.7220	K	T	601	618
PSM	SSGGREDLESSGLQR	209	sp|Q9UK76-2|JUPI1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.8042.9	80.18808	3	1576.7473	1576.7441	K	R	70	85
PSM	RLQGQLEQGDDTAAER	210	sp|Q8NE71-2|ABCF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.7866.11	75.57726	3	1785.8590	1785.8605	R	L	358	374
PSM	SSTATHPPGPAVQLNK	211	sp|Q14684|RRP1B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.8300.8	86.88602	3	1603.8304	1603.8318	K	T	661	677
PSM	HSLNSSSASTTEPDFQK	212	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.8375.9	88.88433	3	1834.8310	1834.8333	K	D	1021	1038
PSM	KNSVVEASEAAYK	213	sp|Q04917|1433F_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.8445.11	90.7386	2	1394.7026	1394.7041	K	E	143	156
PSM	GHAGSVDSIAVDGSGTK	214	sp|Q9GZL7|WDR12_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.8146.11	82.91015	2	1556.7422	1556.7431	R	F	187	204
PSM	LIQSHPESAEDLQEK	215	sp|Q13813|SPTN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.8459.10	91.113	3	1722.8404	1722.8424	R	C	1299	1314
PSM	TATDEAYKDPSNLQGK	216	sp|Q13813|SPTN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.8327.9	87.60747	3	1736.8189	1736.8217	K	V	595	611
PSM	TEDGGEFEEGASENNAK	217	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.8149.11	82.98695	2	1782.7194	1782.7180	K	E	434	451
PSM	LREDENAEPVGTTYQK	218	sp|Q16643-2|DREB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.8144.11	82.85912	2	1848.8860	1848.8853	R	T	152	168
PSM	KQPPVSPGTALVGSQK	219	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.8812.5	100.5266	4	1592.8889	1592.8886	R	E	31	47
PSM	KPPLLNNADSVQAK	220	sp|P09874|PARP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.8573.7	94.13613	3	1493.8174	1493.8202	K	V	748	762
PSM	VDEVPDGAVKPPTNK	221	sp|O75475|PSIP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.8715.7	97.91541	3	1564.8082	1564.8097	R	L	25	40
PSM	THYSNIEANESEEVR	222	sp|P04632|CPNS1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.8551.10	93.55466	3	1776.7906	1776.7914	R	Q	85	100
PSM	RPVHGESDTEQLQDDDIETTK	223	sp|Q9BW27-3|NUP85_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.8798.10	100.157	4	2412.0993	2412.1041	R	V	565	586
PSM	IGQQPQQPGAPPQQDYTK	224	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.8734.11	98.43346	3	1979.9638	1979.9701	K	A	629	647
PSM	SSQSSSQQFSGIGR	225	sp|Q92841-3|DDX17_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.8742.11	98.64945	2	1454.6720	1454.6750	R	S	594	608
PSM	KQPPVSPGTALVGSQK	226	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.8716.11	97.94865	2	1592.8846	1592.8886	R	E	31	47
PSM	VDDSSEDKTEFTVK	227	sp|P49588|SYAC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.8747.9	98.78118	2	1598.7266	1598.7312	K	N	551	565
PSM	SYLSGGAGAAGGGGADPGNK	228	sp|P25490|TYY1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.8510.11	92.46627	2	1662.7566	1662.7598	K	K	184	204
PSM	LNFSHGTHEYHAETIK	229	sp|P14618-2|KPYM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.9108.6	108.3281	4	1882.8933	1882.8962	R	N	74	90
PSM	RPELLTHSTTEVTQPR	230	sp|P78347-2|GTF2I_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.9074.10	107.4507	3	1863.9781	1863.9803	K	T	499	515
PSM	CTGGEVGATSALAPK	231	sp|P30050-2|RL12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34	1-UNIMOD:4	ms_run[1]:scan=1.1.8979.10	104.9239	2	1417.6842	1417.6871	R	I	17	32
PSM	AQAELVGTADEATR	232	sp|P30049|ATPD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.9099.9	108.1045	2	1430.6954	1430.7001	K	A	137	151
PSM	RPAEDMEEEQAFK	233	sp|P61978-2|HNRPK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.9144.8	109.2633	3	1578.6973	1578.6984	K	R	22	35
PSM	KQPPVSPGTALVGSQK	234	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.8970.7	104.6811	3	1592.8840	1592.8886	R	E	31	47
PSM	EGEEPTVYSDEEEPKDESAR	235	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.8987.11	105.1351	3	2294.9626	2294.9662	K	K	121	141
PSM	DVACGANHTLVLDSQKR	236	sp|Q9P258|RCC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34	4-UNIMOD:4	ms_run[1]:scan=1.1.9222.5	111.3372	4	1882.9301	1882.9319	R	V	334	351
PSM	LSVEESEAAGDGVDTK	237	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.9479.10	118.1863	3	1605.7342	1605.7370	K	V	427	443
PSM	ASGNYATVISHNPETK	238	sp|P62917|RL8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.9225.10	111.4262	3	1687.8121	1687.8165	R	K	129	145
PSM	LASGVEGSDIPDDGK	239	sp|O95747|OXSR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.9211.11	111.0537	2	1458.6792	1458.6838	K	L	503	518
PSM	VVDRDSEEAEIIR	240	sp|P09874|PARP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.9371.6	115.2817	3	1529.7694	1529.7685	K	K	803	816
PSM	YGEAGEGPGWGGAHPR	241	sp|P26640|SYVC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.9259.9	112.3248	3	1596.7384	1596.7070	R	I	24	40
PSM	LSVEESEAAGDGVDTK	242	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.9472.11	117.9992	2	1605.7336	1605.7370	K	V	427	443
PSM	GHTDSVQDISFDHSGK	243	sp|P43034|LIS1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.9306.6	113.5646	3	1728.7678	1728.7704	K	L	148	164
PSM	RQAVTNPNNTFYATK	244	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.8695.10	97.38327	2	1723.8614	1723.8642	K	R	107	122
PSM	HEAFESDLAAHQDR	245	sp|O43707|ACTN4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.8760.10	99.13419	3	1624.7260	1624.7230	K	V	456	470
PSM	LNFSHGTHEYHAETIK	246	sp|P14618-2|KPYM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.9049.10	106.786	3	1882.8934	1882.8962	R	N	74	90
PSM	AEPPKAPEQEQAAPGPAAGGEAPK	247	sp|P80723|BASP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=1.1.8146.10	82.90849	3	2298.131171	2297.128790	K	A	98	122
PSM	SETAPAETATPAPVEK	248	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	34	1-UNIMOD:1	ms_run[1]:scan=1.1.9177.10	110.1541	2	1639.7886	1639.7936	M	S	2	18
PSM	AATASAGAGGIDGKPR	249	sp|Q02978|M2OM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	34	1-UNIMOD:1	ms_run[1]:scan=1.1.8178.11	83.73963	2	1440.7297	1440.7316	M	T	2	18
PSM	EDGNEEDKENQGDETQGQQPPQR	250	sp|P67809|YBOX1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.6961.11	51.58807	3	2627.1001	2627.0968	R	R	257	280
PSM	CCAAADPHECYAK	251	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33	1-UNIMOD:4,2-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.7256.4	59.46668	3	1551.5926	1551.5905	K	V	384	397
PSM	AHAAQVTCVAASPHK	252	sp|Q9BQA1|MEP50_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33	8-UNIMOD:4	ms_run[1]:scan=1.1.7050.11	53.92313	2	1546.7702	1546.7674	R	D	165	180
PSM	CCAAADPHECYAK	253	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33	1-UNIMOD:4,2-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.7236.4	58.9498	3	1551.5926	1551.5905	K	V	384	397
PSM	SEASSSPPVVTSSSHSR	254	sp|P48431|SOX2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.7170.11	57.18285	2	1700.7992	1700.7966	K	A	246	263
PSM	RSELSQDAEPAGSQETK	255	sp|Q9BVJ6-2|UT14A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.7305.6	60.71908	3	1831.8319	1831.8548	K	D	265	282
PSM	GEAAAERPGEAAVASSPSK	256	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.7410.6	63.50207	4	1783.8729	1783.8700	K	A	12	31
PSM	VLCGDAGEDAECHAAK	257	sp|O15397|IPO8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33	3-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.7580.10	68.07933	3	1701.7090	1701.7087	K	L	725	741
PSM	AQQQEEQGSVNDVKEEEK	258	sp|Q9Y4W2-2|LAS1L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.7457.11	64.78249	3	2073.9445	2073.9450	K	E	535	553
PSM	NGSLDSPGKQDTEEDEEEDEK	259	sp|Q9Y266|NUDC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.7585.11	68.21603	3	2349.9604	2349.9568	K	D	134	155
PSM	SNPSAVAGNETPGASTK	260	sp|Q9UDY2|ZO2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.7398.11	63.18552	2	1586.7562	1586.7536	K	G	1017	1034
PSM	AKPSPAPPSTTTAPDASGPQK	261	sp|P40855|PEX19_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.7506.10	66.09161	3	2005.0147	2005.0116	K	R	32	53
PSM	GHIISDGGCSCPGDVAK	262	sp|Q9P2T1-2|GMPR2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33	9-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=1.1.8043.10	80.21677	3	1728.7573	1728.7560	K	A	232	249
PSM	VAEDEAEAAAAAK	263	sp|P08195-2|4F2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.7871.9	75.70748	2	1244.5886	1244.5884	K	F	47	60
PSM	CSGIGDNPGSETAAPR	264	sp|P50851|LRBA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33	1-UNIMOD:4	ms_run[1]:scan=1.1.7982.11	78.6205	2	1587.7072	1587.6947	K	A	2675	2691
PSM	SETAPAETATPAPVEK	265	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.7987.8	78.74847	2	1597.7854	1597.7835	M	S	2	18
PSM	SSQTSGTNEQSSAIVSAR	266	sp|O60763-2|USO1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.7905.11	76.59666	2	1808.8552	1808.8500	K	D	776	794
PSM	PSETPQAEVGPTGCPHR	267	sp|P0DN79|CBSL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33	14-UNIMOD:4	ms_run[1]:scan=1.1.7882.9	76.0008	3	1818.8326	1818.8319	M	S	2	19
PSM	AADPPAENSSAPEAEQGGAE	268	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.7806.11	74.02253	3	1896.8002	1896.7973	K	-	305	325
PSM	TTHFVEGGDAGNREDQINR	269	sp|P18124|RL7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.8238.9	85.26725	4	2114.9729	2114.9730	K	L	224	243
PSM	ENSGAAEKPVTIHATPEGTSEACR	270	sp|Q9Y6M1-1|IF2B2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33	23-UNIMOD:4	ms_run[1]:scan=1.1.8355.9	88.34846	4	2511.1625	2511.1660	K	M	233	257
PSM	QHLENDPGSNEDTDIPK	271	sp|O43396|TXNL1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.8452.10	90.9246	3	1907.8486	1907.8497	K	G	105	122
PSM	QGGGGGGGSVPGIER	272	sp|P52272-2|HNRPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.8130.11	82.502	2	1283.6218	1283.6219	K	M	350	365
PSM	RDIQENDEEAVQVK	273	sp|O00231-2|PSD11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.8128.4	82.44603	3	1671.8107	1671.8064	K	E	33	47
PSM	NEEPSEEEIDAPKPK	274	sp|Q9NR30|DDX21_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.8391.9	89.31218	3	1710.7924	1710.7948	K	K	117	132
PSM	NEEPSEEEIDAPKPK	275	sp|Q9NR30|DDX21_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.8411.6	89.83121	3	1710.7927	1710.7948	K	K	117	132
PSM	AGEAPTENPAPPTQQSSAE	276	sp|P16989|YBOX3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.8234.6	85.1691	2	1880.8358	1880.8388	K	-	354	373
PSM	TGVHHYSGNNIELGTACGK	277	sp|P62888|RL30_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33	17-UNIMOD:4	ms_run[1]:scan=1.1.8650.8	96.16991	4	2013.9301	2013.9327	K	Y	69	88
PSM	KRPAPQQIQQVQQQAVQNR	278	sp|Q96GM5-2|SMRD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.8685.9	97.11179	4	2244.2169	2244.2199	R	N	101	120
PSM	TPQAFVHPSEQDGER	279	sp|Q9BV44|THUM3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.8562.8	93.8477	3	1696.7710	1696.7805	R	G	485	500
PSM	THYSNIEANESEEVR	280	sp|P04632|CPNS1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.8570.9	94.06261	3	1776.7906	1776.7914	R	Q	85	100
PSM	EAGDVCYADVQK	281	sp|Q13242|SRSF9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33	6-UNIMOD:4	ms_run[1]:scan=1.1.8687.11	97.16915	2	1353.5852	1353.5871	R	D	133	145
PSM	ADEASELACPTPK	282	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33	9-UNIMOD:4	ms_run[1]:scan=1.1.8796.11	100.1049	2	1387.6268	1387.6289	K	E	2194	2207
PSM	AGGAAVVITEPEHTK	283	sp|Q9P258|RCC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.8515.10	92.59638	2	1478.7714	1478.7729	K	E	78	93
PSM	IVIGYQSHADTATK	284	sp|P06730-3|IF4E_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.8817.11	100.6717	2	1502.7704	1502.7729	K	S	213	227
PSM	AALSASEGEEVPQDK	285	sp|O95831|AIFM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.8672.11	96.7643	2	1529.7192	1529.7209	K	A	113	128
PSM	AALSASEGEEVPQDK	286	sp|O95831|AIFM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.8652.11	96.22836	2	1529.7192	1529.7209	K	A	113	128
PSM	TPTQTNGSNVPFKPR	287	sp|P78347-2|GTF2I_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.8491.11	91.96616	3	1642.8439	1642.8427	R	G	662	677
PSM	EDLPAENGETKTEESPASDEAGEK	288	sp|P05114|HMGN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.8543.11	93.34087	3	2532.0940	2532.0987	K	E	72	96
PSM	VLQHYQESDKGEELGPGNVQK	289	sp|Q9Y6C9|MTCH2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.8968.9	104.6308	4	2354.1473	2354.1502	K	E	91	112
PSM	AVAGNISDPGLQK	290	sp|P18206|VINC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.8979.9	104.9223	2	1268.6700	1268.6725	K	S	803	816
PSM	CTGGEVGATSALAPK	291	sp|P30050-2|RL12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33	1-UNIMOD:4	ms_run[1]:scan=1.1.8998.10	105.4246	2	1417.6842	1417.6871	R	I	17	32
PSM	QVLVAPGNAGTACSEK	292	sp|P22102|PUR2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33	13-UNIMOD:4	ms_run[1]:scan=1.1.8841.10	101.3049	2	1600.7840	1600.7879	K	I	29	45
PSM	TAENATSGETLEENEAGD	293	sp|Q9UQ80|PA2G4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.9018.11	105.9586	2	1836.7456	1836.7497	K	-	377	395
PSM	LQTASDESYKDPTNIQSK	294	sp|Q13813|SPTN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.8920.11	103.3549	3	2023.9636	2023.9698	K	H	1571	1589
PSM	RQDPGDNWEEGGGGGGGMEK	295	sp|Q9UKY7-2|CDV3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.9005.11	105.6121	3	2031.8284	2031.8341	K	S	117	137
PSM	AGVRPSSSGSAWEACSEAPSK	296	sp|Q12789-3|TF3C1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33	15-UNIMOD:4	ms_run[1]:scan=1.1.9170.10	109.9657	3	2119.9546	2119.9593	R	G	839	860
PSM	NPLPPSVGVVDKK	297	sp|Q8NC51-3|PAIRB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.9484.9	118.319	3	1348.7704	1348.7715	K	E	80	93
PSM	KLDEAVAEAHLGK	298	sp|P23526|SAHH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.9250.8	112.0891	3	1379.7385	1379.7408	K	L	389	402
PSM	ALLVTASQCQQPAENK	299	sp|Q01518-2|CAP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33	9-UNIMOD:4	ms_run[1]:scan=1.1.9399.11	116.0444	3	1756.8733	1756.8778	R	L	84	100
PSM	KPLLESGTLGTK	300	sp|P22314|UBA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.9229.10	111.5336	2	1242.7144	1242.7183	R	G	593	605
PSM	VHTECCHGDLLECADDR	301	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33	5-UNIMOD:4,6-UNIMOD:4,13-UNIMOD:4	ms_run[1]:scan=1.1.9361.11	115.0225	3	2085.8248	2085.8303	K	A	265	282
PSM	VHTECCHGDLLECADDR	302	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33	5-UNIMOD:4,6-UNIMOD:4,13-UNIMOD:4	ms_run[1]:scan=1.1.9362.10	115.0474	3	2085.8248	2085.8303	K	A	265	282
PSM	ELDDATEANEGLSR	303	sp|P35580-3|MYH10_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.9274.11	112.7188	2	1518.6750	1518.6798	R	E	1927	1941
PSM	AAAGEFADDPCSSVK	304	sp|P35221-2|CTNA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33	11-UNIMOD:4	ms_run[1]:scan=1.1.9516.11	119.1819	2	1523.6532	1523.6562	K	R	106	121
PSM	VVDRDSEEAEIIR	305	sp|P09874|PARP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.9390.7	115.795	3	1529.7694	1529.7685	K	K	803	816
PSM	LSVEESEAAGDGVDTK	306	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.9529.11	119.5316	2	1605.7306	1605.7370	K	V	427	443
PSM	IQALQQQADEAEDR	307	sp|P67936|TPM4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.9378.5	115.4679	3	1613.7640	1613.7645	K	A	14	28
PSM	TYDPSGDSTLPTCSK	308	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33	13-UNIMOD:4	ms_run[1]:scan=1.1.9241.11	111.856	2	1627.6994	1627.7036	K	K	427	442
PSM	QREELGQGLQGVEQK	309	sp|Q07065|CKAP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.9463.10	117.7551	3	1697.8660	1697.8696	R	V	147	162
PSM	GGSDDSSKDPIDVNYEK	310	sp|P09874|PARP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.9490.11	118.4835	2	1824.7964	1824.8014	R	L	780	797
PSM	MREDYDSVEQDGDEPGPQR	311	sp|Q9Y5S9|RBM8A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.9327.10	114.1274	3	2221.9126	2221.9182	R	S	50	69
PSM	KPPLLNNADSVQAK	312	sp|P09874|PARP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.8564.4	93.8949	4	1493.8241	1493.8202	K	V	748	762
PSM	DLSKPEVEYDCDAPSHNSEK	313	sp|O15164-2|TIF1A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33	11-UNIMOD:4	ms_run[1]:scan=1.1.9314.7	113.7813	4	2318.9925	2318.9961	R	K	838	858
PSM	QEPERNECFLQHK	314	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	33	1-UNIMOD:28,8-UNIMOD:4	ms_run[1]:scan=1.1.9488.7	118.4231	3	1696.7611	1696.7622	K	D	118	131
PSM	SETAPAETATPAPVEK	315	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	33	1-UNIMOD:1	ms_run[1]:scan=1.1.9196.11	110.6582	2	1639.7886	1639.7936	M	S	2	18
PSM	AAADGGGPGGASVGTEEDGGGVGHR	316	sp|A6NHR9|SMHD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	33	1-UNIMOD:1	ms_run[1]:scan=1.1.9081.11	107.6376	3	2178.9482	2178.9521	M	T	2	27
PSM	SHQTGIQASEDVK	317	sp|Q12792|TWF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	33	1-UNIMOD:1	ms_run[1]:scan=1.1.7847.10	75.08031	2	1440.6862	1440.6840	M	E	2	15
PSM	DHAATTAGAASLAGGHHR	318	sp|P29083|T2EA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.7221.4	58.55228	4	1699.8201	1699.8139	K	E	219	237
PSM	DSSGQHVDVSPTSQR	319	sp|Q99798|ACON_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.7316.11	61.00003	3	1598.7310	1598.7285	K	L	550	565
PSM	SGGGGGGGGSSWGGR	320	sp|Q13151|ROA0_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.7258.8	59.51285	2	1191.5022	1191.5018	K	S	270	285
PSM	AGQSAAGAAPGGGVDTR	321	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.7179.10	57.42678	2	1441.6916	1441.6910	R	D	8	25
PSM	DPAEGDGAQPEETPR	322	sp|Q14697|GANAB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.7352.11	61.94937	2	1567.6794	1567.6750	K	D	192	207
PSM	DRDYSDHPSGGSYR	323	sp|P38159-2|RBMX_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.7243.6	59.12815	3	1610.6719	1610.6710	R	D	256	270
PSM	GTPGPPPAHGAALQPHPR	324	sp|Q15654|TRIP6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.7657.7	70.1479	4	1756.9157	1756.9121	R	V	26	44
PSM	ASAAPKPEPVPVQK	325	sp|Q96HC4|PDLI5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.7438.10	64.26687	3	1417.7902	1417.7929	R	G	84	98
PSM	KPLTSSSAAPQRPISTQR	326	sp|Q15691|MARE1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.7479.10	65.37743	4	1924.0509	1924.0490	K	T	151	169
PSM	FASDDEHDEHDENGATGPVK	327	sp|P05455|LA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.7446.9	64.48154	4	2168.8929	2168.8883	K	R	364	384
PSM	TPSPKEEDEEPESPPEK	328	sp|Q9H1E3-2|NUCKS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.7425.11	63.91678	3	1923.8596	1923.8585	K	K	162	179
PSM	VLATVTKPVGGDK	329	sp|Q02878|RL6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.7703.11	71.37112	2	1283.7454	1283.7449	K	N	88	101
PSM	AGDDEPEYEDGR	330	sp|Q9Y6K1|DNM3A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.7535.10	66.86755	2	1351.5182	1351.5164	K	G	277	289
PSM	RQLEEAEEEAQR	331	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.7653.11	70.04646	2	1486.7018	1486.7011	K	A	1877	1889
PSM	APVQPQQSPAAAPGGTDEKPSGK	332	sp|Q13200|PSMD2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.7472.11	65.18932	3	2217.1021	2217.1026	K	E	9	32
PSM	SSGGREDLESSGLQR	333	sp|Q9UK76-2|JUPI1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.8023.10	79.67944	3	1576.7473	1576.7441	K	R	70	85
PSM	HSGPNSADSANDGFVR	334	sp|P52597|HNRPF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.7807.9	74.04585	3	1629.7141	1629.7132	K	L	99	115
PSM	APKPDGPGGGPGGSHMGGNYGDDR	335	sp|P35637-2|FUS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.7849.11	75.13358	4	2251.9681	2251.9665	K	R	448	472
PSM	RCQEAQNGSESEVWTHQSK	336	sp|Q9Y2Z0-2|SGT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32	2-UNIMOD:4	ms_run[1]:scan=1.1.8051.9	80.43076	4	2259.9969	2259.9927	K	I	121	140
PSM	VTQDATPGSALDK	337	sp|Q01581|HMCS1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.7824.7	74.49527	2	1301.6462	1301.6463	K	I	388	401
PSM	AQAAAPASVPAQAPK	338	sp|P47914|RL29_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.7900.11	76.46822	2	1376.7416	1376.7412	K	R	135	150
PSM	KLDAQVQELHAK	339	sp|P35580-3|MYH10_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.8061.11	80.70296	2	1378.7578	1378.7568	K	V	1277	1289
PSM	PCSEETPAISPSK	340	sp|P33316-2|DUT_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32	2-UNIMOD:4	ms_run[1]:scan=1.1.7857.11	75.34093	2	1401.6454	1401.6446	M	R	2	15
PSM	LGDQGPPEEAEDR	341	sp|O00592-2|PODXL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.7763.11	72.91051	2	1411.6222	1411.6215	K	F	413	426
PSM	DGEQHEDLNEVAK	342	sp|O95831|AIFM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.7757.11	72.75758	2	1482.6610	1482.6586	K	L	594	607
PSM	AEAGPEGVAPAPEGEK	343	sp|Q9Y4L1|HYOU1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.8072.11	80.99512	2	1507.7170	1507.7154	K	K	670	686
PSM	EASDPQPEEADGGLK	344	sp|P52907|CAZA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.8071.10	80.967	2	1541.6866	1541.6845	K	S	104	119
PSM	TEGTQEADQYADEK	345	sp|Q02952-2|AKA12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.7929.11	77.22433	2	1583.6592	1583.6587	K	T	1163	1177
PSM	AQHVFQHAVPQEGKPITNQK	346	sp|Q13867|BLMH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.8456.8	91.02879	5	2256.1811	2256.1763	R	S	49	69
PSM	LLETTDRPDGHQNNLR	347	sp|Q14974|IMB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.8200.7	84.29708	4	1877.9369	1877.9344	K	S	510	526
PSM	RDIQENDEEAVQVK	348	sp|O00231-2|PSD11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.8107.4	81.90925	3	1671.8107	1671.8064	K	E	33	47
PSM	QHLENDPGSNEDTDIPK	349	sp|O43396|TXNL1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.8471.11	91.43812	3	1907.8486	1907.8497	K	G	105	122
PSM	QGGGGGGGSVPGIER	350	sp|P52272-2|HNRPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.8110.10	81.99084	2	1283.6218	1283.6219	K	M	350	365
PSM	SCVEEPEPEPEAAEGDGDKK	351	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32	2-UNIMOD:4	ms_run[1]:scan=1.1.8193.11	84.12548	3	2171.9125	2171.9164	K	G	107	127
PSM	HELQANCYEEVK	352	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32	7-UNIMOD:4	ms_run[1]:scan=1.1.8460.10	91.13979	2	1518.6750	1518.6773	K	D	133	145
PSM	AEPPKAPEQEQAAPGPAAGGEAPK	353	sp|P80723|BASP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.8186.10	83.94677	3	2297.1280	2297.1287	K	A	98	122
PSM	LHQLSGSDQLESTAHSR	354	sp|O60271-2|JIP4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.8552.8	93.57833	4	1864.9053	1864.9027	K	I	179	196
PSM	KPPLLNNADSVQAK	355	sp|P09874|PARP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.8554.8	93.63215	3	1493.8174	1493.8202	K	V	748	762
PSM	VSVADHSLHLSK	356	sp|Q13162|PRDX4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.8815.9	100.6143	2	1291.6860	1291.6884	R	A	67	79
PSM	SEHPGLSIGDTAK	357	sp|P26583|HMGB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.8500.7	92.19473	3	1310.6470	1310.6466	K	K	115	128
PSM	DGMDNQGGYGSVGR	358	sp|P31942-2|HNRH3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.8561.10	93.8242	2	1411.5768	1411.5787	R	M	273	287
PSM	TKQDEVNAAWQR	359	sp|Q13813|SPTN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.8582.9	94.37013	2	1444.7050	1444.7059	K	L	228	240
PSM	KPALVSTVEGGQDPK	360	sp|Q14690|RRP5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.8679.11	96.95305	2	1524.8138	1524.8148	R	N	707	722
PSM	SVTEQGAELSNEER	361	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.8548.11	93.47555	2	1547.7036	1547.7063	K	N	28	42
PSM	SGGGTGEEPGSQGLNGEAGPEDSTR	362	sp|O15355|PPM1G_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.8767.11	99.32481	3	2344.9978	2345.0004	K	E	173	198
PSM	GETVNDCHAEIISR	363	sp|P55265-2|DSRAD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32	7-UNIMOD:4	ms_run[1]:scan=1.1.8617.11	95.28755	2	1599.7274	1599.7311	K	R	877	891
PSM	GTVRPANDFNPDADAK	364	sp|P08133-2|ANXA6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.8581.7	94.34783	3	1686.7951	1686.7962	K	A	323	339
PSM	GAVAEDGDELRTEPEAK	365	sp|P27695|APEX1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.8602.10	94.88551	3	1785.8359	1785.8381	K	K	8	25
PSM	ELAQIAGRPTEDEDEK	366	sp|O15355|PPM1G_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.8776.10	99.56575	3	1799.8510	1799.8537	K	E	113	129
PSM	EENSTEEQALEDQNAK	367	sp|Q9NQZ2|SAS10_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.8618.11	95.31437	2	1833.7826	1833.7864	K	R	393	409
PSM	SCSGVEFSTSGSSNTDTGK	368	sp|P45880-1|VDAC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32	2-UNIMOD:4	ms_run[1]:scan=1.1.8668.8	96.65172	3	1906.7821	1906.7851	K	V	61	80
PSM	DTGKTPVEPEVAIHR	369	sp|P60866-2|RS20_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.9060.4	107.0701	4	1647.8605	1647.8580	K	I	5	20
PSM	GAEAANVTGPGGVPVQGSK	370	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.8935.3	103.737	4	1694.8605	1694.8588	K	Y	119	138
PSM	LNFSHGTHEYHAETIK	371	sp|P14618-2|KPYM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.9087.6	107.7866	4	1882.8977	1882.8962	R	N	74	90
PSM	TSSAQVEGGVHSLHSYEK	372	sp|P12268|IMDH2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.9155.6	109.5554	4	1914.9097	1914.9072	R	R	494	512
PSM	DHAVVVGVYRPPPK	373	sp|P22087|FBRL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.8993.9	105.2905	3	1532.8453	1532.8464	R	V	305	319
PSM	TIAQGNLSNTDVQAAK	374	sp|P22695|QCR2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.9146.9	109.3185	3	1629.8290	1629.8322	K	N	360	376
PSM	FNQTYQLAHGTAEEK	375	sp|Q14166|TTL12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.9073.10	107.4244	3	1735.8145	1735.8165	K	M	173	188
PSM	TGAEGAVLDEAK	376	sp|P33176|KINH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.8838.9	101.2246	2	1159.5716	1159.5721	K	N	241	253
PSM	VLQHYQESDKGEELGPGNVQK	377	sp|Q9Y6C9|MTCH2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.8967.10	104.6056	4	2354.1473	2354.1502	K	E	91	112
PSM	KIQVLQQQADDAEER	378	sp|P06753-2|TPM3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.9179.7	110.2027	3	1769.8855	1769.8908	R	A	13	28
PSM	MQVDQEEPHVEEQQQQTPAENK	379	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.9122.10	108.6979	4	2621.1597	2621.1664	K	A	522	544
PSM	PLSSVQENIQQK	380	sp|P52732|KIF11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.8848.10	101.4862	2	1369.7158	1369.7201	K	S	746	758
PSM	RAVAGDASESALLK	381	sp|P05023-4|AT1A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.8972.7	104.7348	3	1386.7459	1386.7467	K	C	445	459
PSM	NSHCAQTVSSVFK	382	sp|Q9H583|HEAT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32	4-UNIMOD:4	ms_run[1]:scan=1.1.8983.9	105.0273	2	1463.6786	1463.6827	K	G	1140	1153
PSM	IQFKPDDGTTPER	383	sp|Q96AE4-2|FUBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.8938.7	103.8237	3	1502.7349	1502.7365	R	I	308	321
PSM	ELRDEEQTAESIK	384	sp|Q14566|MCM6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.9060.7	107.0751	3	1546.7449	1546.7474	K	N	314	327
PSM	SSGSPYGGGYGSGGGSGGYGSR	385	sp|P51991|ROA3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.9017.11	105.932	2	1909.7756	1909.7827	R	R	355	377
PSM	SKDPNSQVGACIVNSENK	386	sp|P32321|DCTD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32	11-UNIMOD:4	ms_run[1]:scan=1.1.8856.9	101.6942	3	1945.9138	1945.9163	R	I	30	48
PSM	EEKEESDDEAAVEEEEEEK	387	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.9109.11	108.3622	3	2251.8889	2251.8975	K	K	301	320
PSM	GHAAFTSDPKPTIEVSGK	388	sp|P00390-3|GSHR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.9393.4	115.8707	4	1840.9345	1840.9319	R	K	172	190
PSM	RPISADSAIMNPASK	389	sp|Q00610-2|CLH1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.9501.9	118.7758	3	1556.7952	1556.7980	R	V	64	79
PSM	MREIVHIQAGQCGNQIGAK	390	sp|Q9BVA1|TBB2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32	1-UNIMOD:35,12-UNIMOD:4	ms_run[1]:scan=1.1.9237.6	111.7413	4	2125.0449	2125.0521	-	F	1	20
PSM	KPDAYTEQLHNEEENEDAR	391	sp|Q9P0T7|TMEM9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.9244.8	111.9307	4	2286.9977	2286.9988	R	S	118	137
PSM	IIYGGSVTGATCK	392	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32	12-UNIMOD:4	ms_run[1]:scan=1.1.9371.9	115.2867	2	1325.6612	1325.6649	R	E	244	257
PSM	VPLEVQEADEAK	393	sp|P26640|SYVC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.9493.10	118.5626	2	1326.6646	1326.6667	K	L	1231	1243
PSM	ETVAVKPTENNEEEFTSK	394	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.9362.9	115.0457	3	2050.9642	2050.9695	R	D	77	95
PSM	VHTECCHGDLLECADDR	395	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32	5-UNIMOD:4,6-UNIMOD:4,13-UNIMOD:4	ms_run[1]:scan=1.1.9355.11	114.8631	3	2085.8248	2085.8303	K	A	265	282
PSM	LAASASTQQLQEVK	396	sp|O95235|KI20A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.9371.11	115.29	2	1472.7762	1472.7834	R	A	680	694
PSM	TGTSCALDCGAGIGR	397	sp|Q9BV86-2|NTM1A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32	5-UNIMOD:4,9-UNIMOD:4	ms_run[1]:scan=1.1.9492.10	118.5356	2	1494.6502	1494.6555	K	I	60	75
PSM	QAVTNPNNTFYATK	398	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.9536.11	119.7178	2	1567.7582	1567.7631	R	R	108	122
PSM	PGNQNTQVTEAWNK	399	sp|Q9UQ80|PA2G4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.9354.11	114.8368	2	1585.7456	1585.7485	K	V	159	173
PSM	HQAFEAELSANQSR	400	sp|Q13813|SPTN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.9442.11	117.1896	2	1586.7392	1586.7437	K	I	614	628
PSM	TPAQSGAWDPNNPNTPSR	401	sp|O00267-2|SPT5H_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.9345.11	114.6011	2	1908.8624	1908.8714	R	A	810	828
PSM	AETEEAEEPEEDGEEHVCVSASK	402	sp|P46821|MAP1B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32	18-UNIMOD:4	ms_run[1]:scan=1.1.9323.11	114.0245	3	2560.0297	2560.0395	K	H	946	969
PSM	QGSKDPAEGDGAQPEETPR	403	sp|Q14697-2|GANAB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.7167.11	57.10132	3	1967.8867	1967.8821	R	D	210	229
PSM	NDIASHPPVEGSYAPR	404	sp|Q7KZF4|SND1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.9507.9	118.9366	3	1708.8121	1708.8169	R	R	716	732
PSM	GSGSRPGIEGDTPR	405	sp|Q14195-2|DPYL3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.7309.7	60.81385	3	1384.6699	1384.6695	R	R	74	88
PSM	RSGVAYIAAPSGSAADK	406	sp|P31939-2|PUR9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.8769.10	99.37704	3	1619.8258	1619.8267	K	V	552	569
PSM	QEPERNECFLQHK	407	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	32	1-UNIMOD:28,8-UNIMOD:4	ms_run[1]:scan=1.1.9507.8	118.9349	3	1696.7608	1696.7622	K	D	118	131
PSM	CCAAADPHECYAK	408	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	32	1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.8678.11	96.92623	2	1535.5612	1534.5632	K	V	384	397
PSM	CCAAADPHECYAK	409	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	32	1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.8659.11	96.41605	2	1534.5623	1534.5634	K	V	384	397
PSM	CCAAADPHECYAK	410	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	32	1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.8640.11	95.90556	2	1534.5623	1534.5634	K	V	384	397
PSM	QEYDESGPSIVHRK	411	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	32	1-UNIMOD:28	ms_run[1]:scan=1.1.9164.11	109.8056	2	1626.7587	1626.7633	K	C	360	374
PSM	KIGQQPQQPGAPPQQDYTK	412	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.8256.10	85.72623	3	2109.065771	2108.065067	K	A	628	647
PSM	NQGGYGGSSSSSSYGSGR	413	sp|P09651|ROA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.7576.11	67.97273	2	1694.678047	1693.692819	R	R	353	371
PSM	NQGGYGGSSSSSSYGSGR	414	sp|P09651|ROA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.7455.11	64.72836	2	1694.678847	1693.692819	R	R	353	371
PSM	SETAPAAPAAPAPAEK	415	sp|P10412|H14_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	32	1-UNIMOD:1	ms_run[1]:scan=1.1.9021.11	106.039	2	1519.7487	1519.7513	M	T	2	18
PSM	SETAPAAPAAPAPAEK	416	sp|P10412|H14_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	32	1-UNIMOD:1	ms_run[1]:scan=1.1.9002.9	105.5289	2	1519.7487	1519.7513	M	T	2	18
PSM	ATDTSQGELVHPK	417	sp|Q5SSJ5|HP1B3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	32	1-UNIMOD:1	ms_run[1]:scan=1.1.8561.11	93.82587	2	1423.6901	1423.6938	M	A	2	15
PSM	TGVHHYSGNNIELGTACGK	418	sp|P62888|RL30_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	32	17-UNIMOD:4	ms_run[1]:scan=1.1.8611.11	95.12643	3	2014.930871	2013.932673	K	Y	69	88
PSM	AATASAGAGGIDGKPR	419	sp|Q02978|M2OM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	32	1-UNIMOD:1	ms_run[1]:scan=1.1.8158.11	83.21851	2	1440.7297	1440.7316	M	T	2	18
PSM	VHGPGIQSGTTNKPNK	420	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.6891.3	49.70537	4	1633.8569	1633.8536	R	F	1360	1376
PSM	TVEAEAAHGTVTR	421	sp|O75874|IDHC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.7293.6	60.40697	3	1340.6722	1340.6684	K	H	302	315
PSM	VAAQCSHAAVSAYK	422	sp|Q9Y3E5|PTH2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31	5-UNIMOD:4	ms_run[1]:scan=1.1.7352.9	61.94603	3	1461.7072	1461.7034	K	Q	82	96
PSM	VEAKPEVQSQPPR	423	sp|Q9UN86-2|G3BP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.7168.8	57.12352	3	1463.7751	1463.7732	R	V	245	258
PSM	AHAAQVTCVAASPHK	424	sp|Q9BQA1|MEP50_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31	8-UNIMOD:4	ms_run[1]:scan=1.1.7050.10	53.92147	3	1546.7707	1546.7674	R	D	165	180
PSM	VAHSDKPGSTSTASFR	425	sp|Q9P0L0|VAPA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.7187.9	57.64305	3	1646.8036	1646.8013	K	D	206	222
PSM	KGPGLAVQSGDK	426	sp|Q96PK6|RBM14_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.7173.10	57.26287	2	1155.6270	1155.6248	K	T	153	165
PSM	HVEASGGSGPGDSGPSDPR	427	sp|Q9UPT8|ZC3H4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.6980.8	52.0873	3	1764.7708	1764.7663	R	L	873	892
PSM	PGSDTIKPDVQK	428	sp|Q06830|PRDX1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.7300.4	60.58258	3	1283.6764	1283.6721	K	S	179	191
PSM	LADSGDGAGPSPEEK	429	sp|Q92917|GPKOW_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.7179.9	57.42512	2	1428.6412	1428.6369	R	D	32	47
PSM	HSEAATAQREEWK	430	sp|Q14103-3|HNRPD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.7353.9	61.973	3	1541.7223	1541.7222	R	M	86	99
PSM	IECDDKGDGSCDVR	431	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31	3-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=1.1.6975.11	51.96007	2	1624.6470	1624.6458	K	Y	621	635
PSM	IHEGCEEPATHNALAK	432	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31	5-UNIMOD:4	ms_run[1]:scan=1.1.7343.10	61.70447	3	1775.8291	1775.8260	R	I	866	882
PSM	RVVDESDETENQEEK	433	sp|O75717|WDHD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.6980.9	52.08897	3	1805.7922	1805.7915	K	A	1085	1100
PSM	STSHTSDFNPNSGSDQR	434	sp|Q99700-4|ATX2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.7320.10	61.10583	3	1835.7703	1835.7671	R	V	528	545
PSM	HLDGEEDGSSDQSQASGTTGGR	435	sp|Q9UNF1|MAGD2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.6986.11	52.24672	2	2189.9114	2189.9057	K	R	182	204
PSM	HADHSSLTLGSGSSTTR	436	sp|Q7Z6Z7-2|HUWE1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.7503.6	66.0062	4	1712.8173	1712.8078	R	L	2522	2539
PSM	NVIHASDSVEGAQR	437	sp|O00746|NDKM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.7655.7	70.09385	3	1481.7223	1481.7223	R	E	148	162
PSM	KLGAGEGGEASVSPEK	438	sp|Q13428-4|TCOF_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.7402.9	63.29032	3	1514.7568	1514.7576	K	T	1402	1418
PSM	MRPGVACSVSQAQK	439	sp|P32969|RL9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31	7-UNIMOD:4	ms_run[1]:scan=1.1.7530.9	66.73137	3	1517.7469	1517.7443	R	D	128	142
PSM	TVYHAEEVQCDGR	440	sp|Q16527|CSRP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31	10-UNIMOD:4	ms_run[1]:scan=1.1.7664.11	70.34164	3	1562.6782	1562.6784	R	S	16	29
PSM	CIGKPGGSLDNSEQK	441	sp|Q9Y5L4|TIM13_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31	1-UNIMOD:4	ms_run[1]:scan=1.1.7408.9	63.45295	3	1588.7581	1588.7515	K	C	50	65
PSM	EAAGTTAAAGTGGATEQPPR	442	sp|O43290|SNUT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.7464.10	64.9707	3	1812.8647	1812.8602	K	H	12	32
PSM	SGGGGGGGLGSGGSIR	443	sp|P35527|K1C9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.7543.10	67.08245	2	1231.5914	1231.5906	R	S	14	30
PSM	QLHQSCQTDDGEDDLK	444	sp|P61201-2|CSN2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31	6-UNIMOD:4	ms_run[1]:scan=1.1.7468.11	65.08082	3	1887.7939	1887.7905	R	K	181	197
PSM	ADDKETCFAEEGK	445	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31	7-UNIMOD:4	ms_run[1]:scan=1.1.7651.11	69.99247	2	1498.6252	1498.6246	K	K	585	598
PSM	SNIHCNTIAPNAGSR	446	sp|P51659-2|DHB4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31	5-UNIMOD:4	ms_run[1]:scan=1.1.7459.11	64.83665	2	1610.7604	1610.7583	K	M	210	225
PSM	AGLESGAEPGDGDSDTTK	447	sp|O60832|DKC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.7677.11	70.67983	2	1705.7308	1705.7279	K	K	481	499
PSM	QEAGISEGQGTAGEEEEK	448	sp|O43583|DENR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.7607.11	68.80811	2	1847.8048	1847.8021	K	K	76	94
PSM	KHEAFESDLAAHQDR	449	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.8086.5	81.35863	4	1752.8245	1752.8179	K	V	455	470
PSM	GDVTAEEAAGASPAK	450	sp|P49006|MRP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.7749.6	72.5455	3	1372.6510	1372.6470	R	A	11	26
PSM	IIHEDGYSEDECK	451	sp|P08754|GNAI3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31	12-UNIMOD:4	ms_run[1]:scan=1.1.7779.10	73.32412	3	1593.6628	1593.6617	K	Q	55	68
PSM	VGGSDEEASGIPSR	452	sp|Q9NQ55|SSF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.7948.11	77.71865	2	1359.6336	1359.6266	R	T	356	370
PSM	EESGVSVSNSQPTNESHSIK	453	sp|Q99808-2|S29A1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.7897.11	76.3908	3	2114.9737	2114.9716	K	A	343	363
PSM	RQLEEAEEEATR	454	sp|P35580-3|MYH10_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.7871.10	75.70915	2	1459.6896	1459.6902	K	A	1905	1917
PSM	LFQECCPHSTDR	455	sp|P61978-2|HNRPK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31	5-UNIMOD:4,6-UNIMOD:4	ms_run[1]:scan=1.1.8066.11	80.83646	2	1548.6462	1548.6450	K	V	180	192
PSM	VDNSSLTGESEPQTR	456	sp|P05023-4|AT1A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.8015.11	79.46902	2	1618.7428	1618.7435	K	S	213	228
PSM	KFAEALGSTEAK	457	sp|P78347-2|GTF2I_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.8182.5	83.8343	3	1250.6512	1250.6506	K	A	436	448
PSM	LGIKPESVQPHRPTTNPNTSK	458	sp|Q16527|CSRP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.8317.8	87.33913	5	2300.2266	2300.2237	R	F	88	109
PSM	AVTEQGAELSNEER	459	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.8246.7	85.47021	3	1531.7134	1531.7114	K	N	28	42
PSM	RPLRPQVVTDDDGQAPEAK	460	sp|Q9HDC9|APMAP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.8317.10	87.34247	4	2091.0689	2091.0709	R	D	11	30
PSM	HTGPNSPDTANDGFVR	461	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.8210.9	84.55856	3	1683.7603	1683.7601	K	L	99	115
PSM	CGFCHVGEEENEAR	462	sp|Q8IWS0-3|PHF6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31	1-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=1.1.8361.10	88.51041	3	1692.6601	1692.6620	K	G	211	225
PSM	NQQITHANNTVSNFK	463	sp|Q92598-2|HS105_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.8285.6	86.48265	3	1714.8355	1714.8387	K	R	54	69
PSM	TATDEAYKDPSNLQGK	464	sp|Q13813|SPTN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.8308.9	87.10233	3	1736.8189	1736.8217	K	V	595	611
PSM	TEDGGEFEEGASENNAK	465	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.8161.10	83.29382	3	1782.7171	1782.7180	K	E	434	451
PSM	TPTSSPASSPLVAK	466	sp|Q14684|RRP1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.8462.11	91.19518	2	1341.7120	1341.7140	K	K	728	742
PSM	SCVEEPEPEPEAAEGDGDKK	467	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31	2-UNIMOD:4	ms_run[1]:scan=1.1.8196.4	84.20193	3	2171.9125	2171.9164	K	G	107	127
PSM	VGQAVDVVGQAGKPK	468	sp|Q13200|PSMD2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.8263.9	85.90395	3	1451.8093	1451.8096	R	T	846	861
PSM	LSSEMNTSTVNSAR	469	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.8290.11	86.62482	2	1495.6910	1495.6936	R	E	277	291
PSM	AVTEQGAELSNEER	470	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.8266.8	85.97988	3	1531.7134	1531.7114	K	N	28	42
PSM	AVTEQGAELSNEER	471	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.8244.10	85.42271	2	1531.7094	1531.7114	K	N	28	42
PSM	GEPAAAAAPEAGASPVEK	472	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.8336.11	87.85063	2	1621.7906	1621.7947	K	E	88	106
PSM	SSTTVSSFANSKPGSAK	473	sp|Q13620-1|CUL4B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.8165.7	83.39243	3	1654.8139	1654.8162	K	K	161	178
PSM	HTGPNSPDTANDGFVR	474	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.8404.9	89.65118	3	1683.7597	1683.7601	K	L	99	115
PSM	SEDEAGCSSVDEESYK	475	sp|Q7L4I2-2|RSRC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31	7-UNIMOD:4	ms_run[1]:scan=1.1.8134.11	82.60406	2	1790.6806	1790.6788	K	T	328	344
PSM	LREDENAEPVGTTYQK	476	sp|Q16643-2|DREB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.8124.6	82.34589	3	1848.8860	1848.8853	R	T	152	168
PSM	AEPPKAPEQEQAAPGPAAGGEAPK	477	sp|P80723|BASP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.8166.11	83.42484	3	2297.1274	2297.1287	K	A	98	122
PSM	TDGEGEDPECLGEGK	478	sp|Q8WZA9|IRGQ_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31	10-UNIMOD:4	ms_run[1]:scan=1.1.8595.8	94.7061	2	1591.6224	1591.6308	R	M	331	346
PSM	KQPPVSPGTALVGSQK	479	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.8722.4	98.0984	4	1592.8889	1592.8886	R	E	31	47
PSM	RSGVAYIAAPSGSAADK	480	sp|P31939-2|PUR9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.8784.4	99.7709	4	1619.8301	1619.8267	K	V	552	569
PSM	SGVISGGASDLK	481	sp|Q14683|SMC1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.8545.9	93.39132	2	1089.5656	1089.5666	K	A	649	661
PSM	HHAAYVNNLNVTEEK	482	sp|P04179-2|SODM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.8672.10	96.76263	3	1737.8122	1737.8434	K	Y	54	69
PSM	NSATSADEQPHIGNYR	483	sp|Q7KZI7-11|MARK2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.8689.10	97.2215	3	1758.7849	1758.7921	R	L	39	55
PSM	LPAAGGGAAGEPLK	484	sp|Q2Q1W2|LIN41_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.8632.8	95.68563	2	1207.6546	1207.6561	R	L	75	89
PSM	AEDKPSTDLSAPVNGEATSQK	485	sp|Q7Z4V5-2|HDGR2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.8771.11	99.43266	3	2144.0185	2144.0233	K	G	590	611
PSM	GDATVSYEDPPTAK	486	sp|Q01844-3|EWS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.8718.11	98.00195	2	1449.6600	1449.6624	K	A	410	424
PSM	IAECSSQLAEEEEK	487	sp|P35580-3|MYH10_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31	4-UNIMOD:4	ms_run[1]:scan=1.1.8774.9	99.51003	2	1621.7100	1621.7141	R	A	1029	1043
PSM	IAECSSQLAEEEEK	488	sp|P35580-3|MYH10_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31	4-UNIMOD:4	ms_run[1]:scan=1.1.8755.11	99.00076	2	1621.7100	1621.7141	R	A	1029	1043
PSM	HHAAYVNNLNVTEEK	489	sp|P04179-2|SODM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.8653.11	96.25515	3	1737.8422	1737.8434	K	Y	54	69
PSM	QQSIAGSADSKPIDVSR	490	sp|Q12904-2|AIMP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.8813.10	100.5618	3	1757.8876	1757.8908	K	L	162	179
PSM	QCQCTSVGAQNTVICSK	491	sp|P16422|EPCAM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31	2-UNIMOD:4,4-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=1.1.8732.11	98.37963	2	1939.8490	1939.8550	R	L	45	62
PSM	EQSGTIYLQHADEEREK	492	sp|P37198|NUP62_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.9058.6	107.02	4	2031.9489	2031.9497	K	T	416	433
PSM	FAAATGATPIAGR	493	sp|P08865|RSSA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.9185.10	110.3663	2	1202.6390	1202.6408	K	F	90	103
PSM	TPVEPEVAIHR	494	sp|P60866-2|RS20_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.9078.3	107.5446	3	1246.6684	1246.6670	K	I	9	20
PSM	TPVEPEVAIHR	495	sp|P60866-2|RS20_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.9098.3	108.0654	3	1246.6684	1246.6670	K	I	9	20
PSM	VLEEANQAINPK	496	sp|Q92841-3|DDX17_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.9064.11	107.1888	2	1324.6938	1324.6986	K	L	457	469
PSM	VLEEANQAINPK	497	sp|Q92841-3|DDX17_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.9026.10	106.1713	2	1324.6938	1324.6986	K	L	457	469
PSM	AAECNIVVTQPR	498	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31	4-UNIMOD:4	ms_run[1]:scan=1.1.9054.11	106.9213	2	1356.6794	1356.6820	R	R	435	447
PSM	CTGGEVGATSALAPK	499	sp|P30050-2|RL12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31	1-UNIMOD:4	ms_run[1]:scan=1.1.8941.10	103.9088	2	1417.6842	1417.6871	R	I	17	32
PSM	QEYDESGPSIVHR	500	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.8875.7	102.1916	3	1515.6931	1515.6954	K	K	360	373
PSM	DINAYNCEEPTEK	501	sp|P30041|PRDX6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31	7-UNIMOD:4	ms_run[1]:scan=1.1.9012.11	105.7988	2	1581.6594	1581.6617	K	L	85	98
PSM	ASSEGGTAAGAGLDSLHK	502	sp|O15143|ARC1B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.8875.8	102.1932	3	1627.7767	1627.7802	K	N	309	327
PSM	STAGDTHLGGEDFDNR	503	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.9118.11	108.5955	3	1690.7176	1690.7183	K	M	221	237
PSM	STAGDTHLGGEDFDNR	504	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.9138.10	109.1098	3	1690.7176	1690.7183	K	M	221	237
PSM	CLDCQEHLCDNCVR	505	sp|Q2Q1W2|LIN41_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31	1-UNIMOD:4,4-UNIMOD:4,9-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.8994.10	105.3186	3	1877.7253	1877.7277	R	A	212	226
PSM	VEEEEERNQILQNEK	506	sp|P35580-3|MYH10_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.8938.11	103.8304	2	1885.8982	1885.9017	R	K	952	967
PSM	NPLPPSVGVVDKK	507	sp|Q8NC51-3|PAIRB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.9439.8	117.1038	3	1348.7701	1348.7715	K	E	80	93
PSM	NISSAQIVGPGPKPEASAK	508	sp|P53990-2|IST1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.9381.6	115.5503	4	1849.9917	1849.9897	K	L	262	281
PSM	GHENVEAAQAEYIEK	509	sp|P05166-2|PCCB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.9244.7	111.929	3	1686.7849	1686.7849	K	F	495	510
PSM	QEAATLAANNTQLQAR	510	sp|Q14980-2|NUMA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.9383.7	115.6061	3	1698.8611	1698.8649	K	V	420	436
PSM	IEQLQNHENEDIYK	511	sp|O00629|IMA3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.9441.11	117.1627	3	1771.8337	1771.8376	K	L	462	476
PSM	EVGGGHGCTSPPFPQEAR	512	sp|Q6ZN17|LN28B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31	8-UNIMOD:4	ms_run[1]:scan=1.1.9364.10	115.101	3	1881.8401	1881.8428	R	A	194	212
PSM	AASAATAAPTATPAAQESGTIPK	513	sp|O00116|ADAS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.9448.10	117.3501	3	2082.0538	2082.0593	R	K	63	86
PSM	SQGGEPTYNVAVGR	514	sp|P35080|PROF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.9343.11	114.5489	2	1433.6862	1433.6899	K	A	92	106
PSM	ESEDKPEIEDVGSDEEEEK	515	sp|P07900-2|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.9428.10	116.8112	3	2191.9033	2191.9128	K	K	373	392
PSM	LDYGQHVVAGTPGR	516	sp|P38919|IF4A3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.9319.11	113.92	2	1468.7400	1468.7423	K	V	153	167
PSM	ILELSGSSSEDSEK	517	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.9507.11	118.9399	2	1479.6896	1479.6940	R	V	3359	3373
PSM	ELDDATEANEGLSR	518	sp|P35580-3|MYH10_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.9254.11	112.1981	2	1518.6750	1518.6798	R	E	1927	1941
PSM	TDSLAHCISEDCR	519	sp|Q9Y530|OARD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31	7-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.9290.10	113.1404	3	1562.6458	1562.6453	K	M	27	40
PSM	KLDPGSEETQTLVR	520	sp|P26641-2|EF1G_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.9506.10	118.9114	2	1571.8108	1571.8155	R	E	451	465
PSM	SEEQLKEEGIEYK	521	sp|P09622|DLDH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.9389.8	115.7698	3	1580.7571	1580.7569	K	V	405	418
PSM	TGTITTFEHAHNMR	522	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.9276.11	112.7711	2	1614.7530	1614.7573	K	V	482	496
PSM	DGTDGETEVGEIQQNK	523	sp|Q6NZY4|ZCHC8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.9299.11	113.384	2	1718.7524	1718.7595	K	S	340	356
PSM	ESLAEEHEGLVGEGQR	524	sp|Q10570|CPSF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.9499.11	118.7254	2	1738.8080	1738.8122	R	S	167	183
PSM	HLCQQLQAEQAAAEK	525	sp|Q14980-2|NUMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31	3-UNIMOD:4	ms_run[1]:scan=1.1.9067.8	107.2632	3	1723.8265	1723.8311	K	R	1365	1380
PSM	NPACSGANICQVKPNDQHFSR	526	sp|P11717|MPRI_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31	4-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.9350.8	114.7266	4	2399.0857	2399.0859	R	K	2185	2206
PSM	AAAAAWEEPSSGNGTAR	527	sp|Q9P258|RCC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.9081.9	107.6342	3	1644.7444	1644.7492	K	A	6	23
PSM	KQPPVSPGTALVGSQK	528	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.8717.4	97.96357	4	1592.8889	1592.8886	R	E	31	47
PSM	KQPPVSPGTALVGSQK	529	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.8758.4	99.07017	4	1592.8889	1592.8886	R	E	31	47
PSM	IGDVVGSSGANQQTSGK	530	sp|Q9Y263|PLAP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.7607.10	68.80645	3	1603.7875	1603.7802	K	V	377	394
PSM	AAFTECCQAADK	531	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31	6-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=1.1.7894.5	76.31046	2	1371.559647	1370.559486	K	A	187	199
PSM	AAFTECCQAADK	532	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31	6-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=1.1.7874.11	75.79148	2	1371.559647	1370.559486	K	A	187	199
PSM	CCAAADPHECYAK	533	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	31	1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.8697.11	97.43895	2	1534.5623	1534.5634	K	V	384	397
PSM	QEYDESGPSIVHR	534	sp|Q9BYX7|ACTBM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.8915.7	103.2191	3	1516.697171	1515.695386	K	K	360	373
PSM	QEYDESGPSIVHR	535	sp|Q9BYX7|ACTBM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.8954.8	104.2535	3	1516.697171	1515.695386	K	K	360	373
PSM	QEYDESGPSIVHR	536	sp|Q9BYX7|ACTBM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.8895.4	102.7054	3	1517.707271	1515.695386	K	K	360	373
PSM	GSVSNQQFAGGCAK	537	sp|Q9H9Z2|LN28A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	31	1-UNIMOD:1,12-UNIMOD:4	ms_run[1]:scan=1.1.8968.11	104.6341	2	1451.6423	1451.6458	M	A	2	16
PSM	GPENLHYDQGCQTSR	538	sp|Q9UBW7|ZMYM2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31	11-UNIMOD:4	ms_run[1]:scan=1.1.7968.11	78.25515	3	1761.750071	1760.753646	K	T	813	828
PSM	LEPKPQPPVAEATPR	539	sp|Q9UHD8|SEPT9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.8568.10	94.01158	3	1629.886271	1628.888606	R	S	223	238
PSM	SETAPAAPAAAPPAEK	540	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	31	1-UNIMOD:1	ms_run[1]:scan=1.1.8858.10	101.7493	2	1519.7485	1519.7513	M	A	2	18
PSM	SETAPAAPAAAPPAEK	541	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	31	1-UNIMOD:1	ms_run[1]:scan=1.1.8870.9	102.0652	3	1519.7500	1519.7513	M	A	2	18
PSM	IIAEGANGPTTPEADK	542	sp|P00367|DHE3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.8362.11	88.53882	2	1583.786647	1582.783866	K	I	400	416
PSM	GDATVSYEDPPTAK	543	sp|Q01844|EWS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.8699.11	97.49278	2	1450.659447	1449.662354	K	A	411	425
PSM	ITDSAGHILYSK	544	sp|P49755|TMEDA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.9034.11	106.3869	2	1304.675847	1303.677216	K	E	76	88
PSM	RPGVTGENSNEVAK	545	sp|Q7Z3K3-2|POGZ_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.6947.7	51.20478	3	1456.7302	1456.7270	K	L	253	267
PSM	NNRPSEGPLQTR	546	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.7348.4	61.82975	3	1367.6953	1367.6906	K	L	572	584
PSM	LRESTPGDSPSTVNK	547	sp|Q5T6F2|UBAP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.7162.8	56.96012	3	1586.7913	1586.7900	K	L	465	480
PSM	LQSEDSAKTEEVDEEK	548	sp|Q9UIG0-2|BAZ1B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.7344.11	61.73325	3	1835.8261	1835.8272	K	K	1118	1134
PSM	IEGDETSTEAATR	549	sp|P52434-3|RPAB3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.7176.11	57.34658	2	1378.6236	1378.6212	R	L	63	76
PSM	AGQSAAGAAPGGGVDTR	550	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.7180.11	57.45585	2	1441.6916	1441.6910	R	D	8	25
PSM	EGGDGEEQDVGDAGR	551	sp|Q8N1G4|LRC47_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.7179.11	57.42845	2	1489.5930	1489.5917	R	L	292	307
PSM	HECQANGPEDLNR	552	sp|P60981-2|DEST_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30	3-UNIMOD:4	ms_run[1]:scan=1.1.7248.11	59.25668	2	1538.6550	1538.6532	K	A	116	129
PSM	RQSNVAAPGDATPPAEK	553	sp|Q96QC0|PP1RA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.7330.5	61.36685	3	1707.8578	1707.8540	K	K	245	262
PSM	HFEANNGKLPDNK	554	sp|Q9P2J5-2|SYLC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.7418.6	63.71857	3	1482.7225	1482.7215	K	V	904	917
PSM	KTQNDVLHAENVK	555	sp|P35241-5|RADI_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.7484.8	65.50933	3	1494.7813	1494.7790	K	A	544	557
PSM	PQEAAVAPEKPPASDETK	556	sp|P29966|MARCS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.7575.11	67.94585	3	1863.9196	1863.9214	K	A	239	257
PSM	SEGDGTQDIVDK	557	sp|Q5UIP0|RIF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.7665.10	70.36613	2	1262.5624	1262.5627	K	S	1513	1525
PSM	FDDGAGGDNEVQR	558	sp|P35998|PRS7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.7697.11	71.21055	2	1378.5770	1378.5750	R	T	285	298
PSM	FSPGAPGGSGSQPNQK	559	sp|Q15942|ZYX_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.7525.10	66.59859	2	1514.7120	1514.7114	K	L	280	296
PSM	EGCGDDNVCNSNLK	560	sp|P23229-2|ITA6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30	3-UNIMOD:4,9-UNIMOD:4	ms_run[1]:scan=1.1.7505.11	66.06709	2	1580.6212	1580.6195	K	L	624	638
PSM	IGDVVGSSGANQQTSGK	561	sp|Q9Y263|PLAP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.7608.10	68.83285	2	1603.7858	1603.7802	K	V	377	394
PSM	RTADDSATSDYCPAPK	562	sp|Q9UBC3-2|DNM3B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30	12-UNIMOD:4	ms_run[1]:scan=1.1.7536.10	66.8945	3	1753.7605	1753.7577	R	R	362	378
PSM	PAHSQNQSNFSSYSSK	563	sp|Q07157-2|ZO1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.7517.10	66.3843	3	1767.7846	1767.7812	K	G	1306	1322
PSM	LGDQGPPEEAEDR	564	sp|O00592-2|PODXL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.7743.8	72.40057	2	1411.6204	1411.6215	K	F	413	426
PSM	KGDSNANSDVCAAALR	565	sp|Q8IZL8|PELP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30	11-UNIMOD:4	ms_run[1]:scan=1.1.8067.7	80.85613	3	1647.7636	1647.7635	R	G	512	528
PSM	APKPDGPGGGPGGSHMGGNYGDDR	566	sp|P35637-2|FUS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.7873.10	75.76292	4	2251.9681	2251.9665	K	R	448	472
PSM	HQGVMVGMGQK	567	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.7727.10	72.00812	2	1170.5646	1170.5638	R	D	40	51
PSM	KGESQTDIEITR	568	sp|P49368|TCPG_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.8052.10	80.45938	2	1375.6966	1375.6943	K	E	249	261
PSM	TPCNAGTFSQPEK	569	sp|O43684-2|BUB3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30	3-UNIMOD:4	ms_run[1]:scan=1.1.7971.11	78.33462	2	1435.6398	1435.6402	R	V	127	140
PSM	HSHTNLSISTGVTK	570	sp|Q5T7N2|LITD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.7870.9	75.68076	3	1480.7626	1480.7634	K	L	572	586
PSM	LFQECCPHSTDR	571	sp|P61978-2|HNRPK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30	5-UNIMOD:4,6-UNIMOD:4	ms_run[1]:scan=1.1.8047.11	80.32632	2	1548.6462	1548.6450	K	V	180	192
PSM	EATNPPVIQEEKPK	572	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.8013.10	79.41708	2	1578.8252	1578.8253	R	K	483	497
PSM	AESCGSGNSTGYQIR	573	sp|Q9H2U1-2|DHX36_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30	4-UNIMOD:4	ms_run[1]:scan=1.1.8001.10	79.10448	2	1585.6794	1585.6791	R	L	281	296
PSM	VAVAAASKPHVEIR	574	sp|P29762|RABP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.8180.2	83.7774	4	1446.8313	1446.8307	K	Q	32	46
PSM	SGGASHSELIHNLR	575	sp|P22061-2|PIMT_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.8288.2	86.55627	4	1476.7461	1476.7433	K	K	5	19
PSM	ASNGDAWVEAHGK	576	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.8134.5	82.59407	3	1340.6131	1340.6109	R	L	147	160
PSM	KQSTDEEVTSLAK	577	sp|P23193|TCEA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.8305.7	87.01885	3	1434.7186	1434.7202	R	S	55	68
PSM	VGQAVDVVGQAGKPK	578	sp|Q13200|PSMD2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.8282.8	86.40578	3	1451.8093	1451.8096	R	T	846	861
PSM	EHDPVGQMVNNPK	579	sp|P55060-3|XPO2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.8335.6	87.81543	3	1463.6800	1463.6827	K	I	913	926
PSM	LSEGSQPAEEEEDQETPSR	580	sp|Q9UKV3-5|ACINU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.8184.10	83.89568	2	2116.9154	2116.9032	K	N	239	258
PSM	RDIQENDEEAVQVK	581	sp|O00231-2|PSD11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.8151.7	83.03175	3	1671.8098	1671.8064	K	E	33	47
PSM	NEEPSEEEIDAPKPK	582	sp|Q9NR30|DDX21_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.8372.11	88.80714	3	1710.7924	1710.7948	K	K	117	132
PSM	QASTDAGTAGALTPQHVR	583	sp|P46937-6|YAP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.8412.8	89.85537	3	1779.8803	1779.8864	R	A	107	125
PSM	GNLGAGNGNLQGPR	584	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.8156.11	83.16735	2	1323.6630	1323.6644	R	H	374	388
PSM	GNLGAGNGNLQGPR	585	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.8136.10	82.65501	2	1323.6630	1323.6644	R	H	374	388
PSM	RLAPEYEAAATR	586	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.8349.11	88.19199	2	1346.6918	1346.6942	K	L	62	74
PSM	YICENQDSISSK	587	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30	3-UNIMOD:4	ms_run[1]:scan=1.1.8104.7	81.83902	3	1442.6374	1442.6347	K	L	287	299
PSM	YICENQDSISSK	588	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30	3-UNIMOD:4	ms_run[1]:scan=1.1.8091.11	81.50282	2	1442.6358	1442.6347	K	L	287	299
PSM	LGDEDEEIDGDTNK	589	sp|P09884|DPOLA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.8454.11	90.97993	2	1548.6456	1548.6427	K	Y	816	830
PSM	IKSEHPGLSIGDTAK	590	sp|P26583|HMGB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.8235.6	85.18782	3	1551.8233	1551.8257	K	K	113	128
PSM	ALYEQNQSDVNEAK	591	sp|Q14691|PSF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.8240.8	85.3213	2	1607.7406	1607.7427	K	S	38	52
PSM	GEPAAAAAPEAGASPVEK	592	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.8413.11	89.88622	2	1621.7906	1621.7947	K	E	88	106
PSM	PASGCEAETQTEELK	593	sp|P11717|MPRI_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30	5-UNIMOD:4	ms_run[1]:scan=1.1.8272.11	86.14377	2	1648.7228	1648.7250	K	N	983	998
PSM	EHGQCADVDECSLAEK	594	sp|Q6UXH1-5|CREL2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30	5-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=1.1.8268.10	86.03561	3	1846.7461	1846.7462	R	T	333	349
PSM	EGATVYATGTHAQVEDGR	595	sp|P32322-3|P5CR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.8417.9	89.98652	3	1860.8563	1860.8602	R	L	157	175
PSM	ERHPGSFDVVHVK	596	sp|P62701|RS4X_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.8685.4	97.10345	4	1505.7765	1505.7739	R	D	199	212
PSM	LTGVFAPRPSTGPHK	597	sp|P62701|RS4X_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.8811.2	100.4945	4	1563.8549	1563.8522	K	L	23	38
PSM	NCPHIVVGTPGR	598	sp|Q13838-2|DX39B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30	2-UNIMOD:4	ms_run[1]:scan=1.1.8550.4	93.51768	3	1305.6610	1305.6612	K	I	179	191
PSM	NCPHIVVGTPGR	599	sp|Q13838-2|DX39B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30	2-UNIMOD:4	ms_run[1]:scan=1.1.8492.5	91.98228	3	1305.6613	1305.6612	K	I	179	191
PSM	ASGNYATVISHNPETKK	600	sp|P62917|RL8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.8501.7	92.22107	4	1815.9145	1815.9115	R	T	129	146
PSM	LHYCVSCAIHSK	601	sp|Q5JNZ5|RS26L_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30	4-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=1.1.8827.10	100.9389	3	1473.6883	1473.6857	K	V	71	83
PSM	RDPHLACVAYER	602	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30	7-UNIMOD:4	ms_run[1]:scan=1.1.8596.8	94.72673	3	1485.7135	1485.7147	K	G	912	924
PSM	VDEVPDGAVKPPTNK	603	sp|O75475|PSIP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.8734.8	98.42847	3	1564.8082	1564.8097	R	L	25	40
PSM	KQPPVSPGTALVGSQK	604	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.8720.7	98.04925	3	1592.8894	1592.8886	R	E	31	47
PSM	IVGPSGAAVPCK	605	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30	11-UNIMOD:4	ms_run[1]:scan=1.1.8538.10	93.20475	2	1154.6106	1154.6118	K	V	1008	1020
PSM	AGYSQGATQYTQAQQTR	606	sp|Q96KR1|ZFR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.8536.11	93.15283	3	1857.8587	1857.8606	K	Q	192	209
PSM	NCPHIVVGTPGR	607	sp|Q13838-2|DX39B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30	2-UNIMOD:4	ms_run[1]:scan=1.1.8511.6	92.4844	3	1305.6613	1305.6612	K	I	179	191
PSM	HQEGEIFDTEK	608	sp|Q02878|RL6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.8702.10	97.57233	2	1331.5958	1331.5993	R	E	227	238
PSM	NGQVIGIGAGQQSR	609	sp|P31939-2|PUR9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.8815.10	100.6159	2	1383.7190	1383.7219	K	I	437	451
PSM	AGGAAVVITEPEHTK	610	sp|Q9P258|RCC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.8530.7	92.9862	3	1478.7742	1478.7729	K	E	78	93
PSM	SQAPGQPGASQWGSR	611	sp|Q96EP5-2|DAZP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.8605.10	94.96429	2	1512.7048	1512.7070	K	V	195	210
PSM	SVTEQGAELSNEER	612	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.8509.11	92.43987	2	1547.7036	1547.7063	K	N	28	42
PSM	TPEAVESPQEASGVR	613	sp|Q7L190|DPPA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.8675.11	96.8451	2	1555.7462	1555.7478	R	W	215	230
PSM	VDEVPDGAVKPPTNK	614	sp|O75475|PSIP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.8675.10	96.84343	3	1564.8109	1564.8097	R	L	25	40
PSM	QVLVAPGNAGTACSEK	615	sp|P22102|PUR2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30	13-UNIMOD:4	ms_run[1]:scan=1.1.8822.11	100.8064	2	1600.7840	1600.7879	K	I	29	45
PSM	GSLGSQGAKDEPEEELQK	616	sp|Q13428-4|TCOF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.8704.10	97.62627	3	1900.9057	1900.9014	K	G	1442	1460
PSM	QEYDESGPSIVHR	617	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.8856.10	101.6959	2	1515.6948	1515.6954	K	K	360	373
PSM	DHAVVVGVYRPPPK	618	sp|P22087|FBRL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.8973.7	104.7613	4	1532.8505	1532.8464	R	V	305	319
PSM	QQREDITQSAQHALR	619	sp|Q12906-7|ILF3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.8854.6	101.6358	4	1779.9257	1779.8976	R	L	309	324
PSM	QQREDITQSAQHALR	620	sp|Q12906-7|ILF3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.8855.5	101.6607	4	1779.9257	1779.8976	R	L	309	324
PSM	RPELLTHSTTEVTQPR	621	sp|P78347-2|GTF2I_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.9059.8	107.0501	4	1863.9777	1863.9803	K	T	499	515
PSM	CTGGEVGATSALAPK	622	sp|P30050-2|RL12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30	1-UNIMOD:4	ms_run[1]:scan=1.1.8963.7	104.4932	3	1417.6879	1417.6871	R	I	17	32
PSM	AREQAEAEVASLNR	623	sp|P06753-2|TPM3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.9029.9	106.2499	3	1542.7711	1542.7750	R	R	41	55
PSM	RPAEDMEEEQAFK	624	sp|P61978-2|HNRPK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.9124.8	108.7461	3	1578.6973	1578.6984	K	R	22	35
PSM	IEALQNHENESVYK	625	sp|P52292|IMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.9029.10	106.2516	3	1672.8031	1672.8056	K	A	473	487
PSM	SADGSAPAGEGEGVTLQR	626	sp|Q01650|LAT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.9031.9	106.3034	3	1700.7934	1700.7966	K	N	31	49
PSM	GYDSAGVAIDGNNHEVK	627	sp|O94808|GFPT2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.9172.9	110.0181	3	1744.8001	1744.8016	R	E	34	51
PSM	HPGSFDVVHVK	628	sp|P62701|RS4X_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.8982.3	104.9909	3	1220.6317	1220.6302	R	D	201	212
PSM	HGLTEADVGITK	629	sp|Q96PZ0-2|PUS7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.9181.10	110.2607	2	1239.6432	1239.6459	K	F	107	119
PSM	MEEESGAPGVPSGNGAPGPK	630	sp|P52272-2|HNRPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.9055.10	106.9463	3	1866.8353	1866.8418	K	G	18	38
PSM	HSEAFEALQQK	631	sp|Q07065|CKAP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.8950.11	104.1513	2	1286.6230	1286.6255	R	S	395	406
PSM	LITQTFSHHNQLAQK	632	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.8905.5	102.9582	4	1764.9285	1764.9271	K	T	54	69
PSM	VLEEANQAINPK	633	sp|Q92841-3|DDX17_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.9045.10	106.6793	2	1324.6938	1324.6986	K	L	457	469
PSM	SCVEEPEPEPEAAEGDGDK	634	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30	2-UNIMOD:4	ms_run[1]:scan=1.1.8844.10	101.383	3	2043.8173	2043.8215	K	K	107	126
PSM	AQAELVGTADEATR	635	sp|P30049|ATPD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.9119.11	108.6216	2	1430.6974	1430.7001	K	A	137	151
PSM	YELISETGGSHDK	636	sp|Q12906-7|ILF3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.8942.6	103.9288	3	1434.6622	1434.6627	K	R	545	558
PSM	YELISETGGSHDK	637	sp|Q12906-7|ILF3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.8939.8	103.852	3	1434.6622	1434.6627	K	R	545	558
PSM	YELISETGGSHDK	638	sp|Q12906-7|ILF3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.8934.8	103.7187	3	1434.6622	1434.6627	K	R	545	558
PSM	YELISETGGSHDK	639	sp|Q12906-7|ILF3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.8935.5	103.7403	3	1434.6622	1434.6627	K	R	545	558
PSM	EFHLNESGDPSSK	640	sp|Q01105|SET_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.8840.7	101.2738	3	1445.6419	1445.6423	K	S	155	168
PSM	IQFKPDDGTTPER	641	sp|Q96AE4-2|FUBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.8915.6	103.2175	3	1502.7349	1502.7365	R	I	308	321
PSM	YEQGTGCWQGPNR	642	sp|P14314-2|GLU2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30	7-UNIMOD:4	ms_run[1]:scan=1.1.9156.11	109.5907	2	1551.6474	1551.6525	K	S	462	475
PSM	ICDECNYGSYQGR	643	sp|Q7RTV0|PHF5A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30	2-UNIMOD:4,5-UNIMOD:4	ms_run[1]:scan=1.1.8890.11	102.5841	2	1620.6248	1620.6297	R	C	45	58
PSM	AAAAAWEEPSSGNGTAR	644	sp|Q9P258|RCC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.9095.11	108.0015	2	1644.7466	1644.7492	K	A	6	23
PSM	EEGETADTVGCCSLR	645	sp|P11387|TOP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30	11-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.9023.11	106.0926	2	1682.6852	1682.6876	K	V	494	509
PSM	STAGDTHLGGEDFDNR	646	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.9098.11	108.0787	2	1690.7120	1690.7183	K	M	221	237
PSM	GTEASSGTEAATGLEGEEK	647	sp|Q8IY81|SPB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.8873.10	102.1449	2	1822.8042	1822.8068	K	D	594	613
PSM	EESDDEAAVEEEEEEK	648	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.9165.11	109.8325	2	1865.7126	1865.7174	K	K	304	320
PSM	GAEHITTYTFNTHK	649	sp|Q7Z7K6-3|CENPV_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.9325.4	114.0651	4	1618.7749	1618.7740	K	A	194	208
PSM	VFEHDSVELNCK	650	sp|P10768|ESTD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30	11-UNIMOD:4	ms_run[1]:scan=1.1.9496.9	118.6416	3	1475.6698	1475.6715	K	M	18	30
PSM	HQAFEAELSANQSR	651	sp|Q13813|SPTN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.9459.7	117.6423	3	1586.7418	1586.7437	K	I	614	628
PSM	YGEAGEGPGWGGAHPR	652	sp|P26640|SYVC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.9300.9	113.4077	3	1596.7006	1596.7070	R	I	24	40
PSM	AHTSSTQLQEELEK	653	sp|Q9Y6Y8|S23IP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.9396.10	115.9619	3	1599.7729	1599.7740	R	V	891	905
PSM	GSNMDFREPTEEER	654	sp|Q15056|IF4H_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.9444.8	117.2387	3	1695.7144	1695.7158	R	A	192	206
PSM	VHPEIINENGNPSYK	655	sp|O95881|TXD12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.9336.6	114.3575	3	1709.8318	1709.8373	K	Y	124	139
PSM	KLERPPETPTVDPTVK	656	sp|Q14839-2|CHD4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.9278.10	112.8219	3	1805.9830	1805.9887	R	Y	696	712
PSM	DVACGANHTLVLDSQKR	657	sp|Q9P258|RCC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30	4-UNIMOD:4	ms_run[1]:scan=1.1.9214.11	111.1332	3	1882.9261	1882.9319	R	V	334	351
PSM	ATQQQHDFTLTQTADGR	658	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.9473.7	118.0196	3	1916.8933	1916.8977	R	S	2637	2654
PSM	HGESAWNLENR	659	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.9532.11	119.6121	2	1311.5922	1311.5956	R	F	11	22
PSM	GVQVETISPGDGR	660	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.9280.10	112.8744	2	1313.6544	1313.6576	M	T	2	15
PSM	HGESAWNLENR	661	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.9513.11	119.1011	2	1311.5922	1311.5956	R	F	11	22
PSM	EQAEAEVASLNR	662	sp|P06753-2|TPM3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.9475.10	118.0786	2	1315.6332	1315.6368	R	R	43	55
PSM	TLIQNCGASTIR	663	sp|P49368|TCPG_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30	6-UNIMOD:4	ms_run[1]:scan=1.1.9415.8	116.4664	2	1332.6788	1332.6820	R	L	450	462
PSM	VHTECCHGDLLECADDR	664	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30	5-UNIMOD:4,6-UNIMOD:4,13-UNIMOD:4	ms_run[1]:scan=1.1.9358.11	114.9425	3	2085.8248	2085.8303	K	A	265	282
PSM	FNEVAAQYSEDK	665	sp|Q9Y237-2|PIN4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.9378.11	115.4779	2	1399.6218	1399.6255	R	A	89	101
PSM	SEEAHAEDSVMDHHFR	666	sp|Q8NC51-3|PAIRB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.9455.8	117.536	4	1895.7873	1895.7857	K	K	315	331
PSM	VEITYTPSDGTQK	667	sp|O75874|IDHC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.9459.10	117.6472	2	1437.6958	1437.6987	K	V	152	165
PSM	GNVFSSPTAAGTPNK	668	sp|Q05682-4|CALD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.9354.9	114.8335	2	1446.7076	1446.7103	K	E	464	479
PSM	SSGFLPASQQACAK	669	sp|Q6NUQ4-2|TM214_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30	12-UNIMOD:4	ms_run[1]:scan=1.1.9456.10	117.5664	2	1450.6814	1450.6875	R	L	473	487
PSM	SYCAEIAHNVSSK	670	sp|P62910|RL32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30	3-UNIMOD:4	ms_run[1]:scan=1.1.9228.11	111.5085	2	1464.6628	1464.6667	K	N	94	107
PSM	DAHSQGEVVSCLEK	671	sp|Q92896|GSLG1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30	11-UNIMOD:4	ms_run[1]:scan=1.1.9438.6	117.0735	3	1557.7063	1557.7093	K	G	259	273
PSM	IHCTQTLLEGDGPK	672	sp|P29762|RABP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30	3-UNIMOD:4	ms_run[1]:scan=1.1.9304.8	113.5139	3	1567.7647	1567.7664	K	T	94	108
PSM	IQALQQQADEAEDR	673	sp|P67936|TPM4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.9359.11	114.9692	2	1613.7600	1613.7645	K	A	14	28
PSM	GGGGGQDNGLEGLGNDSR	674	sp|P08621|RU17_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.9385.11	115.6668	2	1658.7184	1658.7245	R	D	394	412
PSM	RPELLTHSTTEVTQPR	675	sp|P78347-2|GTF2I_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.9078.4	107.5463	4	1863.9777	1863.9803	K	T	499	515
PSM	QHPVPPPAQNQNQVR	676	sp|Q15942|ZYX_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.7147.10	56.55353	3	1708.8760	1708.8757	K	S	329	344
PSM	DLSKPEVEYDCDAPSHNSEK	677	sp|O15164-2|TIF1A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30	11-UNIMOD:4	ms_run[1]:scan=1.1.9335.10	114.3377	4	2318.9925	2318.9961	R	K	838	858
PSM	AGNASKDEIDSAVK	678	sp|P23381|SYWC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.7546.11	67.16472	2	1403.6904	1403.6892	K	M	28	42
PSM	LYKEELEQTYHAK	679	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.9346.9	114.624	3	1651.825571	1650.825337	R	L	259	272
PSM	QEYDESGPSIVHR	680	sp|Q9BYX7|ACTBM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.8935.6	103.742	3	1516.697171	1515.695386	K	K	360	373
PSM	PRNQGGYGGSSSSSSYGSGR	681	sp|P09651|ROA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.7239.8	59.0266	3	1947.830171	1946.846694	K	R	351	371
PSM	SVTEQGAELSNEER	682	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.8543.7	93.3342	3	1548.709871	1547.706344	K	N	28	42
PSM	SVTEQGAELSNEER	683	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.8524.7	92.82725	3	1548.709871	1547.706344	K	N	28	42
PSM	HTGPNSPDTANDGFVR	684	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.8347.8	88.13383	3	1685.761871	1683.760111	K	L	99	115
PSM	QHCCPAGYTCNVK	685	sp|P28799|GRN_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	30	1-UNIMOD:28,3-UNIMOD:4,4-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.8288.11	86.57127	2	1576.6211	1576.6216	R	A	479	492
PSM	HPSKPDPSGECNPDLR	686	sp|Q09028|RBBP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30	11-UNIMOD:4	ms_run[1]:scan=1.1.7368.10	62.37632	3	1803.814271	1804.816246	K	L	157	173
PSM	AQEPESGLSEETQVK	687	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.9179.10	110.2077	2	1629.767847	1630.768610	R	C	4091	4106
PSM	YHTINGHNAEVRK	688	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.6945.4	51.14567	4	1537.7805	1537.7749	K	A	162	175
PSM	YHTVNGHNCEVR	689	sp|P09651-2|ROA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29	9-UNIMOD:4	ms_run[1]:scan=1.1.6954.10	51.39988	3	1484.6635	1484.6579	K	K	167	179
PSM	RQAEQLSAAGEGGDAGR	690	sp|Q9NRX1|PNO1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.7334.10	61.46695	3	1671.7954	1671.7924	K	M	30	47
PSM	TLGETSANAETEQNKK	691	sp|Q5UIP0|RIF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.7104.11	55.37987	3	1719.8338	1719.8275	K	K	1489	1505
PSM	QVHPDTGISSK	692	sp|P33778|H2B1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.7010.4	52.82925	3	1167.5938	1167.5884	K	A	48	59
PSM	NNRPSEGPLQTR	693	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.7328.10	61.31598	2	1367.6922	1367.6906	K	L	572	584
PSM	QSNASSDVEVEEK	694	sp|O75475|PSIP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.7314.11	60.948	2	1420.6332	1420.6318	K	E	101	114
PSM	ISGDTCSGGDVEAR	695	sp|Q92673|SORL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29	6-UNIMOD:4	ms_run[1]:scan=1.1.7226.11	58.69393	2	1422.6074	1422.6045	K	L	731	745
PSM	AFHNEAQVNPERK	696	sp|P17987|TCPA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.7192.8	57.77733	3	1538.7589	1538.7590	R	N	469	482
PSM	ESRYEEEEEQSR	697	sp|Q9Y5B9|SP16H_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.7212.11	58.32057	2	1569.6534	1569.6543	R	S	1003	1015
PSM	EEPAAAGSGAASPSAAEK	698	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.7184.11	57.56472	2	1599.7378	1599.7376	K	G	70	88
PSM	DRDYSDHPSGGSYR	699	sp|P38159-2|RBMX_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.7248.2	59.24168	4	1610.6745	1610.6710	R	D	256	270
PSM	NVLCSACSGQGGK	700	sp|O60884|DNJA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29	4-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=1.1.7586.6	68.23472	3	1336.5895	1336.5864	K	S	140	153
PSM	RNVESGEEELASK	701	sp|Q96HS1|PGAM5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.7593.10	68.43069	3	1446.6991	1446.6950	K	L	76	89
PSM	LSLHEEEGSSGSEQK	702	sp|Q12955|ANK3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.7615.11	69.02192	3	1615.7368	1615.7325	R	Q	4341	4356
PSM	AEAGPEGVAPAPEGEKK	703	sp|Q9Y4L1|HYOU1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.7499.11	65.90855	3	1635.8143	1635.8104	K	Q	670	687
PSM	AQEQQQQMAELHSK	704	sp|Q9P2E9|RRBP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.7586.8	68.23805	3	1654.7749	1654.7733	K	L	908	922
PSM	HLIPAANTGESK	705	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.7503.5	66.00453	3	1236.6520	1236.6462	K	V	107	119
PSM	NSVQTPVENSTNSQHQVK	706	sp|Q9UHI6|DDX20_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.7378.11	62.64537	3	1995.9616	1995.9610	K	E	548	566
PSM	TTTAAAVASTGPSSR	707	sp|P27816-6|MAP4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.7418.11	63.7269	2	1376.6896	1376.6896	K	S	810	825
PSM	FSPGAPGGSGSQPNQK	708	sp|Q15942|ZYX_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.7506.11	66.09328	2	1514.7120	1514.7114	K	L	280	296
PSM	RLQSIGTENTEENR	709	sp|P04075-2|ALDOA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.7591.10	68.37655	3	1645.8064	1645.8019	K	R	97	111
PSM	NSLQEQQEEEEEARK	710	sp|P35580-3|MYH10_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.7632.11	69.48061	3	1845.8374	1845.8340	K	N	1367	1382
PSM	NCPHVVVGTPGR	711	sp|O00148|DX39A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29	2-UNIMOD:4	ms_run[1]:scan=1.1.7788.5	73.547	3	1291.6492	1291.6456	K	I	163	175
PSM	SDKPNASDPSVPLK	712	sp|Q9BQP7|MGME1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.8008.7	79.28052	3	1453.7419	1453.7413	R	I	109	123
PSM	HSHTNLSISTGVTK	713	sp|Q5T7N2|LITD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.7850.6	75.1513	3	1480.7626	1480.7634	K	L	572	586
PSM	HVGDLGNVTADK	714	sp|P00441|SODC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.8065.10	80.80836	2	1224.6104	1224.6099	R	D	81	93
PSM	STESLQANVQR	715	sp|P26373|RL13_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.7826.10	74.54475	2	1231.6168	1231.6157	K	L	106	117
PSM	HQVEQLSSSLK	716	sp|Q14980-2|NUMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.8070.10	80.94043	2	1254.6534	1254.6568	R	Q	551	562
PSM	YLAEVAAGDDKK	717	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.7893.3	76.27827	3	1278.6469	1278.6456	R	G	128	140
PSM	EAMEDGEIDGNK	718	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.7874.10	75.78982	2	1306.5350	1306.5347	K	V	628	640
PSM	IETNENNLESAK	719	sp|Q07065|CKAP4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.7734.11	72.18961	2	1360.6450	1360.6470	K	G	567	579
PSM	SEDDESGAGELTR	720	sp|P33993|MCM7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.7747.8	72.50277	2	1364.5690	1364.5692	K	E	309	322
PSM	AAFTECCQAADK	721	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29	6-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=1.1.7882.4	75.99247	3	1370.5603	1370.5595	K	A	187	199
PSM	AAFTECCQAADK	722	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29	6-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=1.1.7895.4	76.32775	3	1370.5603	1370.5595	K	A	187	199
PSM	AAFTECCQAADK	723	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29	6-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=1.1.7914.10	76.82553	2	1370.5614	1370.5595	K	A	187	199
PSM	AQAAAPASVPAQAPK	724	sp|P47914|RL29_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.7880.11	75.95158	2	1376.7416	1376.7412	K	R	135	150
PSM	DLAEVGEGGGHSQAR	725	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.7716.11	71.71864	2	1481.6852	1481.6859	K	E	1237	1252
PSM	TADDSATSDYCPAPK	726	sp|Q9UBC3-2|DNM3B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29	11-UNIMOD:4	ms_run[1]:scan=1.1.7871.11	75.71082	2	1597.6576	1597.6566	R	R	363	378
PSM	VDNSSLTGESEPQTR	727	sp|P05023-4|AT1A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.7995.9	78.95264	2	1618.7428	1618.7435	K	S	213	228
PSM	EKEDAQEVELQEGK	728	sp|Q02952-2|AKA12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.7943.11	77.58833	2	1630.7680	1630.7686	K	V	1639	1653
PSM	EINSDQATQGNISSDR	729	sp|Q29RF7|PDS5A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.7973.11	78.38707	2	1733.7862	1733.7816	K	G	1220	1236
PSM	DQTPDENDQVVVK	730	sp|O00425|IF2B3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.8296.7	86.77807	3	1485.6946	1485.6947	R	I	526	539
PSM	HTGPNSPDTANDGFVR	731	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.8446.11	90.76555	3	1683.7552	1683.7601	K	L	99	115
PSM	AGGPATPLSPTR	732	sp|Q03252|LMNB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.8168.7	83.46938	2	1123.5986	1123.5986	R	L	29	41
PSM	CGFCHVGEEENEAR	733	sp|Q8IWS0-3|PHF6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29	1-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=1.1.8342.10	88.00475	3	1692.6601	1692.6620	K	G	211	225
PSM	IGNTEDGAPHKEDEPSVGQVAR	734	sp|Q9C0C9|UBE2O_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.8381.9	89.04508	4	2305.0905	2305.0935	R	V	662	684
PSM	QQSVAHQQSGSELALR	735	sp|O95235|KI20A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.8396.9	89.44397	3	1737.8722	1737.8758	R	R	660	676
PSM	HFVALSTNTTK	736	sp|P06744-2|G6PI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.8187.10	83.97072	2	1217.6394	1217.6404	K	V	253	264
PSM	FACHSASLTVR	737	sp|Q15233-2|NONO_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29	3-UNIMOD:4	ms_run[1]:scan=1.1.8458.9	91.0844	2	1247.6072	1247.6081	R	N	54	65
PSM	DGGSGNSTIIVSR	738	sp|Q7Z6Z7-2|HUWE1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.8376.10	88.9129	2	1261.6238	1261.6263	R	S	2359	2372
PSM	KIDASQTEFEK	739	sp|O94979-10|SC31A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.8108.10	81.94147	2	1294.6382	1294.6405	K	N	461	472
PSM	NQNSWGTGEDVK	740	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.8426.11	90.22852	2	1333.5870	1333.5899	K	V	517	529
PSM	YICENQDSISSK	741	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29	3-UNIMOD:4	ms_run[1]:scan=1.1.8111.10	82.01628	2	1442.6358	1442.6347	K	L	287	299
PSM	ILTTASSHEFEHTK	742	sp|Q16851|UGPA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.8200.11	84.30375	3	1599.7906	1599.7893	K	K	39	53
PSM	VLTGVAGEDAECHAAK	743	sp|O95373|IPO7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29	12-UNIMOD:4	ms_run[1]:scan=1.1.8164.11	83.37321	2	1626.7724	1626.7672	K	L	725	741
PSM	AGEAPTENPAPPTQQSSAE	744	sp|P16989|YBOX3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.8254.8	85.67677	2	1880.8358	1880.8388	K	-	354	373
PSM	IQHNGNCQLNEENLSTK	745	sp|Q8WXA9-2|SREK1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29	7-UNIMOD:4	ms_run[1]:scan=1.1.8269.11	86.06382	3	1997.9221	1997.9225	K	T	604	621
PSM	TTHFVEGGDAGNREDQINR	746	sp|P18124|RL7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.8258.11	85.77908	3	2114.9701	2114.9730	K	L	224	243
PSM	QAEVANQETKEDLPAENGETK	747	sp|P05114|HMGN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.8433.11	90.41617	3	2300.0722	2300.0768	K	T	62	83
PSM	QAEVANQETKEDLPAENGETK	748	sp|P05114|HMGN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.8452.11	90.92627	3	2300.0737	2300.0768	K	T	62	83
PSM	APAPKPELIAAEK	749	sp|Q9Y5K6|CD2AP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.8749.5	98.82848	3	1333.7614	1333.7605	K	K	347	360
PSM	TPNTFAVCTEHR	750	sp|Q12756-2|KIF1A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29	8-UNIMOD:4	ms_run[1]:scan=1.1.8696.9	97.40867	3	1431.6565	1431.6565	K	G	1747	1759
PSM	LHYCVSCAIHSK	751	sp|Q5JNZ5|RS26L_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29	4-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=1.1.8798.7	100.152	3	1473.6853	1473.6857	K	V	71	83
PSM	ENEVEEVKEEGPK	752	sp|Q8NC51-3|PAIRB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.8550.9	93.52602	3	1514.7100	1514.7100	K	E	259	272
PSM	AAGIDEQENWHEGK	753	sp|P28838-2|AMPL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.8830.8	101.0142	3	1582.7008	1582.7012	K	E	74	88
PSM	ERSPEVLSGGEDGAVR	754	sp|Q86W42-3|THOC6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.8803.6	100.2853	3	1656.8026	1656.8067	R	L	178	194
PSM	AVLIAGQPGTGK	755	sp|Q9Y230-2|RUVB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.8672.9	96.76096	2	1110.6392	1110.6397	R	T	27	39
PSM	FATHAAALSVR	756	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.8814.4	100.5789	3	1142.6212	1142.6196	R	N	366	377
PSM	VCDSCYDSIKDEDR	757	sp|Q8IWB7|WDFY1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29	2-UNIMOD:4,5-UNIMOD:4	ms_run[1]:scan=1.1.8755.6	98.99243	3	1760.6935	1760.6982	R	T	343	357
PSM	GPVKPTGGPGGGGTQTQQQMNQLK	758	sp|P26196|DDX6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.8654.7	96.2754	4	2365.1773	2365.1809	R	N	23	47
PSM	QELSHALYQHDAACR	759	sp|Q9UMS4|PRP19_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29	14-UNIMOD:4	ms_run[1]:scan=1.1.8711.10	97.81405	3	1797.8179	1797.8216	R	V	101	116
PSM	GSSGGSGAKPSDAASEAARPATSTLNR	760	sp|Q04637-3|IF4G1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.8692.9	97.30067	4	2502.2005	2502.2058	K	F	1056	1083
PSM	EDLPAENGETKTEESPASDEAGEK	761	sp|P05114|HMGN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.8560.11	93.79902	4	2532.0969	2532.0987	K	E	72	96
PSM	NCPHIVVGTPGR	762	sp|Q13838-2|DX39B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29	2-UNIMOD:4	ms_run[1]:scan=1.1.8531.5	93.00943	3	1305.6610	1305.6612	K	I	179	191
PSM	EYSSELNAPSQESDSHPR	763	sp|P49756|RBM25_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.8605.8	94.96095	3	2031.8755	2031.8770	R	K	217	235
PSM	SPPPELTDTATSTK	764	sp|P46013|KI67_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.8616.8	95.25558	3	1443.7072	1443.7093	K	R	2588	2602
PSM	EFHLNESGDPSSK	765	sp|Q01105|SET_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.8821.11	100.7795	2	1445.6390	1445.6423	K	S	155	168
PSM	GDATVSYEDPPTAK	766	sp|Q01844-3|EWS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.8737.11	98.51447	2	1449.6600	1449.6624	K	A	410	424
PSM	SSQSSSQQFSGIGR	767	sp|Q92841-3|DDX17_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.8723.11	98.13708	2	1454.6720	1454.6750	R	S	594	608
PSM	HELQANCYEEVK	768	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29	7-UNIMOD:4	ms_run[1]:scan=1.1.8537.6	93.1713	3	1518.6772	1518.6773	K	D	133	145
PSM	NLQEGNEVDSQSSIR	769	sp|O75152|ZC11A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.8736.11	98.4874	2	1674.7762	1674.7809	K	T	522	537
PSM	GAVAEDGDELRTEPEAK	770	sp|P27695|APEX1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.8582.11	94.37347	2	1785.8336	1785.8381	K	K	8	25
PSM	SCVEEPEPEPEAAEGDGDK	771	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29	2-UNIMOD:4	ms_run[1]:scan=1.1.8824.11	100.8602	2	2043.8188	2043.8215	K	K	107	126
PSM	ILEQEEEEEQAGKPGEPSK	772	sp|Q9BXP5-2|SRRT_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.8766.11	99.29785	3	2125.9972	2126.0015	R	K	267	286
PSM	QQREDITQSAQHALR	773	sp|Q12906-7|ILF3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.8856.6	101.6892	4	1779.9257	1779.8976	R	L	309	324
PSM	QQREDITQSAQHALR	774	sp|Q12906-7|ILF3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.8857.7	101.7175	4	1779.9257	1779.8976	R	L	309	324
PSM	RPAEDMEEEQAFK	775	sp|P61978-2|HNRPK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.9163.6	109.7703	3	1578.6973	1578.6984	K	R	22	35
PSM	HITTISDETSEQVTR	776	sp|Q06546|GABPA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.9023.8	106.0876	3	1715.8285	1715.8326	K	W	151	166
PSM	KPNVGCQQDSEELLK	777	sp|A0AVT1|UBA6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29	6-UNIMOD:4	ms_run[1]:scan=1.1.9058.10	107.0267	3	1743.8515	1743.8461	R	L	342	357
PSM	FAAATGATPIAGR	778	sp|P08865|RSSA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.9166.11	109.8596	2	1202.6390	1202.6408	K	F	90	103
PSM	HPGSFDVVHVK	779	sp|P62701|RS4X_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.8963.4	104.4882	3	1220.6317	1220.6302	R	D	201	212
PSM	TPAQYDASELK	780	sp|P07355-2|ANXA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.8886.10	102.4797	2	1221.5854	1221.5877	K	A	123	134
PSM	LFVSGACDASAK	781	sp|P62873-2|GBB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29	7-UNIMOD:4	ms_run[1]:scan=1.1.9058.11	107.0283	2	1224.5778	1224.5809	R	L	198	210
PSM	TPVEPEVAIHR	782	sp|P60866-2|RS20_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.9059.5	107.0451	3	1246.6684	1246.6670	K	I	9	20
PSM	SSLEDGCLSCGR	783	sp|Q9UBC3-2|DNM3B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29	7-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.8966.10	104.5787	2	1339.5462	1339.5497	K	K	409	421
PSM	SSLEDGCLSCGR	784	sp|Q9UBC3-2|DNM3B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29	7-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.8947.10	104.0694	2	1339.5462	1339.5497	K	K	409	421
PSM	TNLDESDVQPVK	785	sp|Q9Y3I0|RTCB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.8893.5	102.6608	2	1343.6536	1343.6569	R	E	129	141
PSM	VQIAANEETQEREEQMK	786	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.8909.9	103.0706	3	2031.9514	2031.9531	K	E	456	473
PSM	LLATEQEDAAVAK	787	sp|Q9P2E9|RRBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.9009.10	105.7171	2	1357.7072	1357.7089	K	S	708	721
PSM	YELISETGGSHDK	788	sp|Q12906-7|ILF3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.8941.4	103.8988	3	1434.6622	1434.6627	K	R	545	558
PSM	YELISETGGSHDK	789	sp|Q12906-7|ILF3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.8936.6	103.7686	3	1434.6622	1434.6627	K	R	545	558
PSM	YELISETGGSHDK	790	sp|Q12906-7|ILF3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.8933.4	103.6855	3	1434.6622	1434.6627	K	R	545	558
PSM	YELISETGGSHDK	791	sp|Q12906-7|ILF3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.8940.8	103.8789	3	1434.6622	1434.6627	K	R	545	558
PSM	YELISETGGSHDK	792	sp|Q12906-7|ILF3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.8937.7	103.7969	3	1434.6622	1434.6627	K	R	545	558
PSM	YELISETGGSHDK	793	sp|Q12906-7|ILF3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.8943.8	103.9588	3	1434.6622	1434.6627	K	R	545	558
PSM	YELISETGGSHDK	794	sp|Q12906-7|ILF3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.8938.6	103.8221	3	1434.6622	1434.6627	K	R	545	558
PSM	ELAGHTGYLSCCR	795	sp|P62873-2|GBB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29	11-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.8970.6	104.6795	3	1522.6651	1522.6657	R	F	138	151
PSM	AISSASSPQSPGDALR	796	sp|Q96KR1|ZFR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.9145.11	109.295	2	1542.7574	1542.7638	K	R	954	970
PSM	DINAYNCEEPTEK	797	sp|P30041|PRDX6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29	7-UNIMOD:4	ms_run[1]:scan=1.1.8993.11	105.2938	2	1581.6594	1581.6617	K	L	85	98
PSM	LGEVVNTHGPVEPDK	798	sp|P30419|NMT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.9079.7	107.5777	3	1589.8042	1589.8049	K	D	128	143
PSM	LNDMASTDDGTLQSR	799	sp|Q9H6Z4-2|RANB3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.9152.11	109.4831	2	1622.7130	1622.7206	R	L	423	438
PSM	NADGTICYDSTHYK	800	sp|P14550|AK1A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29	7-UNIMOD:4	ms_run[1]:scan=1.1.9121.7	108.6669	3	1643.6860	1643.6886	K	E	128	142
PSM	EEGETADTVGCCSLR	801	sp|P11387|TOP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29	11-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.9004.10	105.5835	2	1682.6852	1682.6876	K	V	494	509
PSM	CLDCQEHLCDNCVR	802	sp|Q2Q1W2|LIN41_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29	1-UNIMOD:4,4-UNIMOD:4,9-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.9013.9	105.8221	3	1877.7253	1877.7277	R	A	212	226
PSM	LYKEELEQTYHAK	803	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.9365.6	115.121	4	1650.8297	1650.8253	R	L	259	272
PSM	IRYESLTDPSK	804	sp|P07900-2|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.9341.4	114.4851	3	1307.6773	1307.6721	K	L	181	192
PSM	AHSSMVGVNLPQK	805	sp|P00558|PGK1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.9453.5	117.4768	3	1366.7017	1366.7027	R	A	172	185
PSM	IVHLQETCDLGK	806	sp|Q9BYT8|NEUL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29	8-UNIMOD:4	ms_run[1]:scan=1.1.9478.6	118.1527	3	1411.7140	1411.7130	R	I	146	158
PSM	LESGMQNMSIHTK	807	sp|P05787-2|K2C8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.9228.4	111.4968	3	1474.6879	1474.6908	R	T	430	443
PSM	IVAERPGTNSTGPAPMAPPR	808	sp|Q13263-2|TIF1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.9345.6	114.5928	4	2018.0357	2018.0367	K	A	326	346
PSM	ITGHFYACQVAQR	809	sp|O00425|IF2B3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29	8-UNIMOD:4	ms_run[1]:scan=1.1.9535.8	119.6871	3	1549.7437	1549.7460	K	K	539	552
PSM	DPDASKPEDWDER	810	sp|P27797|CALR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.9216.9	111.183	3	1558.6528	1558.6536	K	A	210	223
PSM	DVACGANHTLVLDSQKR	811	sp|Q9P258|RCC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29	4-UNIMOD:4	ms_run[1]:scan=1.1.9217.9	111.2095	3	1882.9261	1882.9319	R	V	334	351
PSM	SVSLTGAPESVQK	812	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.9288.10	113.0865	2	1301.6774	1301.6827	R	A	191	204
PSM	YANEVNSDAGAFK	813	sp|Q9UHB9|SRP68_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.9364.11	115.1027	2	1384.6228	1384.6259	K	N	492	505
PSM	IVHLQETCDLGK	814	sp|Q9BYT8|NEUL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29	8-UNIMOD:4	ms_run[1]:scan=1.1.9497.6	118.6635	3	1411.7140	1411.7130	R	I	146	158
PSM	LAQAAQSSVATITR	815	sp|Q9Y490|TLN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.9432.10	116.9184	2	1415.7670	1415.7732	K	L	2044	2058
PSM	YYASEIAGQTTSK	816	sp|P45954|ACDSB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.9263.11	112.4319	2	1417.6696	1417.6725	K	C	372	385
PSM	KATDAEADVASLNR	817	sp|P09493-3|TPM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.9285.11	113.0079	2	1459.7224	1459.7267	K	R	77	91
PSM	LSSQEAASSFGDDR	818	sp|P05165|PCCA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.9459.11	117.6489	2	1468.6414	1468.6430	R	L	244	258
PSM	LTDCVVMRDPASK	819	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29	4-UNIMOD:4	ms_run[1]:scan=1.1.9446.8	117.2927	3	1490.7217	1490.7221	K	R	35	48
PSM	GLSSDNKPMVNLDK	820	sp|P82979|SARNP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.9467.11	117.8645	2	1516.7494	1516.7555	K	L	136	150
PSM	QLSAQSYGVTSSTAR	821	sp|P49790-3|NU153_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.9373.10	115.3418	2	1554.7606	1554.7638	K	R	295	310
PSM	TPDTSTYCYETAEK	822	sp|P46821|MAP1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29	8-UNIMOD:4	ms_run[1]:scan=1.1.9217.11	111.2129	2	1664.6812	1664.6876	R	I	2034	2048
PSM	LGTEPTSETQDELQR	823	sp|O15381|NVL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.9260.10	112.3524	2	1702.7980	1702.8010	R	L	516	531
PSM	VHPEIINENGNPSYK	824	sp|O95881|TXD12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.9316.8	113.8362	3	1709.8318	1709.8373	K	Y	124	139
PSM	TNCCDQCGAYIYTK	825	sp|Q14202|ZMYM3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29	3-UNIMOD:4,4-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=1.1.9394.11	115.9094	2	1752.6838	1752.6906	K	T	448	462
PSM	DGSDEPGTAACPNGSFHCTNTGYK	826	sp|P14314-2|GLU2B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29	11-UNIMOD:4,18-UNIMOD:4	ms_run[1]:scan=1.1.9374.11	115.3703	3	2542.0030	2542.0125	K	P	60	84
PSM	HALLEADVAAHQDR	827	sp|Q13813|SPTN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.8783.8	99.75075	3	1544.7685	1544.7695	K	I	720	734
PSM	CGAALAGHQLIR	828	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29	1-UNIMOD:4	ms_run[1]:scan=1.1.9420.7	116.5953	3	1265.6698	1265.6663	R	G	25	37
PSM	FGQGGAGPVGGQGPR	829	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.8218.8	84.7626	2	1340.6560	1340.6586	R	G	667	682
PSM	ILTTASSHEFEHTK	830	sp|Q16851|UGPA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.8220.6	84.8102	3	1599.7906	1599.7893	K	K	39	53
PSM	LQSIGTENTEENR	831	sp|P04075-2|ALDOA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.7919.11	76.95982	2	1489.7022	1489.7008	R	R	98	111
PSM	AGLESGAEPGDGDSDTTKK	832	sp|O60832|DKC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.7313.11	60.92245	3	1833.8209	1833.8228	K	K	481	500
PSM	SEAHTADGISIR	833	sp|P49916-3|DNLI3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.8104.3	81.82568	3	1255.6225	1255.6157	K	F	705	717
PSM	NDAPLHEINGDHLK	834	sp|O75487|GPC4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.9172.8	110.0164	3	1571.7613	1571.7692	K	I	45	59
PSM	HTGPNSPDTANDGFVR	835	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.8374.2	88.8457	4	1683.7621	1683.7601	K	L	99	115
PSM	TPEAVESPQEASGVR	836	sp|Q7L190|DPPA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.8694.8	97.35285	3	1555.7602	1555.7478	R	W	215	230
PSM	EELQANGSAPAADKEEPAAAGSGAASPSAAEK	837	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.9090.11	107.8726	4	2982.361694	2981.385017	K	G	56	88
PSM	QSNASSDVEVEEK	838	sp|O75475|PSIP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	29	1-UNIMOD:28	ms_run[1]:scan=1.1.8259.7	85.80463	2	1403.6015	1403.6047	K	E	101	114
PSM	CGETGHVAINCSK	839	sp|P62633|CNBP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	29	1-UNIMOD:385,1-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=1.1.8460.9	91.13811	2	1414.5925	1414.5964	R	T	140	153
PSM	GSVSNQQFAGGCAK	840	sp|Q9H9Z2|LN28A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	29	1-UNIMOD:1,12-UNIMOD:4	ms_run[1]:scan=1.1.8949.11	104.1245	2	1451.6423	1451.6458	M	A	2	16
PSM	VIGSGCNLDSAR	841	sp|Q6ZMR3|LDH6A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29	6-UNIMOD:4	ms_run[1]:scan=1.1.8327.10	87.60913	2	1248.592047	1247.592835	R	F	158	170
PSM	VIGSGCNLDSAR	842	sp|Q6ZMR3|LDH6A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29	6-UNIMOD:4	ms_run[1]:scan=1.1.8346.11	88.11217	2	1248.592047	1247.592835	R	F	158	170
PSM	SETAPAAPAAPAPAEK	843	sp|P10412|H14_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	29	1-UNIMOD:1	ms_run[1]:scan=1.1.9040.11	106.5473	2	1519.7487	1519.7513	M	T	2	18
PSM	EDLPAENGETKTEESPASDEAGEK	844	sp|P05114|HMGN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.8798.11	100.1587	3	2533.075871	2532.098731	K	E	72	96
PSM	AAGGDHGSPDSYR	845	sp|P30566|PUR8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	29	1-UNIMOD:1	ms_run[1]:scan=1.1.7536.11	66.89616	2	1330.5553	1330.5533	M	S	2	15
PSM	AHQTGIHATEELK	846	sp|Q6IBS0|TWF2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	29	1-UNIMOD:1	ms_run[1]:scan=1.1.8329.9	87.66051	3	1475.7355	1475.7363	M	E	2	15
PSM	AEASSANLGSGCEEK	847	sp|Q6P1K2|PMF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	29	1-UNIMOD:1,12-UNIMOD:4	ms_run[1]:scan=1.1.8594.11	94.68052	2	1550.6515	1550.6513	M	R	2	17
PSM	FATHAAALSVR	848	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.8833.2	101.0822	3	1144.636571	1142.619642	R	N	366	377
PSM	PVSSAASVYAGAGGSGSR	849	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.8962.11	104.4728	2	1579.755247	1579.759048	R	I	28	46
PSM	APGTPHSHTKPYVR	850	sp|Q07020-2|RL18_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.6893.2	49.74103	4	1546.8061	1546.8005	K	S	126	140
PSM	YHTVNGHNCEVR	851	sp|P09651-2|ROA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28	9-UNIMOD:4	ms_run[1]:scan=1.1.6935.11	50.88547	2	1484.6610	1484.6579	K	K	167	179
PSM	THKPDPGTPQHTSSRPPEPQK	852	sp|Q9UDY2|ZO2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.6827.7	47.98058	5	2321.1591	2321.1513	K	A	1124	1145
PSM	KPHVVTVAGENR	853	sp|Q7KZ85|SPT6H_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.7046.6	53.8057	3	1305.7168	1305.7153	K	D	844	856
PSM	SQRPEESEPLEK	854	sp|Q5TFE4-2|NT5D1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.7212.7	58.3139	3	1427.6905	1427.6892	R	K	295	307
PSM	VTHLVANCTQGEK	855	sp|Q9H8V3-3|ECT2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28	8-UNIMOD:4	ms_run[1]:scan=1.1.7189.8	57.69578	3	1455.7168	1455.7140	K	F	214	227
PSM	TDNAGDQHGGGGGGGGGAGAAGGGGGGENYDDPHK	856	sp|P14866|HNRPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.7099.9	55.24045	6	2980.2025	2980.1953	K	T	63	98
PSM	EDSQRPGAHLTVK	857	sp|P09651-2|ROA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.7278.5	60.02118	4	1436.7433	1436.7372	R	K	93	106
PSM	RLQQQQRPEDAEDGAEGGGK	858	sp|Q08J23|NSUN2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.7017.11	53.02234	4	2168.0261	2168.0206	R	R	9	29
PSM	ATCAPQHGAPGPGPADASK	859	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28	3-UNIMOD:4	ms_run[1]:scan=1.1.7039.11	53.62192	3	1788.8260	1788.8213	K	V	2533	2552
PSM	TDNAGDQHGGGGGGGGGAGAAGGGGGGENYDDPHK	860	sp|P14866|HNRPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.7115.11	55.68044	5	2980.2016	2980.1953	K	T	63	98
PSM	HLVYESDQNK	861	sp|O43852-2|CALU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.7258.9	59.51451	2	1231.5848	1231.5833	R	D	272	282
PSM	ALVADSHPESER	862	sp|Q01082-2|SPTB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.7276.8	59.97467	2	1309.6274	1309.6262	R	I	1657	1669
PSM	TVEAEAAHGTVTR	863	sp|O75874|IDHC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.7273.7	59.89643	3	1340.6722	1340.6684	K	H	302	315
PSM	GPAAAQGSAAAPAEPK	864	sp|Q9UHD9|UBQL2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.7174.11	57.29188	2	1392.7018	1392.6997	R	I	16	32
PSM	EEASGSSVTAEEAK	865	sp|P13010|XRCC5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.7078.11	54.68797	2	1393.6198	1393.6209	K	K	689	703
PSM	LESCGVTSDNCR	866	sp|P13489|RINI_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28	4-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=1.1.7271.8	59.85218	2	1396.5708	1396.5711	K	D	206	218
PSM	YEPAAVSEQGDKK	867	sp|P05023-4|AT1A1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.7214.11	58.37494	2	1420.6818	1420.6834	K	G	10	23
PSM	MGGEEKPIGAGEEK	868	sp|P26639-2|SYTC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.7199.8	57.9686	3	1430.6710	1430.6711	K	Q	13	27
PSM	CGETGHVAINCSK	869	sp|P62633-2|CNBP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28	1-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=1.1.7187.11	57.64639	2	1431.6240	1431.6235	R	T	133	146
PSM	FSTYTSDKDENK	870	sp|Q8WU90|ZC3HF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.7270.10	59.82672	2	1433.6324	1433.6310	R	L	355	367
PSM	HECQANGPEDLNR	871	sp|P60981-2|DEST_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28	3-UNIMOD:4	ms_run[1]:scan=1.1.7268.11	59.77583	2	1538.6550	1538.6532	K	A	116	129
PSM	NQGGYGGSSSSSSYGSGR	872	sp|P09651-2|ROA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.7304.5	60.69045	3	1693.6939	1693.6928	R	R	301	319
PSM	TLASSSSSSSSSSGAETPK	873	sp|Q9Y467|SALL2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.6968.11	51.77322	2	1756.7994	1756.7963	K	Q	253	272
PSM	AEASSGDHPTDTEMKEEQK	874	sp|Q02790|FKBP4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.6973.10	51.90502	3	2088.8950	2088.8906	K	S	427	446
PSM	GAFGKPQGTVAR	875	sp|P27635|RL10_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.7427.3	63.95757	3	1187.6443	1187.6411	R	V	117	129
PSM	AIQGGTSHHLGQNFSK	876	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.7663.8	70.3104	4	1680.8365	1680.8332	R	M	1235	1251
PSM	ILTTASSHEFEHTKK	877	sp|Q16851|UGPA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.7651.5	69.98247	4	1727.8861	1727.8842	K	D	39	54
PSM	RELHGQNPVVTPCNK	878	sp|Q16630-2|CPSF6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28	13-UNIMOD:4	ms_run[1]:scan=1.1.7385.8	62.82942	4	1747.8821	1747.8788	K	Q	147	162
PSM	KVEEEEDESALK	879	sp|Q14566|MCM6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.7405.6	63.36672	3	1404.6616	1404.6620	R	R	733	745
PSM	AAAAAAALQAK	880	sp|P36578|RL4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.7495.10	65.80117	2	955.5460	955.5450	K	S	354	365
PSM	RNVESGEEELASK	881	sp|Q96HS1|PGAM5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.7602.6	68.6676	3	1446.6991	1446.6950	K	L	76	89
PSM	VMSQNFTNCHTK	882	sp|Q13283|G3BP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28	9-UNIMOD:4	ms_run[1]:scan=1.1.7662.8	70.28387	3	1465.6492	1465.6442	K	I	65	77
PSM	RQLEEAEEEAQR	883	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.7656.8	70.12248	3	1486.7023	1486.7011	K	A	1877	1889
PSM	AVSEEQQPALK	884	sp|Q8NE71-2|ABCF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.7548.9	67.21529	2	1198.6210	1198.6193	K	G	164	175
PSM	KIVNSAQTGSFK	885	sp|O75964|ATP5L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.7538.11	66.94994	2	1278.6896	1278.6932	K	Q	55	67
PSM	RALANSLACQGK	886	sp|P04075-2|ALDOA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28	9-UNIMOD:4	ms_run[1]:scan=1.1.7561.10	67.56699	2	1287.6716	1287.6717	K	Y	385	397
PSM	EDGSGDRGDGPFR	887	sp|P13010|XRCC5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.7647.5	69.87445	3	1363.5784	1363.5753	K	L	172	185
PSM	EDGSGDRGDGPFR	888	sp|P13010|XRCC5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.7609.6	68.85271	3	1363.5799	1363.5753	K	L	172	185
PSM	IISSIEQKEENK	889	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.7701.9	71.31432	2	1416.7446	1416.7460	R	G	62	74
PSM	SSPSVKPAVDPAAAK	890	sp|Q6FI81-3|CPIN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.7652.9	70.0161	3	1423.7704	1423.7671	K	L	169	184
PSM	VEQATKPSFESGR	891	sp|P38159-2|RBMX_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.7597.8	68.53592	3	1434.7150	1434.7103	K	R	68	81
PSM	YVLHCQGTEEEK	892	sp|P62495-2|ERF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28	5-UNIMOD:4	ms_run[1]:scan=1.1.7597.9	68.53758	3	1491.6694	1491.6664	R	I	298	310
PSM	TIIGQQGDQSCANK	893	sp|P35251-2|RFC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28	11-UNIMOD:4	ms_run[1]:scan=1.1.7464.11	64.97237	2	1518.7146	1518.7097	K	L	597	611
PSM	TVAQSQQLETNSQR	894	sp|P40938-2|RFC3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.7410.11	63.5104	2	1588.7772	1588.7805	K	D	114	128
PSM	KIIEDCSNSEETVK	895	sp|Q93008-1|USP9X_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28	6-UNIMOD:4	ms_run[1]:scan=1.1.7584.10	68.18733	3	1650.7768	1650.7770	K	L	2288	2302
PSM	TLSTSDDVEDRENEK	896	sp|Q96A65|EXOC4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.7572.10	67.86307	3	1736.7706	1736.7701	R	G	30	45
PSM	ERNTDQASMPENTVAQK	897	sp|P35580-3|MYH10_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.7657.11	70.15456	3	1917.8851	1917.8850	K	L	364	381
PSM	KPLTSSSAAPQRPISTQR	898	sp|Q15691|MARE1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.7463.11	64.94518	3	1924.0507	1924.0490	K	T	151	169
PSM	SVSTPSEAGSQDSGDGAVGSR	899	sp|Q13409-2|DC1I2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.7705.11	71.42478	2	1949.8582	1949.8563	K	T	86	107
PSM	TIEAEAAHGTVTR	900	sp|P48735|IDHP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.7769.7	73.05852	3	1354.6837	1354.6841	K	H	341	354
PSM	RQLEEAEEEATR	901	sp|P35580-3|MYH10_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.7879.9	75.92187	3	1459.6915	1459.6902	K	A	1905	1917
PSM	AAHSEGNTTAGLDMR	902	sp|P78371|TCPB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.7903.11	76.54542	3	1529.6929	1529.6892	R	E	467	482
PSM	QEYDESGPSIVHRK	903	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.7966.10	78.20018	3	1643.7913	1643.7903	K	C	360	374
PSM	EKLEQNPEESQDIK	904	sp|Q01860|PO5F1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.7799.10	73.8386	3	1685.8120	1685.8108	K	A	127	141
PSM	VSGAQEMVSSAK	905	sp|O60664-4|PLIN3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.8063.11	80.75695	2	1192.5748	1192.5758	K	D	117	129
PSM	SEETLDEGPPK	906	sp|Q00688|FKBP3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.7834.10	74.74872	2	1200.5514	1200.5510	K	Y	100	111
PSM	DGEEAGAYDGPR	907	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.8041.11	80.16452	2	1235.5052	1235.5054	R	T	108	120
PSM	NMSVIAHVDHGK	908	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.7982.9	78.61716	2	1306.6454	1306.6452	R	S	21	33
PSM	MDSTANEVEAVK	909	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28	1-UNIMOD:35	ms_run[1]:scan=1.1.7924.11	77.09347	2	1308.5862	1308.5867	K	V	425	437
PSM	EAQELSQNSAIK	910	sp|Q9NR30|DDX21_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.7867.11	75.60397	2	1316.6572	1316.6572	K	Q	450	462
PSM	LMELHGEGSSSGK	911	sp|P61247|RS3A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.7777.8	73.26904	3	1330.6213	1330.6187	K	A	228	241
PSM	AQAAAPASVPAQAPK	912	sp|P47914|RL29_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.7861.11	75.44424	2	1376.7416	1376.7412	K	R	135	150
PSM	KGTVEGFEPADNK	913	sp|P37108|SRP14_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.8048.6	80.34499	3	1390.6771	1390.6729	K	C	43	56
PSM	ASMQQQQQLASAR	914	sp|Q9Y3Y2-3|CHTOP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.7754.11	72.68115	2	1445.7040	1445.7045	R	N	39	52
PSM	HEQNIDCGGGYVK	915	sp|P27797|CALR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28	7-UNIMOD:4	ms_run[1]:scan=1.1.7801.7	73.8837	3	1475.6488	1475.6463	K	L	99	112
PSM	KYEEIDNAPEER	916	sp|P49411|EFTU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.7946.11	77.66624	2	1491.6830	1491.6841	K	A	91	103
PSM	SSQTSGTNEQSSAIVSAR	917	sp|O60763-2|USO1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.7891.11	76.23697	3	1808.8537	1808.8500	K	D	776	794
PSM	PIHQGPDAAVTGHIR	918	sp|P53618|COPB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.8178.7	83.73296	4	1567.8257	1567.8219	K	I	914	929
PSM	ILTTASSHEFEHTK	919	sp|Q16851|UGPA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.8214.6	84.65235	4	1599.7917	1599.7893	K	K	39	53
PSM	TAIHEVMEQGR	920	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.8401.5	89.56715	3	1269.6172	1269.6136	R	V	420	431
PSM	LDDHALTGASDSR	921	sp|Q12788|TBL3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.8299.8	86.85903	3	1356.6265	1356.6270	R	V	616	629
PSM	LREDENAEPVGTTYQK	922	sp|Q16643-2|DREB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.8139.3	82.72145	4	1848.8873	1848.8853	R	T	152	168
PSM	NEEPSEEEIDAPKPK	923	sp|Q9NR30|DDX21_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.8433.9	90.41283	3	1710.7927	1710.7948	K	K	117	132
PSM	LGIKPESVQPHRPTTNPNTSK	924	sp|Q16527|CSRP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.8324.10	87.52928	4	2300.2217	2300.2237	R	F	88	109
PSM	TQTPPVSPAPQPTEER	925	sp|Q14247|SRC8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.8424.9	90.17146	3	1733.8549	1733.8584	K	L	399	415
PSM	KASSEGGTAAGAGLDSLHK	926	sp|O15143|ARC1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.8174.9	83.62952	3	1755.8728	1755.8751	K	N	308	327
PSM	LEGNTVGVEAAR	927	sp|P46060|RAGP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.8135.10	82.62788	2	1214.6244	1214.6255	R	V	56	68
PSM	QGGGGGGGSVPGIER	928	sp|P52272-2|HNRPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.8090.11	81.47601	2	1283.6218	1283.6219	K	M	350	365
PSM	SHFVAASLSNQK	929	sp|Q86XP3|DDX42_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.8187.11	83.97238	2	1287.6566	1287.6571	K	A	709	721
PSM	TIDEGDADEVTK	930	sp|Q7LBC6|KDM3B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.8133.11	82.57858	2	1291.5794	1291.5780	K	Q	1589	1601
PSM	GVDLQENNPASR	931	sp|P51148-2|RAB5C_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.8362.10	88.53715	2	1298.6182	1298.6215	R	S	232	244
PSM	NQNSWGTGEDVK	932	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.8445.10	90.73693	2	1333.5870	1333.5899	K	V	517	529
PSM	FGQGGAGPVGGQGPR	933	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.8248.3	85.51089	3	1340.6575	1340.6586	R	G	667	682
PSM	NNASTDYDLSDK	934	sp|P39023|RL3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.8335.11	87.82377	2	1341.5662	1341.5684	K	S	301	313
PSM	RLAPEYEAAATR	935	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.8360.8	88.4804	3	1346.6944	1346.6942	K	L	62	74
PSM	LHNAIEGGTQLSR	936	sp|O60832|DKC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.8295.6	86.7501	3	1394.7253	1394.7266	R	A	159	172
PSM	DQTPDENDQVVVK	937	sp|O00425|IF2B3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.8285.11	86.49098	2	1485.6930	1485.6947	R	I	526	539
PSM	VEQLGAEGNVEESQK	938	sp|Q9Y383-3|LC7L2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.8379.11	88.99495	2	1615.7646	1615.7689	K	V	137	152
PSM	KHEAFESDLAAHQDR	939	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.8093.9	81.55233	3	1752.8140	1752.8179	K	V	455	470
PSM	LHYCVSCAIHSK	940	sp|Q5JNZ5|RS26L_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28	4-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=1.1.8807.4	100.3898	4	1473.6901	1473.6857	K	V	71	83
PSM	FGVAPDHPEVK	941	sp|P22570-3|ADRO_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.8692.4	97.29235	3	1194.6052	1194.6033	R	N	123	134
PSM	FHHTFSTEIAK	942	sp|P13667|PDIA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.8550.5	93.51935	3	1316.6488	1316.6513	K	F	336	347
PSM	VANVSAAEDSVSQR	943	sp|Q9NY93-2|DDX56_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.8765.5	99.26103	3	1431.6970	1431.6954	R	A	115	129
PSM	KPHTESLELQVR	944	sp|Q9BSJ8|ESYT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.8756.5	99.01788	3	1435.7758	1435.7783	R	G	855	867
PSM	LRSDAGLESDTAMK	945	sp|Q9NR30|DDX21_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.8535.10	93.12442	3	1492.7200	1492.7191	K	K	5	19
PSM	IVIGYQSHADTATK	946	sp|P06730-3|IF4E_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.8815.6	100.6093	3	1502.7697	1502.7729	K	S	213	227
PSM	VASVFANADKGDDEK	947	sp|Q86U86-8|PB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.8631.8	95.6588	3	1564.7347	1564.7369	R	N	1112	1127
PSM	NDIHLDADDPNSADK	948	sp|Q99590|SCAFB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.8567.8	93.98167	3	1638.7120	1638.7121	K	H	1001	1016
PSM	RQAVTNPNNTFYATK	949	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.8673.10	96.78933	3	1723.8652	1723.8642	K	R	107	122
PSM	NSDEADLVPAK	950	sp|P83916|CBX1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.8486.9	91.83244	2	1157.5556	1157.5564	K	E	140	151
PSM	AAHLCAEAALR	951	sp|Q9UQ80|PA2G4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28	5-UNIMOD:4	ms_run[1]:scan=1.1.8536.5	93.14283	3	1181.6017	1181.5975	K	L	145	156
PSM	HIDLVEGDEGR	952	sp|P19367-3|HXK1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.8744.10	98.70182	2	1238.5868	1238.5891	R	M	248	259
PSM	IDEPLEGSEDR	953	sp|P61978-2|HNRPK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.8793.10	100.0229	2	1258.5660	1258.5677	K	I	423	434
PSM	VYIASSSGSTAIK	954	sp|O75368|SH3L1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.8684.11	97.0883	2	1282.6750	1282.6769	R	K	5	18
PSM	ADEASELACPTPK	955	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28	9-UNIMOD:4	ms_run[1]:scan=1.1.8777.11	99.5943	2	1387.6268	1387.6289	K	E	2194	2207
PSM	CVANNQVETLEK	956	sp|P42704|LPPRC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28	1-UNIMOD:4	ms_run[1]:scan=1.1.8755.9	98.99744	2	1403.6676	1403.6715	R	L	930	942
PSM	APGTNVAMASNQAVR	957	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.8635.11	95.7712	2	1485.7262	1485.7358	K	I	1307	1322
PSM	GVEEEEEDGEMRE	958	sp|P62306|RUXF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.8506.11	92.3602	2	1536.5858	1536.5886	R	-	74	87
PSM	SPSPSSPAAVNHHSSSDISPVSNESTSSSPGK	959	sp|O75381-2|PEX14_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.8558.10	93.74361	4	3120.4185	3120.4232	K	E	204	236
PSM	VDNDENEHQLSLR	960	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.8596.9	94.7284	3	1567.7209	1567.7226	K	T	33	46
PSM	VDNDENEHQLSLR	961	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.8576.9	94.21653	3	1567.7209	1567.7226	K	T	33	46
PSM	EDAGDNDDTEGAIGVR	962	sp|Q9H0S4-2|DDX47_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.8778.11	99.62133	2	1632.6814	1632.6863	R	N	377	393
PSM	ALLANQDSGEVQQDPK	963	sp|Q9NP81|SYSM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.8831.11	101.0452	2	1711.8340	1711.8377	R	Y	119	135
PSM	DSEEFGENEEENVHSK	964	sp|Q9NWH9|SLTM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.8613.11	95.18007	3	1877.7523	1877.7551	K	E	125	141
PSM	QRPLTASLQCNSTAQTEK	965	sp|Q9UFW8|CGBP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28	10-UNIMOD:4	ms_run[1]:scan=1.1.8656.9	96.33234	3	2031.9973	2032.0007	K	V	83	101
PSM	SQSSIVPEEEQAANKGEEK	966	sp|Q969G3-2|SMCE1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.8637.9	95.8215	3	2058.9670	2058.9705	R	K	314	333
PSM	AAEAAAAPAESAAPAAGEEPSKEEGEPK	967	sp|P80723|BASP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.8499.11	92.1752	3	2635.2202	2635.2248	K	K	122	150
PSM	KQPPVSPGTALVGSQK	968	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.8842.3	101.3191	4	1592.8885	1592.8886	R	E	31	47
PSM	HPGSFDVVHVK	969	sp|P62701|RS4X_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.8944.4	103.9791	3	1220.6317	1220.6302	R	D	201	212
PSM	VSSVFKDEATVR	970	sp|P46060|RAGP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.9185.5	110.358	3	1336.6921	1336.6987	K	M	476	488
PSM	QQREDITQSAQHALR	971	sp|Q12906-7|ILF3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.8859.4	101.7661	4	1779.9257	1779.8976	R	L	309	324
PSM	YQEGGVESAFHK	972	sp|P40121-2|CAPG_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.9060.5	107.0718	3	1350.6214	1350.6204	K	T	116	128
PSM	ADQDRLDLEER	973	sp|Q14683|SMC1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.8946.8	104.0393	3	1358.6416	1358.6426	K	K	402	413
PSM	ILTGHTQSVTCLR	974	sp|Q9NVX2|NLE1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28	11-UNIMOD:4	ms_run[1]:scan=1.1.9135.7	109.0273	3	1484.7715	1484.7770	R	W	241	254
PSM	ITHQIVDRPGQQTSVIGR	975	sp|O00541-2|PESC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.8991.5	105.2308	4	2004.0849	2004.0865	R	C	368	386
PSM	ELAGHTGYLSCCR	976	sp|P62873-2|GBB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28	11-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.8951.6	104.1699	3	1522.6651	1522.6657	R	F	138	151
PSM	AREILVEESNVQR	977	sp|P60510|PP4C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.9158.8	109.6393	3	1541.8225	1541.8161	K	V	32	45
PSM	IVAPISDSPKPPPQR	978	sp|O95336|6PGL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.9164.8	109.8006	3	1600.8901	1600.8937	K	V	171	186
PSM	LAAIAESGVER	979	sp|P28072|PSB6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.9067.7	107.2616	2	1114.5952	1114.5982	R	Q	210	221
PSM	RQLDTETNLHLNTK	980	sp|P12270|TPR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.9125.6	108.7686	3	1681.8718	1681.8747	K	E	878	892
PSM	DHAVVVGVYRPPPK	981	sp|P22087|FBRL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.8954.4	104.2468	4	1532.8505	1532.8464	R	V	305	319
PSM	FNQTYQLAHGTAEEK	982	sp|Q14166|TTL12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.9093.7	107.9433	3	1735.8145	1735.8165	K	M	173	188
PSM	LEHTAQTYSELQGER	983	sp|O95071-2|UBR5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.9104.8	108.2281	3	1760.8273	1760.8329	K	I	458	473
PSM	QQREDITQSAQHALR	984	sp|Q12906-7|ILF3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.8851.11	101.5657	3	1779.8998	1779.8976	R	L	309	324
PSM	AVENSSTAIGIR	985	sp|P25788-2|PSA3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.8859.7	101.7711	2	1216.6388	1216.6411	K	C	30	42
PSM	MEEESGAPGVPSGNGAPGPK	986	sp|P52272-2|HNRPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.9036.11	106.4402	3	1866.8353	1866.8418	K	G	18	38
PSM	SSTETCYSAIPK	987	sp|O75369-2|FLNB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28	6-UNIMOD:4	ms_run[1]:scan=1.1.9114.11	108.4917	2	1342.6032	1342.6075	R	A	2472	2484
PSM	TNLDESDVQPVK	988	sp|Q9Y3I0|RTCB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.8913.9	103.1709	2	1343.6536	1343.6569	R	E	129	141
PSM	LRAEPDHMVLGK	989	sp|P41252|SYIC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.8835.2	101.1346	4	1364.7241	1364.7234	R	R	892	904
PSM	RQQEQQVPILEK	990	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.9177.8	110.1508	3	1494.8143	1494.8154	R	F	1105	1117
PSM	TSSGDASSLSIEETNK	991	sp|O43290|SNUT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.8944.10	103.9891	2	1624.7402	1624.7428	K	L	110	126
PSM	AQEPESGLSEETQVK	992	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.9127.11	108.8285	2	1630.7648	1630.7686	R	C	4091	4106
PSM	SAAMLGNSEDHTALSR	993	sp|O60749-2|SNX2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.9188.10	110.4452	3	1658.7904	1658.7682	K	A	230	246
PSM	TAENATSGETLEENEAGD	994	sp|Q9UQ80|PA2G4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.8999.11	105.4528	2	1836.7456	1836.7497	K	-	377	395
PSM	MTTETASEDDNFGTAQSNK	995	sp|Q92616|GCN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.9004.9	105.5818	3	2045.8441	2045.8484	K	A	1853	1872
PSM	EDQSILCTGESGAGKTENTK	996	sp|P35580-3|MYH10_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28	7-UNIMOD:4	ms_run[1]:scan=1.1.9047.10	106.7326	3	2123.9632	2123.9641	R	K	170	190
PSM	TLHPAVHAGILAR	997	sp|P31939-2|PUR9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.9219.3	111.2532	4	1354.7881	1354.7833	K	N	66	79
PSM	IDRLDGAHAPELTK	998	sp|O76003|GLRX3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.9444.4	117.2321	4	1534.8117	1534.8103	K	K	97	111
PSM	DAALATALGDKK	999	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.9290.3	113.1288	3	1172.6398	1172.6401	K	S	146	158
PSM	DLEEDHACIPIKK	1000	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28	8-UNIMOD:4	ms_run[1]:scan=1.1.9497.3	118.6585	4	1566.7737	1566.7712	K	S	560	573
PSM	DLEEDHACIPIKK	1001	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28	8-UNIMOD:4	ms_run[1]:scan=1.1.9478.3	118.1477	4	1566.7741	1566.7712	K	S	560	573
PSM	IRYESLTDPSK	1002	sp|P07900-2|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.9361.5	115.0125	3	1307.6773	1307.6721	K	L	181	192
PSM	KAEEELGELEAK	1003	sp|Q9UQE7|SMC3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.9373.4	115.3318	3	1344.6691	1344.6772	R	L	684	696
PSM	KATDAEADVASLNR	1004	sp|P09493-3|TPM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.9286.7	113.0279	3	1459.7269	1459.7267	K	R	77	91
PSM	GVPHPEDDHSQVEGPESLR	1005	sp|Q6P996-5|PDXD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.9492.5	118.5272	4	2083.9517	2083.9559	K	-	743	762
PSM	HGSYEDAVHSGALND	1006	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.9313.5	113.7511	3	1570.6642	1570.6648	K	-	542	557
PSM	MREDYDSVEQDGDEPGPQR	1007	sp|Q9Y5S9|RBM8A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.9347.9	114.6498	4	2221.9197	2221.9182	R	S	50	69
PSM	VVVVTGANTGIGK	1008	sp|Q8TC12|RDH11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.9389.9	115.7714	2	1213.7000	1213.7031	K	E	43	56
PSM	ALVDGPCTQVR	1009	sp|P50914|RL14_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28	7-UNIMOD:4	ms_run[1]:scan=1.1.9219.10	111.2649	2	1214.6050	1214.6078	R	R	36	47
PSM	EGNGTVMGAEIR	1010	sp|P60660-2|MYL6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.9363.10	115.0742	2	1232.5792	1232.5819	K	H	99	111
PSM	TVTQLVAEDGSR	1011	sp|Q9H4I3|TRABD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.9493.9	118.5609	2	1274.6328	1274.6467	R	V	63	75
PSM	ESLTEAEVATEK	1012	sp|P18858-3|DNLI1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.9292.11	113.1957	2	1305.6264	1305.6300	K	E	131	143
PSM	HGESAWNLENR	1013	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.9494.11	118.5912	2	1311.5922	1311.5956	R	F	11	22
PSM	IIYGGSVTGATCK	1014	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28	12-UNIMOD:4	ms_run[1]:scan=1.1.9429.11	116.8394	2	1325.6622	1325.6649	R	E	244	257
PSM	IIYGGSVTGATCK	1015	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28	12-UNIMOD:4	ms_run[1]:scan=1.1.9390.11	115.8017	2	1325.6612	1325.6649	R	E	244	257
PSM	IIYGGSVTGATCK	1016	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28	12-UNIMOD:4	ms_run[1]:scan=1.1.9352.9	114.7811	2	1325.6612	1325.6649	R	E	244	257
PSM	TGQYSGIYDCAK	1017	sp|Q6NUK1-2|SCMC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28	10-UNIMOD:4	ms_run[1]:scan=1.1.9430.11	116.8662	2	1361.5880	1361.5922	K	K	302	314
PSM	KLDEAVAEAHLGK	1018	sp|P23526|SAHH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.9231.6	111.5807	3	1379.7385	1379.7408	K	L	389	402
PSM	FNEVAAQYSEDK	1019	sp|Q9Y237-2|PIN4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.9397.11	115.9904	2	1399.6218	1399.6255	R	A	89	101
PSM	VEITYTPSDGTQK	1020	sp|O75874|IDHC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.9484.11	118.3223	2	1437.6958	1437.6987	K	V	152	165
PSM	GNVFSSPTAAGTPNK	1021	sp|Q05682-4|CALD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.9334.11	114.313	2	1446.7076	1446.7103	K	E	464	479
PSM	ILELSGSSSEDSEK	1022	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.9488.11	118.4297	2	1479.6896	1479.6940	R	V	3359	3373
PSM	NENSEVDTSAGSGSAPSVLHQR	1023	sp|Q8NFC6|BD1L1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.9329.10	114.1797	3	2241.0235	2241.0258	R	N	1477	1499
PSM	SAEDYNSSNALNVK	1024	sp|Q13153-2|PAK1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.9339.11	114.4453	2	1510.6860	1510.6899	K	A	149	163
PSM	DVTNNVHYENYR	1025	sp|Q16181-2|SEPT7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.9354.10	114.8351	2	1522.6786	1522.6801	K	S	298	310
PSM	VLETEGSQESTVIR	1026	sp|Q0VF96|CGNL1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.9436.8	117.0229	3	1546.7797	1546.7839	K	A	470	484
PSM	EDQSILCTGESGAGK	1027	sp|P35580-3|MYH10_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28	7-UNIMOD:4	ms_run[1]:scan=1.1.9458.11	117.622	2	1550.6838	1550.6882	R	T	170	185
PSM	VGEGFEEETVDGRK	1028	sp|P29762|RABP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.9392.10	115.8538	2	1550.7184	1550.7213	K	C	68	82
PSM	AIAHYEQSADYYK	1029	sp|P54920|SNAA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.9409.10	116.3117	2	1557.7176	1557.7099	K	G	141	154
PSM	IEQFVYSSPHDNK	1030	sp|P49591|SYSC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.9533.11	119.6389	2	1562.7344	1562.7365	K	S	324	337
PSM	QAVTNPNNTFYATK	1031	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.9517.10	119.207	2	1567.7582	1567.7631	R	R	108	122
PSM	VTAQGPGLEPSGNIANK	1032	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.9411.10	116.3652	2	1651.8492	1651.8529	K	T	384	401
PSM	ASGNYATVISHNPETK	1033	sp|P62917|RL8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.9206.11	110.9218	3	1687.8121	1687.8165	R	K	129	145
PSM	LRTEGDGVYTLNNEK	1034	sp|P00738|HPT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.9411.11	116.3669	2	1707.8362	1707.8428	K	Q	117	132
PSM	ALLVTASQCQQPAENK	1035	sp|Q01518-2|CAP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28	9-UNIMOD:4	ms_run[1]:scan=1.1.9418.9	116.5463	3	1756.8733	1756.8778	R	L	84	100
PSM	VILGSEAAQQHPEEVR	1036	sp|Q9NY33-4|DPP3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.9306.11	113.5729	2	1761.8816	1761.9009	R	G	96	112
PSM	KLETEETVPETDVETK	1037	sp|Q03701|CEBPZ_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.9268.10	112.5606	3	1846.9012	1846.9048	K	K	659	675
PSM	ESSNSVSNHQLSGFDQAR	1038	sp|Q9Y450|HBS1L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.9513.10	119.0995	3	1961.8750	1961.8827	K	L	63	81
PSM	RVSLEPHQGPGTPESK	1039	sp|Q14980-2|NUMA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.7548.6	67.21028	4	1717.8769	1717.8747	K	K	1975	1991
PSM	AALAHSEEVTASQVAATK	1040	sp|Q15149|PLEC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.9394.9	115.9061	3	1782.9094	1782.9112	R	T	2744	2762
PSM	YELISETGGSHDK	1041	sp|Q12906-7|ILF3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.8962.8	104.4678	3	1434.6622	1434.6627	K	R	545	558
PSM	FGQGGAGPVGGQGPR	1042	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.8208.11	84.50761	2	1340.6560	1340.6586	R	G	667	682
PSM	DSYVGDEAQSK	1043	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.7375.10	62.56277	2	1197.5172	1197.5150	K	R	51	62
PSM	KPNEGADGQWK	1044	sp|Q8NC51-3|PAIRB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.7173.5	57.25453	3	1228.5889	1228.5836	R	K	295	306
PSM	YHTINGHNAEVR	1045	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.7178.11	57.40115	2	1409.6808	1409.6800	K	K	162	174
PSM	VDDSSEDKTEFTVK	1046	sp|P49588|SYAC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.8752.11	98.9196	3	1598.7283	1598.7312	K	N	551	565
PSM	SGGTEGLLAEK	1047	sp|Q9UHB9|SRP68_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.8829.9	100.9899	2	1060.5378	1060.5400	R	L	267	278
PSM	CASQSGMTAYGTR	1048	sp|Q99439|CNN2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28	1-UNIMOD:4	ms_run[1]:scan=1.1.7814.10	74.2306	2	1388.5836	1388.5813	K	R	175	188
PSM	TTHFVEGGDAGNREDQINR	1049	sp|P18124|RL7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.8314.11	87.26434	4	2114.9729	2114.9730	K	L	224	243
PSM	TFQGHTNEVNAIK	1050	sp|Q9BZK7|TBL1R_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.8147.8	82.93072	3	1457.7286	1457.7263	K	W	344	357
PSM	QVTQEEGQQLAR	1051	sp|P62070-4|RRAS2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.7698.11	71.23737	2	1385.6902	1385.6899	R	Q	142	154
PSM	NDFTEEEEAQVRK	1052	sp|P63208|SKP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.9436.10	117.0262	3	1593.7252	1593.7271	K	E	143	156
PSM	ALVDGPCTQVR	1053	sp|P50914|RL14_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28	7-UNIMOD:4	ms_run[1]:scan=1.1.9200.10	110.762	2	1214.6050	1214.6078	R	R	36	47
PSM	LENGELEHIRPK	1054	sp|Q15102|PA1B3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.8892.2	102.6237	3	1433.7664	1433.7626	R	I	84	96
PSM	RMGESDDSILR	1055	sp|P63220|RS21_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.8764.3	99.23074	3	1277.6047	1277.6034	R	L	61	72
PSM	SGNALFHASTLHR	1056	sp|Q14152|EIF3A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.9219.7	111.2599	3	1410.718571	1409.716396	K	L	286	299
PSM	ENEVEEVKEEGPK	1057	sp|Q8NC51|PAIRB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.8531.8	93.01443	3	1515.715271	1514.710033	K	E	274	287
PSM	LTDCVVMRDPASK	1058	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28	4-UNIMOD:4	ms_run[1]:scan=1.1.9427.5	116.7763	3	1491.718871	1490.722135	K	R	47	60
PSM	VDEVPDGAVKPPTNK	1059	sp|O75475|PSIP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.8696.10	97.41033	3	1565.807471	1564.809687	R	L	25	40
PSM	AADPPAENSSAPEAEQGGAE	1060	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.7766.10	72.9856	3	1897.803071	1896.797344	K	-	305	325
PSM	GGGGGQDNGLEGLGNDSR	1061	sp|P08621|RU17_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.9486.11	118.376	2	1659.704847	1658.724454	R	D	394	412
PSM	RCQEAQNGSESEVWTHQSK	1062	sp|Q9Y2Z0|SGT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28	2-UNIMOD:4	ms_run[1]:scan=1.1.8450.11	90.87272	4	2260.973694	2259.992707	K	I	153	172
PSM	VLSGTIHAGQPVK	1063	sp|Q15029|U5S1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.8134.4	82.5924	3	1306.739771	1305.740485	R	V	496	509
PSM	QNAQCLHGDIAQSQR	1064	sp|Q9BQ39|DDX50_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:28,5-UNIMOD:4	ms_run[1]:scan=1.1.9205.9	110.8921	3	1707.7685	1707.7742	K	E	413	428
PSM	EDLPAENGETKTEESPASDEAGEK	1065	sp|P05114|HMGN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.8733.11	98.40653	3	2533.077671	2532.098731	K	E	72	96
PSM	AAHGGSAASSALK	1066	sp|O94888|UBXN7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:1	ms_run[1]:scan=1.1.7342.10	61.67742	2	1168.5843	1168.5831	M	G	2	15
PSM	CNTQQPGCENVCYDK	1067	sp|P17302|CXA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:385,1-UNIMOD:4,8-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.9428.11	116.8129	2	1854.6935	1854.6966	R	S	54	69
PSM	TKSENGLEFTSSGSANTETTK	1068	sp|P21796|VDAC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.9115.11	108.5176	3	2188.998071	2188.013151	K	V	33	54
PSM	QELSHALYQHDAACR	1069	sp|Q9UMS4|PRP19_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28	14-UNIMOD:4	ms_run[1]:scan=1.1.8696.8	97.407	4	1799.822094	1797.821666	R	V	101	116
PSM	QAASGLVGQENAR	1070	sp|Q9Y265|RUVB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:28	ms_run[1]:scan=1.1.9395.9	115.9332	2	1282.6242	1282.6261	K	E	34	47
PSM	GSHTDAPDTATGNCLLQR	1071	sp|Q9P2R3|ANFY1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28	14-UNIMOD:4	ms_run[1]:scan=1.1.9543.11	119.8988	3	1911.863171	1912.869738	R	A	447	465
PSM	HADIVTTTTHK	1072	sp|P34897-2|GLYM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.6941.9	51.04572	2	1222.6336	1222.6306	K	T	260	271
PSM	LAQHITYVHQHSR	1073	sp|P33993|MCM7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.7282.3	60.12192	5	1588.8286	1588.8222	R	Q	533	546
PSM	LEAVSHTSDMHR	1074	sp|Q01518-2|CAP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.7188.5	57.66362	4	1381.6473	1381.6408	R	G	18	30
PSM	REHALTSGTIK	1075	sp|Q15369-2|ELOC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.7060.5	54.18647	3	1211.6668	1211.6622	K	A	17	28
PSM	NYQQNYQNSESGEK	1076	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.7355.11	62.0305	2	1687.7102	1687.7074	R	N	157	171
PSM	GGVVNAAKEEHETDEK	1077	sp|O15042-2|SR140_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.7093.6	55.07633	4	1711.8025	1711.8013	R	R	138	154
PSM	RPLEDGDQPDAK	1078	sp|Q96AE4-2|FUBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.7008.2	52.79027	3	1339.6411	1339.6368	K	K	65	77
PSM	HHIETGGGQLPAK	1079	sp|Q92616|GCN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.7124.11	55.9267	3	1343.6956	1343.6946	R	L	2538	2551
PSM	HVPGGGNVQIQNK	1080	sp|P27816-6|MAP4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.7317.11	61.02667	3	1346.7094	1346.7055	K	K	1016	1029
PSM	YHTINGHNAEVR	1081	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.7197.7	57.91228	3	1409.6836	1409.6800	K	K	162	174
PSM	SAGGRPGSGPQLGTGR	1082	sp|O14908|GIPC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.7251.9	59.33207	3	1453.7407	1453.7386	R	G	225	241
PSM	LNSNDEDIHTANER	1083	sp|P04424-3|ARLY_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.7342.9	61.67575	3	1626.7255	1626.7234	K	R	81	95
PSM	GSNTIASAAADK	1084	sp|P55060-3|XPO2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.7345.8	61.7553	2	1104.5440	1104.5411	R	I	715	727
PSM	QVQQHQGNLDASGPAR	1085	sp|Q96SQ9-2|CP2S1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.7137.10	56.28048	3	1704.8290	1704.8292	R	D	251	267
PSM	TDGCHAYLSK	1086	sp|Q01518-2|CAP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	4-UNIMOD:4	ms_run[1]:scan=1.1.7241.6	59.07397	2	1150.5072	1150.5077	K	N	412	422
PSM	QVHPDTGISSK	1087	sp|P33778|H2B1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.6989.7	52.32385	2	1167.5902	1167.5884	K	A	48	59
PSM	KPNEGADGQWK	1088	sp|Q8NC51-3|PAIRB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.7192.4	57.77067	3	1228.5889	1228.5836	R	K	295	306
PSM	VLVQNAAGSQEK	1089	sp|Q9Y490|TLN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.7297.10	60.5166	2	1242.6582	1242.6568	K	L	2032	2044
PSM	IHMGSCAENTAK	1090	sp|P24752|THIL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	6-UNIMOD:4	ms_run[1]:scan=1.1.7126.4	55.97005	3	1317.5863	1317.5805	K	K	191	203
PSM	RDHALLEEQSK	1091	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.7213.11	58.34758	2	1324.6730	1324.6735	K	Q	633	644
PSM	ESEPQAAAEPAEAK	1092	sp|P80723|BASP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.7301.4	60.61794	2	1426.6592	1426.6575	K	E	39	53
PSM	ESEPQAAAEPAEAK	1093	sp|P80723|BASP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.7321.10	61.1327	2	1426.6594	1426.6575	K	E	39	53
PSM	YHTINGHNCEVK	1094	sp|P51991|ROA3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	9-UNIMOD:4	ms_run[1]:scan=1.1.7088.8	54.94885	3	1470.6715	1470.6674	K	K	188	200
PSM	TCVADESAENCDK	1095	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	2-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=1.1.7040.11	53.6492	2	1497.5732	1497.5712	K	S	76	89
PSM	SSGAASSAPGGGDGAEYK	1096	sp|Q96T37-3|RBM15_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.7252.11	59.36189	2	1567.6760	1567.6750	R	T	153	171
PSM	IECDDKGDGSCDVR	1097	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	3-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=1.1.6988.8	52.29308	3	1624.6468	1624.6458	K	Y	621	635
PSM	EDIYSGGGGGGSR	1098	sp|Q13151|ROA0_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.7443.3	64.39065	3	1210.5256	1210.5215	K	S	177	190
PSM	NVLCSACSGQGGK	1099	sp|O60884|DNJA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	4-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=1.1.7587.8	68.26505	3	1336.5895	1336.5864	K	S	140	153
PSM	EDGSGDRGDGPFR	1100	sp|P13010|XRCC5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.7628.7	69.36594	3	1363.5784	1363.5753	K	L	172	185
PSM	EQCCYNCGKPGHLAR	1101	sp|P62633-2|CNBP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	3-UNIMOD:4,4-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=1.1.7369.10	62.40267	4	1848.7873	1848.7818	R	D	88	103
PSM	HGKPTDSTPATWK	1102	sp|O60832|DKC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.7527.6	66.64548	3	1424.7064	1424.7048	K	Q	401	414
PSM	HRPSEADEEELAR	1103	sp|O14617-2|AP3D1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.7504.8	66.03584	3	1537.7158	1537.7121	K	R	564	577
PSM	DSGRGDSVSDSGSDALR	1104	sp|Q53EL6-2|PDCD4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.7648.9	69.90804	3	1679.7361	1679.7347	R	S	59	76
PSM	FKEQEQDDSTVACR	1105	sp|Q7LBC6|KDM3B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	13-UNIMOD:4	ms_run[1]:scan=1.1.7395.10	63.10323	3	1711.7515	1711.7472	K	F	925	939
PSM	RELHGQNPVVTPCNK	1106	sp|Q16630-2|CPSF6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	13-UNIMOD:4	ms_run[1]:scan=1.1.7374.9	62.53425	3	1747.8784	1747.8788	K	Q	147	162
PSM	SNASTLESHETEEPAAK	1107	sp|Q9UJA5|TRM6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.7646.10	69.85587	3	1799.8177	1799.8173	K	K	472	489
PSM	EDIYSGGGGGGSR	1108	sp|Q13151|ROA0_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.7436.10	64.21252	2	1210.5236	1210.5215	K	S	177	190
PSM	VLANPGNSQVAR	1109	sp|Q14974|IMB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.7592.11	68.40536	2	1224.6590	1224.6575	R	V	43	55
PSM	VHSEVASLQEK	1110	sp|Q9Y305-4|ACOT9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.7469.10	65.10629	2	1225.6304	1225.6302	R	Q	382	393
PSM	NSLQEQQEEEEEARK	1111	sp|P35580-3|MYH10_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.7651.10	69.9908	3	1845.8374	1845.8340	K	N	1367	1382
PSM	LLQAETASNSAR	1112	sp|Q14980-2|NUMA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.7602.11	68.67593	2	1259.6486	1259.6469	R	A	1271	1283
PSM	VSSDNVADLHEK	1113	sp|P28074|PSB5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.7661.10	70.26055	2	1312.6278	1312.6259	R	Y	246	258
PSM	SGDETPGSEVPGDK	1114	sp|Q1KMD3|HNRL2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.7490.11	65.67167	2	1373.5948	1373.5947	R	A	161	175
PSM	IICTGATSEEEAK	1115	sp|P62380|TBPL1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	3-UNIMOD:4	ms_run[1]:scan=1.1.7605.11	68.75528	2	1407.6556	1407.6551	K	F	66	79
PSM	ANGTTVHVGIHPSK	1116	sp|Q9UNX3|RL26L_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.7444.11	64.43092	2	1416.7472	1416.7474	K	V	90	104
PSM	ATAPQTQHVSPMR	1117	sp|P29692-2|EF1D_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.7368.9	62.37465	3	1422.7072	1422.7038	R	Q	490	503
PSM	CEDLETQTQSEK	1118	sp|O00592-2|PODXL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	1-UNIMOD:4	ms_run[1]:scan=1.1.7433.11	64.13298	2	1466.6200	1466.6195	K	Q	312	324
PSM	IEDVGSDEEDDSGK	1119	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.7403.11	63.32072	2	1493.5996	1493.6005	K	D	250	264
PSM	TLGETSANAETEQNK	1120	sp|Q5UIP0|RIF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.7361.10	62.18972	2	1591.7360	1591.7325	K	K	1489	1504
PSM	AVTEQGHELSNEER	1121	sp|P31946-2|1433B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.7387.10	62.88668	3	1597.7374	1597.7332	K	N	28	42
PSM	GGVDHAAAFGR	1122	sp|Q9HC38-2|GLOD4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.7716.2	71.70364	3	1056.5137	1056.5101	K	I	191	202
PSM	LDPHNHVLYSNR	1123	sp|P31948|STIP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8036.3	80.01643	4	1463.7285	1463.7269	K	S	33	45
PSM	RYESHPVCADLQAK	1124	sp|Q9NX63|MIC19_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	8-UNIMOD:4	ms_run[1]:scan=1.1.7923.6	77.0585	4	1672.8001	1672.7991	K	I	176	190
PSM	GLGAQEQGATDHIK	1125	sp|Q96BK5|PINX1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.7936.8	77.4012	3	1423.7053	1423.7056	K	V	44	58
PSM	SGGVGGSNTNWK	1126	sp|P27694|RFA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.7733.11	72.16399	2	1162.5354	1162.5367	K	T	432	444
PSM	KPITTGGVTYR	1127	sp|Q14192|FHL2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.7728.6	72.02717	3	1191.6625	1191.6612	K	E	167	178
PSM	HPQPGAVELAAK	1128	sp|P27708|PYR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.7900.7	76.46155	3	1216.6582	1216.6564	R	H	2025	2037
PSM	DCPLNAEAASSK	1129	sp|Q10567-2|AP1B1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	2-UNIMOD:4	ms_run[1]:scan=1.1.7843.8	74.97958	2	1261.5602	1261.5608	R	L	858	870
PSM	PAEKPAETPVATSPTATDSTSGDSSR	1130	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.7911.9	76.74675	4	2559.1957	2559.1936	K	S	148	174
PSM	MDSTEPPYSQK	1131	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.7756.8	72.73212	2	1281.5566	1281.5547	K	R	155	166
PSM	NCTIVSPDAGGAK	1132	sp|P60891|PRPS1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	2-UNIMOD:4	ms_run[1]:scan=1.1.7931.9	77.27317	2	1288.6076	1288.6082	R	R	164	177
PSM	EASGETTGVDITK	1133	sp|O75152|ZC11A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8033.11	79.94932	2	1306.6250	1306.6252	K	I	541	554
PSM	IIEDQQESLNK	1134	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.7961.11	78.06763	2	1315.6614	1315.6619	K	W	318	329
PSM	ERSDALNSAIDK	1135	sp|P35221-2|CTNA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8034.10	79.97467	2	1317.6548	1317.6524	K	M	359	371
PSM	ADTQTYQPYNK	1136	sp|P84090|ERH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.7716.10	71.71696	2	1327.6046	1327.6044	R	D	74	85
PSM	LMELHGEGSSSGK	1137	sp|P61247|RS3A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.7792.10	73.65943	2	1330.6162	1330.6187	K	A	228	241
PSM	HCLLTCEECK	1138	sp|Q56VL3|OCAD2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	2-UNIMOD:4,6-UNIMOD:4,9-UNIMOD:4	ms_run[1]:scan=1.1.7963.11	78.1215	2	1348.5570	1348.5574	R	I	129	139
PSM	RQLEEAEEEATR	1139	sp|P35580-3|MYH10_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.7890.10	76.20948	2	1459.6896	1459.6902	K	A	1905	1917
PSM	TNSSSNDLEVEDR	1140	sp|Q8IX90-3|SKA3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.7939.11	77.48427	2	1464.6332	1464.6328	K	T	315	328
PSM	NIIHGSDSVESAEK	1141	sp|P15531-2|NDKA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.7977.11	78.49135	2	1484.7094	1484.7107	R	E	140	154
PSM	ASTEGVAIQGQQGTR	1142	sp|Q92621|NU205_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.7715.11	71.69258	2	1501.7428	1501.7485	K	L	70	85
PSM	IEYNDQNDGSCDVK	1143	sp|O75369-2|FLNB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	11-UNIMOD:4	ms_run[1]:scan=1.1.7910.11	76.72443	2	1655.6758	1655.6733	K	Y	594	608
PSM	GGCPGGEATLSQPPPR	1144	sp|P20290|BTF3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	3-UNIMOD:4	ms_run[1]:scan=1.1.8441.11	90.63095	2	1579.7424	1579.7413	R	G	20	36
PSM	IGQTKPVVVYR	1145	sp|Q9NRZ9-2|HELLS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8329.5	87.65385	3	1258.7395	1258.7398	R	L	695	706
PSM	INISEGNCPER	1146	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	8-UNIMOD:4	ms_run[1]:scan=1.1.8333.7	87.76366	3	1287.5896	1287.5877	R	I	47	58
PSM	QHEADADLINAGK	1147	sp|P55809|SCOT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8369.6	88.71812	3	1380.6637	1380.6633	R	E	356	369
PSM	LHNAIEGGTQLSR	1148	sp|O60832|DKC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8294.7	86.72527	3	1394.7253	1394.7266	R	A	159	172
PSM	KEDEVEEWQHR	1149	sp|P15311|EZRI_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8459.7	91.108	3	1483.6693	1483.6691	R	A	438	449
PSM	GGGALSAVAATK	1150	sp|P61011|SRP54_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8437.9	90.52022	2	1001.5486	1001.5506	K	S	256	268
PSM	NSDEADLVPAK	1151	sp|P83916|CBX1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8448.8	90.81419	2	1157.5548	1157.5564	K	E	140	151
PSM	NSDEADLVPAK	1152	sp|P83916|CBX1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8467.10	91.32847	2	1157.5548	1157.5564	K	E	140	151
PSM	SGTVDPQELQK	1153	sp|P30626-2|SORCN_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8171.10	83.55233	2	1200.5970	1200.5986	R	A	102	113
PSM	TNEAQAIETAR	1154	sp|P61088|UBE2N_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8285.7	86.48431	2	1202.5874	1202.5891	K	A	131	142
PSM	VEIIANDQGNR	1155	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8223.9	84.88644	2	1227.6200	1227.6207	R	I	50	61
PSM	SNVSDAVAQSTR	1156	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8162.11	83.32137	2	1233.5952	1233.5949	K	I	232	244
PSM	FACHSASLTVR	1157	sp|Q15233-2|NONO_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	3-UNIMOD:4	ms_run[1]:scan=1.1.8446.4	90.75388	3	1247.6110	1247.6081	R	N	54	65
PSM	FACHSASLTVR	1158	sp|Q15233-2|NONO_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	3-UNIMOD:4	ms_run[1]:scan=1.1.8445.7	90.73193	3	1247.6110	1247.6081	R	N	54	65
PSM	FACHSASLTVR	1159	sp|Q15233-2|NONO_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	3-UNIMOD:4	ms_run[1]:scan=1.1.8443.5	90.67478	3	1247.6110	1247.6081	R	N	54	65
PSM	FACHSASLTVR	1160	sp|Q15233-2|NONO_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	3-UNIMOD:4	ms_run[1]:scan=1.1.8465.3	91.26275	3	1247.6110	1247.6081	R	N	54	65
PSM	ISSDLDGHPVPK	1161	sp|P29401-2|TKT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8416.3	89.95057	3	1263.6493	1263.6459	K	Q	103	115
PSM	ISSDLDGHPVPK	1162	sp|P29401-2|TKT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8422.9	90.11788	2	1263.6438	1263.6459	K	Q	103	115
PSM	NPELPNAAQAQK	1163	sp|O60264|SMCA5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8356.11	88.3785	2	1279.6486	1279.6520	R	E	803	815
PSM	YGLEECTCASSDGKDDK	1164	sp|O14672|ADA10_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	6-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.8382.11	89.07523	3	1933.7632	1933.7670	K	E	575	592
PSM	YTVENGYSTSAK	1165	sp|P28340|DPOD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8252.9	85.62587	2	1318.5994	1318.6041	K	V	739	751
PSM	RPPGPTTSPASTSLSSPGQR	1166	sp|Q01970-2|PLCB3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8455.9	91.0036	3	1980.0001	1980.0025	R	D	852	872
PSM	FGQGGAGPVGGQGPR	1167	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8268.11	86.03728	2	1340.6560	1340.6586	R	G	667	682
PSM	ASNGDAWVEAHGK	1168	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8114.6	82.08611	3	1340.6131	1340.6109	R	L	147	160
PSM	EAPPMEKPEVVK	1169	sp|P62841|RS15_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8306.7	87.04565	3	1352.7016	1352.7010	K	T	66	78
PSM	YICENQDSISSK	1170	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	3-UNIMOD:4	ms_run[1]:scan=1.1.8233.8	85.14042	2	1442.6288	1442.6347	K	L	287	299
PSM	YICENQDSISSK	1171	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	3-UNIMOD:4	ms_run[1]:scan=1.1.8131.11	82.52752	2	1442.6358	1442.6347	K	L	287	299
PSM	WDQTADQTPGATPK	1172	sp|O75533|SF3B1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8397.11	89.47332	2	1514.6964	1514.7001	R	K	200	214
PSM	LQGQLEQGDDTAAER	1173	sp|Q8NE71-2|ABCF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8127.10	82.42395	2	1629.7612	1629.7594	R	L	359	374
PSM	QGIETPEDQNDLRK	1174	sp|Q15637-3|SF01_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8444.10	90.70995	3	1641.7951	1641.7958	K	M	228	242
PSM	HTGPNSPDTANDGFVR	1175	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8426.8	90.22352	3	1683.7597	1683.7601	K	L	99	115
PSM	HVQSLEPDPGTPGSER	1176	sp|Q9NX46|ARHL2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8312.11	87.21135	3	1704.8050	1704.8067	R	T	54	70
PSM	TTHFVEGGDAGNREDQINR	1177	sp|P18124|RL7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8278.11	86.30395	3	2114.9683	2114.9730	K	L	224	243
PSM	NFDDEDSVDGNRPSSASSTSSK	1178	sp|Q7Z460|CLAP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8228.7	85.01685	3	2300.9593	2300.9629	K	A	240	262
PSM	LHYCVSCAIHSK	1179	sp|Q5JNZ5|RS26L_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	4-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=1.1.8788.3	99.87695	4	1473.6901	1473.6857	K	V	71	83
PSM	ERHPGSFDVVHVK	1180	sp|P62701|RS4X_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8661.2	96.45419	4	1505.7769	1505.7739	R	D	199	212
PSM	VEPHATIAEIK	1181	sp|Q9NZ01|TECR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8812.6	100.5283	3	1206.6616	1206.6608	K	N	23	34
PSM	KEELVAEQALK	1182	sp|Q9Y6E2|BZW2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8718.4	97.99028	3	1256.6983	1256.6976	K	H	310	321
PSM	FTDADKETEIVK	1183	sp|Q03701|CEBPZ_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8697.6	97.43062	3	1394.6932	1394.6929	K	K	647	659
PSM	SEDSSGAAGLSGLHR	1184	sp|Q86U86-8|PB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8741.9	98.61903	3	1442.6719	1442.6750	K	T	946	961
PSM	TDPEKGEIEDYR	1185	sp|Q8TCS8|PNPT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8647.6	96.08595	3	1450.6621	1450.6576	K	L	517	529
PSM	QGRPVVICDKEDTETIK	1186	sp|Q06210|GFPT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	8-UNIMOD:4	ms_run[1]:scan=1.1.8690.9	97.2468	4	1987.0037	1987.0044	R	N	631	648
PSM	TALIHDGLAR	1187	sp|P25398|RS12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8795.9	100.0748	2	1065.5918	1065.5931	K	G	24	34
PSM	HYGYNSYSVSNSEK	1188	sp|P07858|CATB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8670.11	96.71083	3	1633.7011	1633.7008	K	D	224	238
PSM	HLSSCAAPAPLTSAER	1189	sp|Q6IBS0|TWF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	5-UNIMOD:4	ms_run[1]:scan=1.1.8828.6	100.9591	3	1666.8088	1666.8097	K	E	137	153
PSM	NLQEGNEVDSQSSIR	1190	sp|O75152|ZC11A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8735.9	98.45715	3	1674.7792	1674.7809	K	T	522	537
PSM	EHGVGGVSQCPEPGLR	1191	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	10-UNIMOD:4	ms_run[1]:scan=1.1.8703.9	97.59769	3	1677.7837	1677.7893	R	H	1364	1380
PSM	YLAEVAAGDDK	1192	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8766.7	99.29118	2	1150.5494	1150.5506	R	K	128	139
PSM	YLAEVAAGDDK	1193	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8744.9	98.70015	2	1150.5494	1150.5506	R	K	128	139
PSM	IVGPSGAAVPCK	1194	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	11-UNIMOD:4	ms_run[1]:scan=1.1.8556.11	93.69103	2	1154.6106	1154.6118	K	V	1008	1020
PSM	QLQQAQAAGAEQEVEK	1195	sp|P39748|FEN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8717.9	97.9719	3	1726.8460	1726.8486	K	F	110	126
PSM	IVGPSGAAVPCK	1196	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	11-UNIMOD:4	ms_run[1]:scan=1.1.8557.11	93.71828	2	1154.6106	1154.6118	K	V	1008	1020
PSM	SAGQENLETLK	1197	sp|P48681|NEST_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8784.9	99.77924	2	1188.5942	1188.5986	K	S	831	842
PSM	LGHELQQAGLK	1198	sp|Q14980-2|NUMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8546.10	93.4199	2	1192.6544	1192.6564	R	T	1641	1652
PSM	LNGGLGTSMGCK	1199	sp|Q16851|UGPA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	11-UNIMOD:4	ms_run[1]:scan=1.1.8713.10	97.8671	2	1193.5508	1193.5533	K	G	113	125
PSM	LGSTEVASNVPK	1200	sp|Q9Y5A9-2|YTHD2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8625.10	95.5007	2	1200.6336	1200.6350	K	V	144	156
PSM	ASIHEAWTDGK	1201	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8767.3	99.31149	3	1213.5760	1213.5727	K	E	422	433
PSM	VYVGNLGNNGNK	1202	sp|P84103|SRSF3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8484.10	91.78226	2	1247.6242	1247.6258	K	T	12	24
PSM	QPGNETADTVLK	1203	sp|P61758|PFD3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8490.11	91.94012	2	1271.6350	1271.6357	K	K	40	52
PSM	MDSTANEVEAVK	1204	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8549.9	93.4991	2	1292.5898	1292.5918	K	V	425	437
PSM	GGGPAGAGGEAPAALR	1205	sp|Q5RKV6|EXOS6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8625.11	95.50237	2	1307.6544	1307.6582	R	G	78	94
PSM	FSGDLDDQTCR	1206	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	10-UNIMOD:4	ms_run[1]:scan=1.1.8658.10	96.38773	2	1312.5328	1312.5354	K	E	236	247
PSM	NSNPALNDNLEK	1207	sp|O00299|CLIC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8518.10	92.6751	2	1327.6346	1327.6368	K	G	120	132
PSM	HQEGEIFDTEK	1208	sp|Q02878|RL6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8721.3	98.06972	3	1331.5999	1331.5993	R	E	227	238
PSM	SFAANGIQAHPESSTGSDAR	1209	sp|Q5QJE6|TDIF2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8745.10	98.72887	3	2001.9082	2001.9140	K	T	25	45
PSM	SAVENCQDSWR	1210	sp|P52209-2|6PGD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	6-UNIMOD:4	ms_run[1]:scan=1.1.8618.8	95.30936	2	1350.5602	1350.5623	K	R	384	395
PSM	RTEEGPTLSYGR	1211	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8506.10	92.35854	2	1364.6654	1364.6684	R	D	149	161
PSM	SEPIPESNDGPVK	1212	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8571.11	94.09164	2	1367.6538	1367.6569	K	V	367	380
PSM	QSSSTNYTNELK	1213	sp|Q9UHB6-4|LIMA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8548.10	93.47388	2	1370.6344	1370.6314	K	A	281	293
PSM	AVANYDSVEEGEK	1214	sp|P51659-2|DHB4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8605.9	94.96262	2	1409.6292	1409.6310	K	V	94	107
PSM	SSQSSSQQFSGIGR	1215	sp|Q92841-3|DDX17_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8761.11	99.16299	2	1454.6720	1454.6750	R	S	594	608
PSM	NDAPTPGTSTTPGLR	1216	sp|Q04726-2|TLE3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8597.10	94.75742	2	1483.7238	1483.7267	R	S	324	339
PSM	SQAPGQPGASQWGSR	1217	sp|Q96EP5-2|DAZP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8585.10	94.45029	2	1512.7048	1512.7070	K	V	195	210
PSM	ENEVEEVKEEGPK	1218	sp|Q8NC51-3|PAIRB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8569.7	94.033	3	1514.7100	1514.7100	K	E	259	272
PSM	HELQANCYEEVK	1219	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	7-UNIMOD:4	ms_run[1]:scan=1.1.8479.6	91.64367	3	1518.6766	1518.6773	K	D	133	145
PSM	HELQANCYEEVK	1220	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	7-UNIMOD:4	ms_run[1]:scan=1.1.8499.6	92.16687	3	1518.6766	1518.6773	K	D	133	145
PSM	AALSASEGEEVPQDK	1221	sp|O95831|AIFM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8662.10	96.4941	3	1529.7244	1529.7209	K	A	113	128
PSM	SGGGTGEEPGSQGLNGEAGPEDSTR	1222	sp|O15355|PPM1G_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8786.11	99.83649	3	2344.9978	2345.0004	K	E	173	198
PSM	VDNDENEHQLSLR	1223	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8616.9	95.25725	3	1567.7209	1567.7226	K	T	33	46
PSM	VDNDENEHQLSLR	1224	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8557.8	93.71328	3	1567.7209	1567.7226	K	T	33	46
PSM	TTDDTTTDNYIAQGK	1225	sp|Q7Z2T5|TRM1L_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8564.11	93.90657	2	1642.7294	1642.7322	K	R	595	610
PSM	QQREDITQSAQHALR	1226	sp|Q12906-7|ILF3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8860.4	101.7928	4	1779.9257	1779.8976	R	L	309	324
PSM	QQREDITQSAQHALR	1227	sp|Q12906-7|ILF3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8858.4	101.7393	4	1779.9257	1779.8976	R	L	309	324
PSM	TNHIYVSSDDIK	1228	sp|Q6P2Q9|PRP8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8935.4	103.7387	3	1390.6702	1390.6729	R	E	2087	2099
PSM	LNFSHGTHEYHAETIK	1229	sp|P14618-2|KPYM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.9068.8	107.2897	4	1882.8961	1882.8962	R	N	74	90
PSM	IKEEPLDDEYDK	1230	sp|Q5VZL5-4|ZMYM4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8967.7	104.6005	3	1492.6906	1492.6933	R	A	217	229
PSM	VCGHTYEEDAIVR	1231	sp|Q96MF7|NSE2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	2-UNIMOD:4	ms_run[1]:scan=1.1.9154.6	109.5287	3	1547.7046	1547.7038	K	M	184	197
PSM	RLDECEEAFQGTK	1232	sp|P61289-2|PSME3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	5-UNIMOD:4	ms_run[1]:scan=1.1.9164.7	109.799	3	1581.7078	1581.7093	R	V	88	101
PSM	ALAAGGYDVEK	1233	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8998.8	105.4212	2	1092.5432	1092.5451	K	N	68	79
PSM	ALAAGGYDVEK	1234	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8978.9	104.8961	2	1092.5432	1092.5451	K	N	68	79
PSM	TLHSDDEGTVLDDSR	1235	sp|O00170|AIP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8843.6	101.3501	3	1658.7370	1658.7384	R	A	40	55
PSM	VTADVINAAEK	1236	sp|O43175|SERA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.9091.8	107.8934	2	1129.5954	1129.5979	K	L	59	70
PSM	VYVGNLGTGAGK	1237	sp|Q16629-4|SRSF7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.9185.9	110.3646	2	1134.6012	1134.6033	K	G	13	25
PSM	LFPVCHDSDESDTAK	1238	sp|Q9Y6K1|DNM3A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	5-UNIMOD:4	ms_run[1]:scan=1.1.8963.10	104.4982	3	1719.7393	1719.7410	K	A	383	398
PSM	IGSTIDDTISK	1239	sp|Q14677-2|EPN4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.9168.9	109.9102	2	1148.5890	1148.5925	K	F	190	201
PSM	GLCGAIHSSIAK	1240	sp|P36542-2|ATPG_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	3-UNIMOD:4	ms_run[1]:scan=1.1.9053.3	106.8811	3	1212.6364	1212.6285	R	Q	101	113
PSM	LNQDQLDAVSK	1241	sp|Q14444-2|CAPR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.9080.8	107.606	2	1229.6200	1229.6252	R	Y	88	99
PSM	VDVTEQPGLSGR	1242	sp|Q9H3N1|TMX1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.9069.10	107.3193	2	1256.6306	1256.6361	K	F	83	95
PSM	LNFSHGTHEYHAETIK	1243	sp|P14618-2|KPYM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.9011.11	105.7719	3	1882.8937	1882.8962	R	N	74	90
PSM	GGGGGGPGEGFDVAK	1244	sp|Q9Y295|DRG1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.9029.11	106.2532	2	1260.5714	1260.5735	K	T	47	62
PSM	DLGLAQDSATSTK	1245	sp|P31937|3HIDH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.9042.10	106.5988	2	1305.6426	1305.6412	K	S	285	298
PSM	GLSEDTTEETLK	1246	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.9182.10	110.2872	2	1321.6202	1321.6249	K	E	578	590
PSM	VLEEANQAINPK	1247	sp|Q92841-3|DDX17_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.9050.6	106.8058	3	1324.7008	1324.6986	K	L	457	469
PSM	LCDSYEIRPGK	1248	sp|O43390-2|HNRPR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	2-UNIMOD:4	ms_run[1]:scan=1.1.8975.11	104.8208	2	1336.6424	1336.6445	K	H	225	236
PSM	RAVAGDASESALLK	1249	sp|P05023-4|AT1A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8958.6	104.3572	3	1386.7459	1386.7467	K	C	445	459
PSM	SRAEAESMYQIK	1250	sp|P05787-2|K2C8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8906.7	102.9872	3	1411.6771	1411.6765	R	Y	302	314
PSM	LNEQVTQEQPLK	1251	sp|Q14690|RRP5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.9148.11	109.3756	2	1425.7430	1425.7463	K	D	123	135
PSM	AQAELVGTADEATR	1252	sp|P30049|ATPD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.9079.11	107.5844	2	1430.6954	1430.7001	K	A	137	151
PSM	YSDASDDSFSEPR	1253	sp|Q9NRF8|PYRG2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.9043.11	106.6274	2	1474.5818	1474.5848	R	I	567	580
PSM	SSFYPDGGDQETAK	1254	sp|Q9NYF8-2|BCLF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.9165.10	109.8308	2	1500.6336	1500.6369	R	T	317	331
PSM	EQIVPKPEEEVAQK	1255	sp|P18621-3|RL17_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8965.8	104.5483	3	1622.8510	1622.8515	K	K	154	168
PSM	EQIVPKPEEEVAQK	1256	sp|P18621-3|RL17_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.9003.9	105.5554	3	1622.8516	1622.8515	K	K	154	168
PSM	PGLVDSNPAPPESQEK	1257	sp|Q14061|COX17_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.9117.10	108.5677	3	1663.8010	1663.8053	M	K	2	18
PSM	PGLVDSNPAPPESQEK	1258	sp|Q14061|COX17_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.9097.11	108.053	2	1663.8008	1663.8053	M	K	2	18
PSM	AKDPFAHLPK	1259	sp|P26641-2|EF1G_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.9194.2	110.5903	3	1122.6193	1122.6186	K	S	326	336
PSM	ASGNYATVISHNPETK	1260	sp|P62917|RL8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.9209.7	110.9943	4	1687.8169	1687.8165	R	K	129	145
PSM	RLGLPGDEVDNK	1261	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.9462.4	117.718	3	1311.6787	1311.6783	K	V	2704	2716
PSM	KATDAEADVASLNR	1262	sp|P09493-3|TPM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.9264.7	112.4511	3	1459.7269	1459.7267	K	R	77	91
PSM	DDDIEEGDLPEHK	1263	sp|Q14696|MESD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.9203.9	110.8393	3	1510.6423	1510.6423	K	R	73	86
PSM	IVAERPGTNSTGPAPMAPPR	1264	sp|Q13263-2|TIF1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.9325.7	114.0701	4	2018.0357	2018.0367	K	A	326	346
PSM	QAVTNPNNTFYATK	1265	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.9522.9	119.3397	3	1567.7590	1567.7631	R	R	108	122
PSM	VELHSTCQTISVDR	1266	sp|O00267-2|SPT5H_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	7-UNIMOD:4	ms_run[1]:scan=1.1.9445.7	117.264	3	1643.7913	1643.7937	R	Q	730	744
PSM	ALAAAGYDVEK	1267	sp|P16402|H13_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.9274.8	112.7138	2	1106.5578	1106.5608	K	N	66	77
PSM	ALAAAGYDVEK	1268	sp|P16402|H13_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.9254.8	112.1931	2	1106.5578	1106.5608	K	N	66	77
PSM	ALAAAGYDVEK	1269	sp|P16402|H13_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.9235.9	111.6929	2	1106.5578	1106.5608	K	N	66	77
PSM	GGPSPGDVEAIK	1270	sp|P09661|RU2A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.9266.9	112.5066	2	1125.5646	1125.5666	K	N	194	206
PSM	VYVGNLGTGAGK	1271	sp|Q16629-4|SRSF7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.9204.7	110.8624	2	1134.6012	1134.6033	K	G	13	25
PSM	VNVPVIGGHAGK	1272	sp|P40926|MDHM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.9535.2	119.6771	3	1146.6517	1146.6510	R	T	192	204
PSM	VLVDQTTGLSR	1273	sp|Q15717-2|ELAV1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.9507.10	118.9382	2	1187.6490	1187.6510	R	G	164	175
PSM	EAAENSLVAYK	1274	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.9476.10	118.1056	2	1193.5922	1193.5928	K	A	143	154
PSM	EAAENSLVAYK	1275	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.9495.10	118.6163	2	1193.5922	1193.5928	K	A	143	154
PSM	AADLNGDLTATR	1276	sp|Q15293|RCN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.9345.8	114.5961	2	1216.6028	1216.6048	K	E	177	189
PSM	ANDDLADAGLEK	1277	sp|Q9HB90|RRAGC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.9494.8	118.5862	2	1230.5720	1230.5728	R	L	199	211
PSM	NISSAQIVGPGPKPEASAK	1278	sp|P53990-2|IST1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.9378.8	115.4729	3	1849.9861	1849.9897	K	L	262	281
PSM	EALQDVEDENQ	1279	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.9502.11	118.8059	2	1288.5392	1288.5419	K	-	245	256
PSM	DLLHPSPEEEK	1280	sp|P42677|RS27_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.9423.3	116.6673	3	1292.6275	1292.6248	K	R	6	17
PSM	NCIIVSPDAGGAK	1281	sp|P21108|PRPS3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	2-UNIMOD:4	ms_run[1]:scan=1.1.9390.10	115.8	2	1300.6408	1300.6445	K	R	164	177
PSM	VCDEPHPLLVK	1282	sp|P35250-2|RFC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	2-UNIMOD:4	ms_run[1]:scan=1.1.9294.5	113.2395	3	1305.6745	1305.6751	K	E	220	231
PSM	GVQVETISPGDGR	1283	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.9299.10	113.3823	2	1313.6544	1313.6576	M	T	2	15
PSM	IIYGGSVTGATCK	1284	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	12-UNIMOD:4	ms_run[1]:scan=1.1.9378.3	115.4645	3	1325.6665	1325.6649	R	E	244	257
PSM	TLIQNCGASTIR	1285	sp|P49368|TCPG_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	6-UNIMOD:4	ms_run[1]:scan=1.1.9396.11	115.9636	2	1332.6788	1332.6820	R	L	450	462
PSM	IQTQPGYANTLR	1286	sp|Q00325-2|MPCP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.9323.9	114.0211	2	1360.7054	1360.7099	R	D	189	201
PSM	IQTQPGYANTLR	1287	sp|Q00325-2|MPCP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.9343.10	114.5472	2	1360.7054	1360.7099	R	D	189	201
PSM	VHTECCHGDLLECADDR	1288	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	5-UNIMOD:4,6-UNIMOD:4,13-UNIMOD:4	ms_run[1]:scan=1.1.9360.9	114.9925	3	2085.8248	2085.8303	K	A	265	282
PSM	HEQGLSTALSVEK	1289	sp|Q96I25|SPF45_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.9525.5	119.4139	3	1397.7139	1397.7150	K	T	257	270
PSM	SQGGEPTYNVAVGR	1290	sp|P35080|PROF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.9363.11	115.0758	2	1433.6852	1433.6899	K	A	92	106
PSM	VEITYTPSDGTQK	1291	sp|O75874|IDHC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.9440.11	117.1357	2	1437.6958	1437.6987	K	V	152	165
PSM	QCSDSSAMESLTK	1292	sp|Q92616|GCN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	2-UNIMOD:4	ms_run[1]:scan=1.1.9404.9	116.1758	2	1442.5982	1442.6017	R	H	328	341
PSM	LGNYAGAVQDCER	1293	sp|O43765|SGTA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	11-UNIMOD:4	ms_run[1]:scan=1.1.9332.11	114.2603	2	1451.6422	1451.6463	K	A	138	151
PSM	NTGVILANDANAER	1294	sp|P46087-4|NOP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.9448.11	117.3518	2	1456.7234	1456.7270	K	L	441	455
PSM	VFEHDSVELNCK	1295	sp|P10768|ESTD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	11-UNIMOD:4	ms_run[1]:scan=1.1.9491.10	118.5087	2	1475.6656	1475.6715	K	M	18	30
PSM	AAAGEFADDPCSSVK	1296	sp|P35221-2|CTNA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	11-UNIMOD:4	ms_run[1]:scan=1.1.9497.11	118.6718	2	1523.6532	1523.6562	K	R	106	121
PSM	LTRDETNYGIPQR	1297	sp|P63244|RACK1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.9247.6	112.007	3	1561.7833	1561.7849	K	A	45	58
PSM	VHTECCHGDLLECADDR	1298	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	5-UNIMOD:4,6-UNIMOD:4,13-UNIMOD:4	ms_run[1]:scan=1.1.9342.8	114.5178	4	2085.8273	2085.8303	K	A	265	282
PSM	QAEETYENIPGQSK	1299	sp|O00410-3|IPO5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.9223.11	111.3739	2	1592.7268	1592.7318	K	I	46	60
PSM	TYDPSGDSTLPTCSK	1300	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	13-UNIMOD:4	ms_run[1]:scan=1.1.9222.11	111.3472	2	1627.6994	1627.7036	K	K	427	442
PSM	TPDTSTYCYETAEK	1301	sp|P46821|MAP1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	8-UNIMOD:4	ms_run[1]:scan=1.1.9198.11	110.7109	2	1664.6812	1664.6876	R	I	2034	2048
PSM	SSVLIAQQTDTSDPEK	1302	sp|P46060|RAGP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.9415.11	116.4714	2	1717.8314	1717.8370	K	V	453	469
PSM	NISSAQIVGPGPKPEASAK	1303	sp|P53990-2|IST1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.9379.11	115.5049	2	1849.9854	1849.9897	K	L	262	281
PSM	IAECSSQLAEEEEK	1304	sp|P35580-3|MYH10_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	4-UNIMOD:4	ms_run[1]:scan=1.1.8769.10	99.37704	3	1621.7119	1621.7141	R	A	1029	1043
PSM	RQLEEAEEEAQR	1305	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.7665.8	70.3628	3	1486.7023	1486.7011	K	A	1877	1889
PSM	ADEASELACPTPK	1306	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	9-UNIMOD:4	ms_run[1]:scan=1.1.8800.9	100.2092	3	1387.6270	1387.6289	K	E	2194	2207
PSM	EELQANGSAPAADKEEPAAAGSGAASPSAAEK	1307	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.9123.10	108.7236	4	2981.3709	2981.3849	K	G	56	88
PSM	RDPHLACVAYER	1308	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	7-UNIMOD:4	ms_run[1]:scan=1.1.8615.10	95.23203	3	1485.7135	1485.7147	K	G	912	924
PSM	MICQQVEAIKK	1309	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	3-UNIMOD:4	ms_run[1]:scan=1.1.8882.2	102.3633	3	1346.7088	1346.7050	K	E	813	824
PSM	KLNEQVTQEQPLK	1310	sp|Q14690|RRP5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8480.10	91.67722	3	1553.8390	1553.8413	K	D	122	135
PSM	ERHPGSFDVVHVK	1311	sp|P62701|RS4X_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8703.6	97.59268	3	1505.7697	1505.7739	R	D	199	212
PSM	YKPESEELTAER	1312	sp|P07237|PDIA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8304.7	86.99188	3	1450.6939	1450.6939	K	I	327	339
PSM	GETVNDCHAEIISR	1313	sp|P55265-2|DSRAD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	7-UNIMOD:4	ms_run[1]:scan=1.1.8627.8	95.55105	3	1599.7312	1599.7311	K	R	877	891
PSM	GAEAANVTGPGGVPVQGSK	1314	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8969.10	104.6593	3	1694.8567	1694.8588	K	Y	119	138
PSM	NDIASHPPVEGSYAPR	1315	sp|Q7KZF4|SND1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.9448.8	117.3468	3	1708.8130	1708.8169	R	R	716	732
PSM	SGGTEGLLAEK	1316	sp|Q9UHB9|SRP68_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8830.9	101.0159	2	1060.5378	1060.5400	R	L	267	278
PSM	QREELGQGLQGVEQK	1317	sp|Q07065|CKAP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.9469.11	117.9183	2	1697.8636	1697.8696	R	V	147	162
PSM	AEQLGAEGNVDESQK	1318	sp|Q9NQ29|LUC7L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.7787.11	73.53132	2	1573.7220	1573.7220	K	I	140	155
PSM	YGDGGSTFQSTTGHCVHMR	1319	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	15-UNIMOD:4	ms_run[1]:scan=1.1.9376.11	115.4241	3	2096.8768	2096.8793	R	G	276	295
PSM	HGEVCPAGWK	1320	sp|Q06830|PRDX1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	5-UNIMOD:4	ms_run[1]:scan=1.1.8118.8	82.1964	2	1139.5140	1139.5182	K	P	169	179
PSM	ASDTSSETVFGK	1321	sp|Q86V48|LUZP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8647.10	96.09261	2	1227.5592	1227.5619	K	R	530	542
PSM	LDYGQHVVAGTPGR	1322	sp|P38919|IF4A3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.9322.9	113.995	3	1468.7422	1468.7423	K	V	153	167
PSM	LREDENAEPVGTTYQK	1323	sp|Q16643-2|DREB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8144.8	82.85412	3	1848.8860	1848.8853	R	T	152	168
PSM	HPAKPDPSGECNPDLR	1324	sp|Q16576-2|RBBP7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	11-UNIMOD:4	ms_run[1]:scan=1.1.7362.10	62.2164	3	1788.8257	1788.8213	K	L	200	216
PSM	YHVVSGADDYTVK	1325	sp|Q8TED0|UTP15_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.9367.9	115.1795	3	1452.6868	1452.6885	K	L	135	148
PSM	RQHSSQDVHVVLK	1326	sp|Q9UNZ2-5|NSF1C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.7410.5	63.5004	4	1531.8233	1531.8219	K	L	175	188
PSM	QLHQSCQTDDGEDDLKK	1327	sp|P61201-2|CSN2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	6-UNIMOD:4	ms_run[1]:scan=1.1.7183.7	57.53113	4	2015.8905	2015.8855	R	G	181	198
PSM	TVLHTGSAPSSSTPFNK	1328	sp|O14646-2|CHD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.9338.9	114.4155	3	1729.8616	1729.8635	K	E	946	963
PSM	GHAAFTSDPKPTIEVSGK	1329	sp|P00390-3|GSHR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.9393.5	115.8723	4	1840.9345	1840.9319	R	K	172	190
PSM	NGQVCFSTQDHKPCNPR	1330	sp|O75688-2|PPM1B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	5-UNIMOD:4,14-UNIMOD:4	ms_run[1]:scan=1.1.7881.9	75.97456	4	2043.8993	2043.9003	R	E	159	176
PSM	GNSRPGTPSAEGGSTSSTLR	1331	sp|P35269|T2FA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.7396.10	63.13033	3	1917.9181	1917.9140	R	A	383	403
PSM	RMGESDDSILR	1332	sp|P63220|RS21_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8783.5	99.74575	3	1277.6047	1277.6034	R	L	61	72
PSM	GHENVEAAQAEYIEK	1333	sp|P05166-2|PCCB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.9246.8	111.9838	3	1686.7849	1686.7849	K	F	495	510
PSM	VSGQVQALQNHYR	1334	sp|O00411|RPOM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.8987.7	105.1284	3	1498.7584	1498.7641	R	K	519	532
PSM	SSEHINEGETAMLVCK	1335	sp|P35613-3|BASI_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	12-UNIMOD:35,15-UNIMOD:4	ms_run[1]:scan=1.1.9389.9	115.7714	3	1819.8040	1819.8080	K	S	19	35
PSM	QGGGGGGGSVPGIER	1336	sp|P52272|HNRPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:28	ms_run[1]:scan=1.1.9461.10	117.7012	2	1266.6024	1266.5948	K	M	389	404
PSM	DGEEAGAYDGPR	1337	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.8022.9	79.65108	2	1236.510447	1235.505459	R	T	108	120
PSM	VEIIANDQGNR	1338	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.8243.10	85.39732	2	1228.621647	1227.620764	R	I	50	61
PSM	QDAQSLHGDIPQK	1339	sp|Q9NR30|DDX21_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:28	ms_run[1]:scan=1.1.9445.11	117.2707	2	1418.6749	1418.6785	K	Q	462	475
PSM	CGETGHVAINCSK	1340	sp|P62633|CNBP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:385,1-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=1.1.8479.11	91.652	2	1415.5942	1414.5962	R	T	140	153
PSM	QSSGASSSSFSSSR	1341	sp|O00571|DDX3X_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:28	ms_run[1]:scan=1.1.7687.11	70.94241	2	1343.5605	1343.5584	R	A	604	618
PSM	QRPGQQVATCVR	1342	sp|O75534|CSDE1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:28,10-UNIMOD:4	ms_run[1]:scan=1.1.8046.10	80.29755	2	1381.6875	1381.6879	K	L	497	509
PSM	YEQGTGCWQGPNR	1343	sp|P14314|GLU2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27	7-UNIMOD:4	ms_run[1]:scan=1.1.9175.10	110.1005	2	1552.652047	1551.652475	K	S	465	478
PSM	SSQTSGTNEQSSAIVSAR	1344	sp|O60763|USO1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.7884.11	76.05614	2	1809.868447	1808.850048	K	D	765	783
PSM	CAGGHDDATLAR	1345	sp|P49916|DNLI3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.8160.10	83.26814	2	1225.5140	1225.5141	K	L	729	741
PSM	ATAAETSASEPEAESK	1346	sp|Q15020|SART3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:1	ms_run[1]:scan=1.1.8363.11	88.56568	2	1620.7282	1619.7162	M	A	2	18
PSM	SETAPAAPAAPAPAEK	1347	sp|P10412|H14_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:1	ms_run[1]:scan=1.1.8983.10	105.029	2	1519.7487	1519.7513	M	T	2	18
PSM	KQEEFDVANNGSSQANK	1348	sp|P29144|TPP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.7997.9	79.00042	3	1865.840771	1864.855134	R	L	152	169
PSM	LMELHGEGSSSGK	1349	sp|P61247|RS3A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.7772.11	73.14359	2	1331.621647	1330.618715	K	A	228	241
PSM	TTHFVEGGDAGNREDQINR	1350	sp|P18124|RL7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.8273.9	86.16707	4	2115.973694	2114.972957	K	L	224	243
PSM	AAGGDHGSPDSYR	1351	sp|P30566|PUR8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:1	ms_run[1]:scan=1.1.7517.11	66.38596	2	1330.5553	1330.5533	M	S	2	15
PSM	ELVSCSNCTDYQAR	1352	sp|P49591|SYSC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27	5-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.8982.11	105.0043	2	1702.708647	1701.708670	R	R	391	405
PSM	HLPSTEPDPHVVR	1353	sp|Q9BUJ2|HNRL1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.8283.6	86.42925	3	1483.751471	1482.757926	K	I	271	284
PSM	TGVHHYSGNNIELGTACGK	1354	sp|P62888|RL30_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27	17-UNIMOD:4	ms_run[1]:scan=1.1.9017.7	105.9253	4	2014.920094	2013.932673	K	Y	69	88
PSM	AADISESSGADCK	1355	sp|O43583|DENR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:1,12-UNIMOD:4	ms_run[1]:scan=1.1.8565.11	93.93333	2	1351.5522	1351.5557	M	G	2	15
PSM	ASVSSATFSGHGAR	1356	sp|Q7Z4H3|HDDC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:1	ms_run[1]:scan=1.1.9536.9	119.7145	2	1375.6427	1375.6475	M	S	2	16
PSM	IRYESLTDPSK	1357	sp|Q58FF8|H90B2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.9321.3	113.959	3	1306.677971	1307.672131	K	L	54	65
PSM	NPLPPSVGVVDKK	1358	sp|Q8NC51|PAIRB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.9382.4	115.5741	3	1347.783371	1348.771451	K	E	80	93
PSM	AKPAEAPAAAAPK	1359	sp|P36957|ODO2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.6878.5	49.36055	3	1191.6640	1191.6611	K	A	153	166
PSM	AGAGPGGPPQKPAPSSQR	1360	sp|Q9Y5J1|UTP18_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.6905.11	50.06207	3	1658.8501	1658.8489	K	K	31	49
PSM	HQDVPSQDDSKPTQR	1361	sp|Q9NRN7|ADPPT_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.6786.11	46.8694	3	1736.8084	1736.8078	R	Q	253	268
PSM	KGDVEGSQSQDEGEGSGESER	1362	sp|Q9UQE7|SMC3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.6782.11	46.7621	3	2165.8972	2165.8945	K	G	1059	1080
PSM	HEEQPAPGYDTHGR	1363	sp|Q07157-2|ZO1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.7027.5	53.28342	4	1592.7061	1592.6968	R	L	1077	1091
PSM	DRDYSDHPSGGSYR	1364	sp|P38159-2|RBMX_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.7263.3	59.63453	4	1610.6745	1610.6710	R	D	256	270
PSM	KLEDQNEYESR	1365	sp|Q96SU4-2|OSBL9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.7332.3	61.40765	3	1409.6467	1409.6422	R	S	643	654
PSM	ESRYEEEEEQSR	1366	sp|Q9Y5B9|SP16H_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.7210.9	58.26425	3	1569.6580	1569.6543	R	S	1003	1015
PSM	ACVVHGSDLK	1367	sp|P05023-4|AT1A1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	2-UNIMOD:4	ms_run[1]:scan=1.1.7200.11	58.0011	2	1084.5344	1084.5335	K	D	662	672
PSM	FGGSGSQVDSAR	1368	sp|Q13200|PSMD2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.7310.10	60.84443	2	1166.5326	1166.5316	R	M	358	370
PSM	VPVHDVTDASK	1369	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.7143.11	56.44565	2	1166.5958	1166.5932	K	V	1440	1451
PSM	VSDGGSSSTDFK	1370	sp|Q7Z6Z7-2|HUWE1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.7245.10	59.17762	2	1185.5160	1185.5150	K	M	3543	3555
PSM	ETCFAEEGKK	1371	sp|P02768|ALBU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	3-UNIMOD:4	ms_run[1]:scan=1.1.7137.11	56.28215	2	1197.5346	1197.5336	K	L	589	599
PSM	KESDLNGAQIK	1372	sp|P20700|LMNB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.7276.7	59.973	2	1201.6314	1201.6302	K	L	124	135
PSM	KFHEAQLSEK	1373	sp|O75694-2|NU155_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.7206.5	58.1528	3	1215.6187	1215.6248	R	I	707	717
PSM	FCENTQAGEGR	1374	sp|Q92896|GSLG1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	2-UNIMOD:4	ms_run[1]:scan=1.1.7168.10	57.12685	2	1267.5270	1267.5251	R	V	323	334
PSM	MDSTEPPYSQK	1375	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	1-UNIMOD:35	ms_run[1]:scan=1.1.7314.10	60.94633	2	1297.5490	1297.5496	K	R	155	166
PSM	PGPTPSGTNVGSSGR	1376	sp|P60468|SC61B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.7203.10	58.08127	2	1369.6594	1369.6586	M	S	2	17
PSM	AHVQEVAQHNLK	1377	sp|Q86UP2-4|KTN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.7116.6	55.69945	3	1372.7257	1372.7211	K	E	909	921
PSM	ETPAATEAPSSTPK	1378	sp|P80723|BASP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.7222.11	58.59025	2	1385.6666	1385.6674	K	A	185	199
PSM	GRDVIAQSQSGTGK	1379	sp|P38919|IF4A3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.6989.4	52.31385	3	1402.7173	1402.7165	K	T	75	89
PSM	LQAENDASKEEVK	1380	sp|P33176|KINH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.7119.9	55.78658	3	1459.7197	1459.7154	R	E	477	490
PSM	LDNTNEYNSNDGK	1381	sp|Q5T7N2|LITD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.7095.11	55.13723	2	1482.6250	1482.6223	K	K	146	159
PSM	AEDGATPSPSNETPK	1382	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.7184.10	57.56305	2	1499.6754	1499.6740	K	K	138	153
PSM	TCNCETEDYGEK	1383	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	2-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=1.1.7229.9	58.77077	2	1504.5454	1504.5446	K	F	369	381
PSM	EEPAAAGSGAASPSAAEK	1384	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.7165.11	57.04687	2	1599.7378	1599.7376	K	G	70	88
PSM	EWSQHINGASHSR	1385	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.7537.4	66.91142	4	1507.6969	1507.6916	K	R	305	318
PSM	KHSHTNLSISTGVTK	1386	sp|Q5T7N2|LITD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.7509.6	66.16399	4	1608.8605	1608.8584	K	L	571	586
PSM	VLANPGNSQVAR	1387	sp|Q14974|IMB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.7587.3	68.25671	3	1224.6628	1224.6575	R	V	43	55
PSM	SESPKEPEQLR	1388	sp|P09651-2|ROA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.7411.5	63.52743	3	1298.6479	1298.6466	K	K	4	15
PSM	RIAELSEDDQK	1389	sp|Q9BZE4|NOG1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.7622.4	69.19918	3	1302.6445	1302.6415	K	I	295	306
PSM	LHDSSGSQVGTGFK	1390	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.7684.11	70.86215	3	1418.6800	1418.6790	K	S	1829	1843
PSM	AAAAAAALQAK	1391	sp|P36578|RL4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.7506.7	66.08662	2	955.5460	955.5450	K	S	354	365
PSM	TLENQSHETLER	1392	sp|P48681|NEST_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.7595.8	68.48164	3	1455.6985	1455.6954	K	E	559	571
PSM	EGVHGGLINK	1393	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.7435.9	64.18373	2	1022.5538	1022.5509	K	K	117	127
PSM	LLQAAAGASAR	1394	sp|Q96T76-8|MMS19_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.7622.7	69.20419	2	1027.5776	1027.5774	K	A	395	406
PSM	HSEAATAQREEWK	1395	sp|Q14103-3|HNRPD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.7372.7	62.47717	3	1541.7220	1541.7222	R	M	86	99
PSM	AAIISAEGDSK	1396	sp|P35232|PHB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.7690.10	71.02122	2	1060.5402	1060.5400	K	A	209	220
PSM	KLLADQAEAR	1397	sp|P84098|RL19_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.7406.8	63.39713	2	1113.6146	1113.6142	K	R	153	163
PSM	ESGASVDEVAR	1398	sp|P50579-2|MAP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.7477.11	65.32497	2	1118.5228	1118.5204	K	Q	58	69
PSM	KGESGQSWPR	1399	sp|Q15185-3|TEBP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.7459.9	64.83331	2	1130.5490	1130.5469	R	L	79	89
PSM	TFVSGACDASSK	1400	sp|Q9HAV0|GBB4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	7-UNIMOD:4	ms_run[1]:scan=1.1.7702.11	71.34435	2	1228.5404	1228.5394	R	L	198	210
PSM	HLIPAANTGESK	1401	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.7522.4	66.50805	3	1236.6520	1236.6462	K	V	107	119
PSM	EMDEAATAEER	1402	sp|Q04637-3|IF4G1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.7490.9	65.66833	2	1250.5090	1250.5085	K	G	827	838
PSM	GGNASGEPGLDQR	1403	sp|Q7LBC6|KDM3B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.7380.10	62.6977	2	1256.5748	1256.5745	K	A	326	339
PSM	LYTSAPNTSQGK	1404	sp|Q5QJE6|TDIF2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.7446.11	64.48486	2	1265.6272	1265.6252	K	D	426	438
PSM	TVLDQQQTPSR	1405	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.7673.8	70.57105	2	1271.6472	1271.6470	K	L	1129	1140
PSM	VFDPQNDKPSK	1406	sp|O15145|ARPC3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.7466.11	65.02647	2	1273.6308	1273.6303	K	W	148	159
PSM	CTDDFNGAQCK	1407	sp|P17980|PRS6A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	1-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.7383.11	62.78053	2	1314.4974	1314.4969	R	A	387	398
PSM	KPALQSSVVATSK	1408	sp|Q9H307|PININ_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.7558.11	67.48769	2	1314.7500	1314.7507	K	E	109	122
PSM	YTQSNSVCYAK	1409	sp|P31939-2|PUR9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	8-UNIMOD:4	ms_run[1]:scan=1.1.7547.10	67.18993	2	1319.5840	1319.5816	K	N	426	437
PSM	VKVETYNDESR	1410	sp|P27694|RFA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.7398.10	63.18385	2	1338.6448	1338.6415	R	I	576	587
PSM	KIIEDQQESLNK	1411	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.7700.10	71.28923	3	1443.7570	1443.7569	K	W	317	329
PSM	EVYQQQQYGSGGR	1412	sp|Q99729-2|ROAA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.7695.10	71.15525	2	1498.6810	1498.6801	K	G	233	246
PSM	TQASSSFQDSSQPAGK	1413	sp|P46087-4|NOP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.7372.11	62.48383	2	1624.7364	1624.7329	K	A	703	719
PSM	EGTCPEAPTDECKPVK	1414	sp|P02787|TRFE_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	4-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.7523.9	66.54317	3	1816.7983	1816.7972	R	W	347	363
PSM	ALTSADGASEEQSQNDEDNQGSEK	1415	sp|Q92552-2|RT27_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.7535.11	66.86922	3	2509.0330	2509.0324	K	L	303	327
PSM	ANGHLLLNSEK	1416	sp|Q9P2J5-2|SYLC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.7936.6	77.39787	3	1194.6397	1194.6357	R	M	652	663
PSM	GLTTTGNSSLNSTSNTK	1417	sp|Q96KR1|ZFR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.7783.9	73.42557	2	1681.8206	1681.8119	K	V	468	485
PSM	YLAEVAAGDDKK	1418	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.7873.7	75.75792	3	1278.6469	1278.6456	R	G	128	140
PSM	RGDIIGVQGNPGK	1419	sp|Q15046-2|SYK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8045.3	80.25903	3	1309.7143	1309.7103	R	T	206	219
PSM	DSLHQPQYVEK	1420	sp|Q93008-1|USP9X_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8011.10	79.3642	3	1342.6537	1342.6517	R	L	402	413
PSM	KGDEVDGVDEVAK	1421	sp|P09874|PARP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.7951.7	77.79156	3	1359.6580	1359.6518	R	K	209	222
PSM	RAGELTEDEVER	1422	sp|P62269|RS18_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.7908.5	76.66679	3	1402.6711	1402.6688	K	V	55	67
PSM	AGFAGDDAPR	1423	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.7757.6	72.74925	2	975.4424	975.4410	K	A	19	29
PSM	DGGGRGPDELEGPDSK	1424	sp|P48634|PRC2A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.7808.10	74.07423	3	1584.6961	1584.7016	R	L	209	225
PSM	TEGTQEADQYADEK	1425	sp|Q02952-2|AKA12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.7931.7	77.26984	3	1583.6590	1583.6587	K	T	1163	1177
PSM	HGTCAAQVDALNSQK	1426	sp|O00584|RNT2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	4-UNIMOD:4	ms_run[1]:scan=1.1.7723.10	71.90383	3	1598.7511	1598.7471	K	K	118	133
PSM	IIHEDGYSEEECR	1427	sp|P04899-5|GNAI2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	12-UNIMOD:4	ms_run[1]:scan=1.1.8076.7	81.0947	3	1635.6862	1635.6835	K	Q	39	52
PSM	EGVLTGSPEQK	1428	sp|Q92616|GCN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.7782.11	73.40315	2	1143.5782	1143.5772	R	E	2270	2281
PSM	VHELNEEIGK	1429	sp|Q9Y383-3|LC7L2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.7959.11	78.01366	2	1166.5920	1166.5931	R	L	123	133
PSM	SGGNEVSIEER	1430	sp|Q15061|WDR43_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.7826.9	74.54308	2	1175.5410	1175.5418	K	L	431	442
PSM	EDGVITASEDR	1431	sp|Q8IWB7|WDFY1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.7924.9	77.09013	2	1190.5526	1190.5415	K	T	36	47
PSM	SEETLDEGPPK	1432	sp|Q00688|FKBP3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.7854.11	75.26407	2	1200.5514	1200.5510	K	Y	100	111
PSM	QEYDESGPSIVHRK	1433	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.7986.3	78.7095	4	1643.7905	1643.7903	K	C	360	374
PSM	QTYSTEPNNLK	1434	sp|P46779|RL28_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.7850.11	75.15963	2	1293.6204	1293.6201	K	A	23	34
PSM	VQEGETIEDGAR	1435	sp|P36639-2|8ODP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.7710.10	71.55745	2	1302.6068	1302.6052	K	R	62	74
PSM	NAWADNANACAK	1436	sp|Q9NTJ5|SAC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	10-UNIMOD:4	ms_run[1]:scan=1.1.8074.11	81.04826	2	1304.5580	1304.5567	K	Q	436	448
PSM	LCTSATESEVAR	1437	sp|P31930|QCR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	2-UNIMOD:4	ms_run[1]:scan=1.1.7923.9	77.0635	2	1322.6140	1322.6136	R	G	379	391
PSM	ADTQTYQPYNK	1438	sp|P84090|ERH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.7736.10	72.2392	2	1327.6046	1327.6044	R	D	74	85
PSM	CASQVGMTAPGTR	1439	sp|Q99439|CNN2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	1-UNIMOD:4	ms_run[1]:scan=1.1.7933.10	77.32674	2	1334.6062	1334.6071	K	R	215	228
PSM	TGCETVDAVQER	1440	sp|O94901-9|SUN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	3-UNIMOD:4	ms_run[1]:scan=1.1.7918.11	76.93293	2	1363.6056	1363.6038	K	V	628	640
PSM	AAFTECCQAADK	1441	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	6-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=1.1.7855.11	75.28963	2	1370.5604	1370.5595	K	A	187	199
PSM	CASQAGMTAYGTR	1442	sp|Q15417|CNN3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	1-UNIMOD:4	ms_run[1]:scan=1.1.8007.11	79.2611	2	1372.5852	1372.5864	K	R	173	186
PSM	ELCQQIHAECK	1443	sp|Q86XP3|DDX42_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	3-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.7860.11	75.41833	2	1414.6314	1414.6333	R	R	337	348
PSM	AINGPTSASGDDISK	1444	sp|P51114|FXR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8012.9	79.39145	2	1431.6820	1431.6841	K	L	579	594
PSM	YICENQDSISSK	1445	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	3-UNIMOD:4	ms_run[1]:scan=1.1.7851.11	75.18577	2	1442.6350	1442.6347	K	L	287	299
PSM	HEQNIDCGGGYVK	1446	sp|P27797|CALR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	7-UNIMOD:4	ms_run[1]:scan=1.1.7790.8	73.60492	3	1475.6488	1475.6463	K	L	99	112
PSM	TAEDYSVDENGQR	1447	sp|O60488-2|ACSL4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.7802.11	73.91652	2	1482.6238	1482.6223	K	W	496	509
PSM	LFQECCPHSTDR	1448	sp|P61978-2|HNRPK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	5-UNIMOD:4,6-UNIMOD:4	ms_run[1]:scan=1.1.8085.9	81.3387	3	1548.6481	1548.6450	K	V	180	192
PSM	EATNPPVIQEEKPK	1449	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8005.10	79.20744	3	1578.8260	1578.8253	R	K	483	497
PSM	EATNPPVIQEEKPK	1450	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.7993.11	78.90148	2	1578.8252	1578.8253	R	K	483	497
PSM	IIHEDGYSEEECR	1451	sp|P04899-5|GNAI2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	12-UNIMOD:4	ms_run[1]:scan=1.1.8057.10	80.59385	3	1635.6862	1635.6835	K	Q	39	52
PSM	RYESHPVCADLQAK	1452	sp|Q9NX63|MIC19_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	8-UNIMOD:4	ms_run[1]:scan=1.1.7911.8	76.74509	3	1672.8016	1672.7991	K	I	176	190
PSM	VAPAEPQEAPDSTAAGGSASK	1453	sp|Q3LXA3-2|TKFC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.7725.11	71.95805	2	1939.9154	1939.9123	R	R	352	373
PSM	TPASPVVHIR	1454	sp|P14866|HNRPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8347.3	88.1255	3	1075.6171	1075.6138	K	G	98	108
PSM	LENPDEACAVSQK	1455	sp|Q5T4S7-2|UBR4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	8-UNIMOD:4	ms_run[1]:scan=1.1.8144.9	82.85578	2	1459.6646	1459.6613	R	H	115	128
PSM	RFPGYDSESK	1456	sp|P46777|RL5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8090.6	81.46768	3	1184.5495	1184.5462	K	E	179	189
PSM	RFPGYDSESK	1457	sp|P46777|RL5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8110.5	81.9825	3	1184.5495	1184.5462	K	E	179	189
PSM	KEEELQGALAR	1458	sp|P35580-3|MYH10_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8453.6	90.94489	3	1242.6601	1242.6568	K	G	1109	1120
PSM	FACHSASLTVR	1459	sp|Q15233-2|NONO_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	3-UNIMOD:4	ms_run[1]:scan=1.1.8440.3	90.59095	3	1247.6110	1247.6081	R	N	54	65
PSM	FACHSASLTVR	1460	sp|Q15233-2|NONO_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	3-UNIMOD:4	ms_run[1]:scan=1.1.8439.6	90.56902	3	1247.6110	1247.6081	R	N	54	65
PSM	AQIHALEGGEVK	1461	sp|P18858-3|DNLI1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8295.5	86.74844	3	1250.6647	1250.6619	R	I	543	555
PSM	ISSDLDGHPVPK	1462	sp|P29401-2|TKT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8396.4	89.43563	3	1263.6496	1263.6459	K	Q	103	115
PSM	KVIDQQNGLYR	1463	sp|P27694|RFA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8179.5	83.75616	3	1332.7093	1332.7150	K	C	489	500
PSM	AVVVCPKDEDYK	1464	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	5-UNIMOD:4	ms_run[1]:scan=1.1.8276.8	86.2455	3	1421.6857	1421.6861	K	Q	584	596
PSM	LSSEMNTSTVNSAR	1465	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8299.10	86.86237	3	1495.6921	1495.6936	R	E	277	291
PSM	RTSSAQVEGGVHSLHSYEK	1466	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8461.8	91.16327	4	2071.0077	2071.0083	K	R	493	512
PSM	TTHFVEGGDAGNREDQINR	1467	sp|P18124|RL7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8253.6	85.64304	4	2114.9729	2114.9730	K	L	224	243
PSM	TPASPVVHIR	1468	sp|P14866|HNRPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8366.2	88.63105	3	1075.6171	1075.6138	K	G	98	108
PSM	AQQGPSAQGKPTYFR	1469	sp|Q9H9Z2|LN28A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8435.8	90.46487	3	1634.8144	1634.8165	K	E	178	193
PSM	LQETLSAADR	1470	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8364.11	88.59247	2	1102.5610	1102.5618	R	C	15	25
PSM	VVGCSCVVVK	1471	sp|P25398|RS12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	4-UNIMOD:4,6-UNIMOD:4	ms_run[1]:scan=1.1.8235.7	85.19115	2	1105.5606	1105.5624	K	D	103	113
PSM	VVGCSCVVVK	1472	sp|P25398|RS12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	4-UNIMOD:4,6-UNIMOD:4	ms_run[1]:scan=1.1.8255.10	85.70068	2	1105.5606	1105.5624	K	D	103	113
PSM	SGTDVDAANLR	1473	sp|P42574|CASP3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8254.6	85.6701	2	1117.5370	1117.5364	R	E	65	76
PSM	ALANSLACQGK	1474	sp|P04075-2|ALDOA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	8-UNIMOD:4	ms_run[1]:scan=1.1.8131.10	82.52585	2	1131.5704	1131.5706	R	Y	386	397
PSM	LEGQGDVPTPK	1475	sp|Q9Y2Z0-2|SGT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8138.11	82.70599	2	1139.5826	1139.5823	K	Q	225	236
PSM	TPDGQGLSTYK	1476	sp|Q5VYK3|ECM29_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8204.4	84.39888	2	1165.5632	1165.5615	K	E	1057	1068
PSM	LACDVDQVTR	1477	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	3-UNIMOD:4	ms_run[1]:scan=1.1.8440.11	90.60429	2	1175.5588	1175.5605	R	Q	972	982
PSM	LGNSADALESAK	1478	sp|O96011-2|PX11B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8378.9	88.96492	2	1174.5824	1174.5829	R	R	47	59
PSM	QAQILASEAEK	1479	sp|Q9UJZ1-2|STML2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8206.11	84.45657	2	1186.6204	1186.6193	K	A	178	189
PSM	NCIAQTSAVVK	1480	sp|Q4VC31|CCD58_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	2-UNIMOD:4	ms_run[1]:scan=1.1.8257.10	85.75183	2	1189.6122	1189.6125	K	N	73	84
PSM	EGALCEENMR	1481	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	5-UNIMOD:4	ms_run[1]:scan=1.1.8240.6	85.31464	2	1207.4974	1207.4961	K	G	689	699
PSM	ASDPGLPAEEPK	1482	sp|P27708|PYR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8410.11	89.80895	2	1209.5866	1209.5877	R	E	1858	1870
PSM	FACHSASLTVR	1483	sp|Q15233-2|NONO_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	3-UNIMOD:4	ms_run[1]:scan=1.1.8444.5	90.70161	3	1247.6110	1247.6081	R	N	54	65
PSM	FACHSASLTVR	1484	sp|Q15233-2|NONO_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	3-UNIMOD:4	ms_run[1]:scan=1.1.8442.6	90.64955	3	1247.6110	1247.6081	R	N	54	65
PSM	ASRDEIFAQSK	1485	sp|P35580-3|MYH10_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8111.5	82.00795	3	1250.6299	1250.6255	R	E	1687	1698
PSM	NNASTDYDLSDK	1486	sp|P39023|RL3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8341.6	87.9721	3	1341.5692	1341.5684	K	S	301	313
PSM	NNASTDYDLSDK	1487	sp|P39023|RL3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8360.11	88.4854	2	1341.5662	1341.5684	K	S	301	313
PSM	KIGQQPQQPGAPPQQDYTK	1488	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8276.11	86.2505	3	2108.0665	2108.0651	K	A	628	647
PSM	AEEDTQFNYHR	1489	sp|Q14683|SMC1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8404.11	89.65452	2	1408.5992	1408.6007	K	K	178	189
PSM	GMTSLQCDCTEK	1490	sp|Q9BTE7|DCNL5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	7-UNIMOD:4,9-UNIMOD:4	ms_run[1]:scan=1.1.8157.10	83.19286	2	1428.5664	1428.5683	K	L	109	121
PSM	YICENQDSISSK	1491	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	3-UNIMOD:4	ms_run[1]:scan=1.1.8151.11	83.03841	2	1442.6358	1442.6347	K	L	287	299
PSM	YICENQDSISSK	1492	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	3-UNIMOD:4	ms_run[1]:scan=1.1.8127.6	82.41728	3	1442.6374	1442.6347	K	L	287	299
PSM	STSLETQDDDNIR	1493	sp|Q6IA86-5|ELP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8361.11	88.51208	2	1492.6628	1492.6641	K	L	281	294
PSM	ETNISYSQEADDR	1494	sp|O00116|ADAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8423.11	90.14792	2	1526.6450	1526.6485	K	V	170	183
PSM	ASLQETHFDSTQTK	1495	sp|O94888|UBXN7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8415.9	89.93465	3	1591.7482	1591.7478	R	Q	296	310
PSM	MKETAENYLGHTAK	1496	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8327.11	87.6108	2	1591.7642	1591.7664	K	N	174	188
PSM	RGPQLVCTGSDDGTVK	1497	sp|Q96DI7-2|SNR40_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	7-UNIMOD:4	ms_run[1]:scan=1.1.8384.8	89.12357	3	1688.8129	1688.8152	R	L	162	178
PSM	FRPAGAAPRPPPKPM	1498	sp|Q5JNZ5|RS26L_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8614.2	95.19192	4	1588.8689	1588.8660	R	-	101	116
PSM	AGVENGKPTHFTVYTK	1499	sp|O75369-2|FLNB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8773.3	99.47311	4	1747.8913	1747.8893	K	G	858	874
PSM	LCSSVVIEDPKK	1500	sp|Q0VF96|CGNL1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	2-UNIMOD:4	ms_run[1]:scan=1.1.8811.7	100.5028	3	1373.7241	1373.7224	R	Q	218	230
PSM	APLKPYPVSPSDK	1501	sp|P41252|SYIC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8612.8	95.14828	3	1397.7553	1397.7554	K	V	1039	1052
PSM	SIRPDNMSEYSK	1502	sp|Q13547|HDAC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8503.6	92.27216	3	1425.6559	1425.6558	R	Q	78	90
PSM	PAASITSKPATLTTTSATSK	1503	sp|O43670-2|ZN207_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8801.5	100.2295	4	1933.0321	1933.0368	K	L	328	348
PSM	EGEDSSVIHYDDK	1504	sp|Q14839-2|CHD4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8676.8	96.86707	3	1492.6336	1492.6318	K	A	1240	1253
PSM	AAGARPLTSPESLSR	1505	sp|P46379-2|BAG6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8811.9	100.5061	3	1511.8051	1511.8056	K	D	1067	1082
PSM	SQAPGQPGASQWGSR	1506	sp|Q96EP5-2|DAZP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8612.9	95.14995	3	1512.7087	1512.7070	K	V	195	210
PSM	HELQANCYEEVK	1507	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	7-UNIMOD:4	ms_run[1]:scan=1.1.8518.6	92.66843	3	1518.6766	1518.6773	K	D	133	145
PSM	LQMEQQQQLQQR	1508	sp|Q9NS69|TOM22_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8752.9	98.91627	3	1556.7712	1556.7729	K	Q	106	118
PSM	VDEVPDGAVKPPTNK	1509	sp|O75475|PSIP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8656.7	96.329	3	1564.8094	1564.8097	R	L	25	40
PSM	VDNDENEHQLSLR	1510	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8728.8	98.26691	3	1567.7209	1567.7226	K	T	33	46
PSM	SVEAAAELSAK	1511	sp|P20962|PTMS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8570.5	94.05595	2	1074.5548	1074.5557	K	D	5	16
PSM	YLAEVATGEK	1512	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8692.6	97.29568	2	1079.5494	1079.5499	R	R	133	143
PSM	FNAHGDANTIVCNSK	1513	sp|P09382|LEG1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	12-UNIMOD:4	ms_run[1]:scan=1.1.8555.10	93.66255	3	1646.7463	1646.7471	R	D	50	65
PSM	FAEALGSTEAK	1514	sp|P78347-2|GTF2I_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8764.11	99.24406	2	1122.5544	1122.5557	K	A	437	448
PSM	FVGQDVEGER	1515	sp|P17812|PYRG1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8556.10	93.68937	2	1134.5300	1134.5306	K	M	499	509
PSM	DPQALSEHLK	1516	sp|P31948|STIP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8686.9	97.1388	2	1136.5814	1136.5826	K	N	514	524
PSM	SLKDEDVLQK	1517	sp|Q9NZ01|TECR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8500.3	92.18806	3	1173.6283	1173.6241	K	L	58	68
PSM	VIQVAAGSSNLK	1518	sp|P05091-2|ALDH2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8831.8	101.0402	2	1185.6688	1185.6717	R	R	222	234
PSM	EATDAIGHLDR	1519	sp|Q12906-7|ILF3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8781.11	99.702	2	1196.5760	1196.5786	K	Q	298	309
PSM	HRPELIDYGK	1520	sp|P12814-2|ACTN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8634.5	95.73431	3	1226.6434	1226.6407	R	L	186	196
PSM	AFDTAGNGYCR	1521	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	10-UNIMOD:4	ms_run[1]:scan=1.1.8539.11	93.23327	2	1230.5072	1230.5088	K	S	214	225
PSM	FEDVVNQSSPK	1522	sp|Q01085-2|TIAR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8735.10	98.45882	2	1248.5936	1248.5986	R	N	210	221
PSM	IDEPLEGSEDR	1523	sp|P61978-2|HNRPK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8812.11	100.5366	2	1258.5660	1258.5677	K	I	423	434
PSM	IDEPLEGSEDR	1524	sp|P61978-2|HNRPK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8774.8	99.50837	2	1258.5660	1258.5677	K	I	423	434
PSM	HPDADSLYVEK	1525	sp|P54577|SYYC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8787.10	99.86165	2	1272.5986	1272.5986	K	I	381	392
PSM	NFSDNQLQEGK	1526	sp|P37802-2|TAGL2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8605.7	94.95928	2	1278.5822	1278.5840	R	N	182	193
PSM	VEDVVVSDECR	1527	sp|Q96EK6|GNA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	10-UNIMOD:4	ms_run[1]:scan=1.1.8651.11	96.20174	2	1305.5848	1305.5871	R	G	119	130
PSM	GGGPAGAGGEAPAALR	1528	sp|Q5RKV6|EXOS6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8644.10	96.01172	2	1307.6544	1307.6582	R	G	78	94
PSM	FSGDLDDQTCR	1529	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	10-UNIMOD:4	ms_run[1]:scan=1.1.8677.11	96.89919	2	1312.5328	1312.5354	K	E	236	247
PSM	FHHTFSTEIAK	1530	sp|P13667|PDIA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8531.6	93.0111	3	1316.6488	1316.6513	K	F	336	347
PSM	NLDGISHAPNAVK	1531	sp|Q92820|GGH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8686.11	97.14214	2	1334.6912	1334.6942	K	T	254	267
PSM	VVTDTDETELAR	1532	sp|P05198|IF2A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8822.10	100.8047	2	1347.6502	1347.6518	K	Q	277	289
PSM	SEPIPESNDGPVK	1533	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8591.7	94.60053	2	1367.6538	1367.6569	K	V	367	380
PSM	ISVYYNEASSHK	1534	sp|Q13509|TBB3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8739.11	98.56852	2	1396.6588	1396.6623	R	Y	47	59
PSM	GEDEEENNLEVR	1535	sp|P04843|RPN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8523.7	92.80088	3	1431.6133	1431.6113	K	E	90	102
PSM	AGGAAVVITEPEHTK	1536	sp|Q9P258|RCC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8496.11	92.09666	2	1478.7714	1478.7729	K	E	78	93
PSM	QCVENADLPEGEK	1537	sp|Q99460-2|PSMD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	2-UNIMOD:4	ms_run[1]:scan=1.1.8513.11	92.54553	2	1487.6538	1487.6562	K	K	111	124
PSM	YNLDASEEEDSNK	1538	sp|O95218-2|ZRAB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8663.11	96.52265	2	1512.6194	1512.6216	K	K	183	196
PSM	TSSFAEPGGGGGGGGGGPGGSASGPGGTGGGK	1539	sp|P49840|GSK3A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8626.11	95.52928	3	2432.0533	2432.0590	R	A	19	51
PSM	FNAHGDANTIVCNSK	1540	sp|P09382|LEG1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	12-UNIMOD:4	ms_run[1]:scan=1.1.8536.9	93.1495	3	1646.7463	1646.7471	R	D	50	65
PSM	HALHCTILASAGQQR	1541	sp|Q9BT78|CSN4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	5-UNIMOD:4	ms_run[1]:scan=1.1.8609.5	95.06285	3	1661.8399	1661.8420	K	S	228	243
PSM	INNLNVEENSSGDQR	1542	sp|Q9Y5V3-2|MAGD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8509.9	92.43653	3	1687.7719	1687.7761	K	R	308	323
PSM	RQAVTNPNNTFYATK	1543	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8676.11	96.87207	2	1723.8614	1723.8642	K	R	107	122
PSM	VSEEAESQQQWDTSK	1544	sp|Q01082-2|SPTB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8747.10	98.78285	2	1750.7624	1750.7646	K	G	2109	2124
PSM	EYSSELNAPSQESDSHPR	1545	sp|P49756|RBM25_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8585.8	94.44528	3	2031.8755	2031.8770	R	K	217	235
PSM	HQALQAEIAGHEPR	1546	sp|Q13813|SPTN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8988.2	105.1464	4	1555.7865	1555.7855	K	I	826	840
PSM	LLYNRPGTVSSLKK	1547	sp|P35659|DEK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8881.2	102.3376	4	1574.9173	1574.9144	K	N	112	126
PSM	AQEPESGLSEETQVK	1548	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9107.11	108.3106	2	1630.7680	1630.7686	R	C	4091	4106
PSM	MKETAEAYLGK	1549	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8975.5	104.8108	3	1239.6178	1239.6169	K	K	153	164
PSM	GISVHISNAEPK	1550	sp|Q13148|TADBP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9107.5	108.3006	3	1250.6647	1250.6619	K	H	252	264
PSM	DCHLAQVPSHTVVAR	1551	sp|P02787|TRFE_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	2-UNIMOD:4	ms_run[1]:scan=1.1.9090.3	107.8593	4	1688.8421	1688.8417	K	S	259	274
PSM	LITQTFSHHNQLAQK	1552	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8885.8	102.4505	4	1764.9285	1764.9271	K	T	54	69
PSM	NPSDSAVHSPFTK	1553	sp|Q14157-5|UBP2L_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9162.4	109.74	3	1385.6542	1385.6575	K	R	408	421
PSM	CTGGEVGATSALAPK	1554	sp|P30050-2|RL12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	1-UNIMOD:4	ms_run[1]:scan=1.1.8965.5	104.5433	3	1417.6879	1417.6871	R	I	17	32
PSM	RGVSCQFGPDVTK	1555	sp|P53041|PPP5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	5-UNIMOD:4	ms_run[1]:scan=1.1.8950.6	104.143	3	1449.7039	1449.7035	K	A	400	413
PSM	VIMVGSGGVGK	1556	sp|P11233|RALA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9045.7	106.6743	2	1002.5514	1002.5532	K	S	17	28
PSM	TGLAVTVGQAK	1557	sp|Q13428-4|TCOF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9040.6	106.5389	2	1043.5968	1043.5975	K	S	706	717
PSM	AEPVEVVAPR	1558	sp|P09874|PARP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9065.10	107.2137	2	1065.5812	1065.5818	K	G	487	497
PSM	QVLVAPGNAGTACSEK	1559	sp|P22102|PUR2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	13-UNIMOD:4	ms_run[1]:scan=1.1.8839.6	101.2459	3	1600.8013	1600.7879	K	I	29	45
PSM	SIGTANRPMGAGEALR	1560	sp|Q12906-7|ILF3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9104.7	108.2264	3	1599.8107	1599.8151	K	R	258	274
PSM	ALAAGGYDVEK	1561	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9017.9	105.9287	2	1092.5432	1092.5451	K	N	68	79
PSM	GSFSDTGLGDGK	1562	sp|Q9Y2W1|TR150_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9010.8	105.7404	2	1139.5078	1139.5095	K	M	376	388
PSM	VLTVINQTQK	1563	sp|P42766|RL35_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8847.9	101.4588	2	1142.6642	1142.6659	R	E	57	67
PSM	VLTVINQTQK	1564	sp|P42766|RL35_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8844.7	101.378	2	1142.6642	1142.6659	R	E	57	67
PSM	VLTVINQTQK	1565	sp|P42766|RL35_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8839.7	101.2475	2	1142.6642	1142.6659	R	E	57	67
PSM	LFPVCHDSDESDTAK	1566	sp|Q9Y6K1|DNM3A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	5-UNIMOD:4	ms_run[1]:scan=1.1.8944.9	103.9875	3	1719.7393	1719.7410	K	A	383	398
PSM	EITALAPSTMK	1567	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	10-UNIMOD:35	ms_run[1]:scan=1.1.8902.11	102.8914	2	1176.6028	1176.6060	K	I	316	327
PSM	QPAPTTIGGLNK	1568	sp|P27816-6|MAP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9051.7	106.8343	2	1195.6534	1195.6561	K	K	727	739
PSM	IDEELVTNSGK	1569	sp|Q9NRZ9-2|HELLS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9009.8	105.7138	2	1203.5968	1203.5983	K	F	574	585
PSM	GVVEVTHDLQK	1570	sp|P50454|SERPH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9097.8	108.048	2	1223.6482	1223.6510	K	H	309	320
PSM	SSASFSTTAVSAR	1571	sp|P61764|STXB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8839.11	101.2542	2	1270.6178	1270.6153	R	Y	506	519
PSM	AEITLVATKPEK	1572	sp|Q9UBF2|COPG2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9192.4	110.5407	3	1298.7445	1298.7445	K	L	591	603
PSM	AEFAAPSTDAPDK	1573	sp|Q96B26|EXOS8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9022.10	106.0642	2	1318.6002	1318.6041	K	G	64	77
PSM	VQIAANEETQEREEQMK	1574	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8889.9	102.5584	3	2031.9469	2031.9531	K	E	456	473
PSM	AAECNIVVTQPR	1575	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	4-UNIMOD:4	ms_run[1]:scan=1.1.9035.11	106.4136	2	1356.6794	1356.6820	R	R	435	447
PSM	NPSDSAVHSPFTK	1576	sp|Q14157-5|UBP2L_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9181.6	110.2541	3	1385.6542	1385.6575	K	R	408	421
PSM	GTGEAEEEYVGPR	1577	sp|Q13895|BYST_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8942.10	103.9355	2	1392.6124	1392.6157	R	L	41	54
PSM	TIQGHLQSENFK	1578	sp|O15042-2|SR140_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8958.11	104.3655	2	1400.7034	1400.7048	R	Q	635	647
PSM	DVASTAGEEGDTSLR	1579	sp|Q8ND24|RN214_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9055.11	106.948	2	1506.6794	1506.6798	K	E	111	126
PSM	APVPGTPDSLSSGSSR	1580	sp|Q9UJZ1-2|STML2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9140.11	109.1633	2	1513.7328	1513.7373	K	D	277	293
PSM	ICDECNYGSYQGR	1581	sp|Q7RTV0|PHF5A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	2-UNIMOD:4,5-UNIMOD:4	ms_run[1]:scan=1.1.8910.11	103.0964	2	1620.6248	1620.6297	R	C	45	58
PSM	ELNNTCEPVVTQPK	1582	sp|Q92598-2|HS105_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	6-UNIMOD:4	ms_run[1]:scan=1.1.8948.10	104.0962	2	1627.7868	1627.7876	K	P	747	761
PSM	AAAAAWEEPSSGNGTAR	1583	sp|Q9P258|RCC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9075.11	107.4786	2	1644.7466	1644.7492	K	A	6	23
PSM	IEALQNHENESVYK	1584	sp|P52292|IMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9010.6	105.7371	3	1672.8031	1672.8056	K	A	473	487
PSM	STAGDTHLGGEDFDNR	1585	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9158.9	109.6409	3	1690.7176	1690.7183	K	M	221	237
PSM	EQTEGEYSSLEHESAR	1586	sp|O43837-2|IDH3B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9096.10	108.0256	3	1850.7874	1850.7918	R	G	165	181
PSM	VQIAANEETQEREEQMK	1587	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8930.11	103.6178	3	2031.9490	2031.9531	K	E	456	473
PSM	VCEIHFHEINNK	1588	sp|Q96DH6-2|MSI2H_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	2-UNIMOD:4	ms_run[1]:scan=1.1.9328.4	114.1435	4	1538.7341	1538.7300	K	M	163	175
PSM	DHVVSDFSEHGSLK	1589	sp|P54886-2|P5CS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9324.4	114.039	4	1555.7345	1555.7267	K	Y	766	780
PSM	AGIATHFVDSEK	1590	sp|Q6NVY1|HIBCH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9391.2	115.8135	3	1273.6321	1273.6303	R	L	210	222
PSM	VCDEPHPLLVK	1591	sp|P35250-2|RFC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	2-UNIMOD:4	ms_run[1]:scan=1.1.9301.3	113.4248	3	1305.6745	1305.6751	K	E	220	231
PSM	VCDEPHPLLVK	1592	sp|P35250-2|RFC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	2-UNIMOD:4	ms_run[1]:scan=1.1.9302.2	113.4501	3	1305.6745	1305.6751	K	E	220	231
PSM	KLEEEGEQFVK	1593	sp|P22307-7|NLTP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9395.3	115.9232	3	1334.6737	1334.6718	K	K	399	410
PSM	DAHSIHGTNPQYLVEK	1594	sp|Q8NAV1|PR38A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9473.3	118.0129	4	1807.8857	1807.8853	K	I	8	24
PSM	SGNIVAGIANESKK	1595	sp|P49915|GUAA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9409.5	116.3034	3	1386.7459	1386.7467	R	L	170	184
PSM	KLQEESDLELAK	1596	sp|O75822-2|EIF3J_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9509.7	118.987	3	1401.7345	1401.7351	K	E	122	134
PSM	NIVHNYSEAEIK	1597	sp|Q9Y6I3-3|EPN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9307.7	113.593	3	1415.7034	1415.7045	K	V	12	24
PSM	TLQAGLSSNHVSHGEVLR	1598	sp|O95163|ELP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9440.6	117.1274	4	1903.9861	1903.9864	K	K	672	690
PSM	TVFAEHISDECK	1599	sp|P39023|RL3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	11-UNIMOD:4	ms_run[1]:scan=1.1.9422.7	116.6478	3	1434.6442	1434.6449	K	R	104	116
PSM	KQEVQAWDGEVR	1600	sp|P45974-2|UBP5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9368.7	115.2029	3	1443.7105	1443.7106	R	Q	163	175
PSM	AQQALSELHTVEK	1601	sp|Q5T4S7-2|UBR4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9515.8	119.15	3	1452.7654	1452.7572	R	A	1838	1851
PSM	TNTPVKEDWNVR	1602	sp|P78347-2|GTF2I_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9518.7	119.229	3	1457.7229	1457.7263	R	I	515	527
PSM	CYSCGEFGHIQK	1603	sp|P62633-2|CNBP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	1-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=1.1.9407.6	116.2513	3	1484.6167	1484.6177	K	D	112	124
PSM	ASTSGLGIKDEGDIK	1604	sp|Q15047-3|SETB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9213.6	111.0983	3	1489.7629	1489.7624	K	Q	1024	1039
PSM	LVLVGDGGTGK	1605	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9402.9	116.122	2	1014.5696	1014.5710	K	T	13	24
PSM	EDQSILCTGESGAGK	1606	sp|P35580-3|MYH10_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	7-UNIMOD:4	ms_run[1]:scan=1.1.9445.6	117.2624	3	1550.6863	1550.6882	R	T	170	185
PSM	HQAFEAELSANQSR	1607	sp|Q13813|SPTN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9436.9	117.0246	3	1586.7418	1586.7437	K	I	614	628
PSM	IQALQQQADEAEDR	1608	sp|P67936|TPM4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9375.6	115.3887	3	1613.7640	1613.7645	K	A	14	28
PSM	LTLQHVNSNQCLDK	1609	sp|Q10472|GALT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	11-UNIMOD:4	ms_run[1]:scan=1.1.9214.8	111.1282	3	1668.8239	1668.8253	K	A	513	527
PSM	SSDEAVILCK	1610	sp|Q9UNM6-2|PSD13_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	9-UNIMOD:4	ms_run[1]:scan=1.1.9224.7	111.3943	2	1120.5404	1120.5434	K	T	108	118
PSM	GAGLGFSTAPNK	1611	sp|Q1ED39|KNOP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9460.8	117.6709	2	1118.5702	1118.5720	R	I	431	443
PSM	QDAQSLLAPGK	1612	sp|Q9UDR5|AASS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9524.9	119.3935	2	1126.5960	1126.5982	R	F	323	334
PSM	THSTSSSLGSGESPFSR	1613	sp|Q9UGV2-2|NDRG3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9426.10	116.7582	3	1722.7828	1722.7809	R	S	317	334
PSM	ESLAEEHEGLVGEGQR	1614	sp|Q10570|CPSF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9498.10	118.697	3	1738.8097	1738.8122	R	S	167	183
PSM	LRQDFEEVTTQNEK	1615	sp|Q5VTR2|BRE1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9378.7	115.4712	3	1735.8190	1735.8377	K	L	349	363
PSM	QLAGQSFYQK	1616	sp|Q8WUP2-2|FBLI1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9470.11	117.9454	2	1168.5862	1168.5877	R	D	217	227
PSM	VILGSEAAQQHPEEVR	1617	sp|Q9NY33-4|DPP3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9295.8	113.2716	3	1761.8956	1761.9009	R	G	96	112
PSM	KHEAFETDFTVHK	1618	sp|Q13813|SPTN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9495.3	118.6046	4	1587.7697	1587.7682	K	D	1911	1924
PSM	YLAPSGPSGTLK	1619	sp|Q16658|FSCN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9391.7	115.8219	2	1189.6320	1189.6343	R	A	230	242
PSM	EAAENSLVAYK	1620	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9482.9	118.2653	2	1193.5922	1193.5928	K	A	143	154
PSM	VVVVTGANTGIGK	1621	sp|Q8TC12|RDH11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9370.11	115.2632	2	1213.7000	1213.7031	K	E	43	56
PSM	VADMALHYANK	1622	sp|P50990-2|TCPQ_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9212.9	111.0769	2	1231.5982	1231.6019	K	Y	278	289
PSM	DQVANSAFVER	1623	sp|P07900-2|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9335.4	114.3277	3	1234.5964	1234.5942	K	L	622	633
PSM	AENYDIPSADR	1624	sp|P22314|UBA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9343.8	114.5439	2	1249.5560	1249.5575	R	H	870	881
PSM	QELILSNSEDK	1625	sp|P53621-2|COPA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9474.9	118.0498	2	1274.6328	1274.6354	R	S	261	272
PSM	LQNNNVYTIAK	1626	sp|P63010-2|AP2B1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9291.11	113.169	2	1276.6734	1276.6775	K	R	882	893
PSM	EALQDVEDENQ	1627	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9483.10	118.2937	2	1288.5392	1288.5419	K	-	245	256
PSM	LNQLKPGLQYK	1628	sp|Q12906-7|ILF3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9317.5	113.8575	3	1300.7518	1300.7503	R	L	409	420
PSM	VCDEPHPLLVK	1629	sp|P35250-2|RFC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	2-UNIMOD:4	ms_run[1]:scan=1.1.9295.4	113.2649	3	1305.6745	1305.6751	K	E	220	231
PSM	VCDEPHPLLVK	1630	sp|P35250-2|RFC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	2-UNIMOD:4	ms_run[1]:scan=1.1.9298.5	113.3472	3	1305.6745	1305.6751	K	E	220	231
PSM	VCDEPHPLLVK	1631	sp|P35250-2|RFC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	2-UNIMOD:4	ms_run[1]:scan=1.1.9299.5	113.374	3	1305.6745	1305.6751	K	E	220	231
PSM	VCDEPHPLLVK	1632	sp|P35250-2|RFC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	2-UNIMOD:4	ms_run[1]:scan=1.1.9296.2	113.2885	3	1305.6745	1305.6751	K	E	220	231
PSM	GVQVETISPGDGR	1633	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9318.9	113.8904	2	1313.6544	1313.6576	M	T	2	15
PSM	VEGELEEMERK	1634	sp|P35580-3|MYH10_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9227.9	111.4782	2	1347.6300	1347.6340	K	H	892	903
PSM	NPLPPSVGVVDKK	1635	sp|Q8NC51-3|PAIRB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9463.7	117.7501	3	1348.7704	1348.7715	K	E	80	93
PSM	LEGEACGVYTPR	1636	sp|P18065|IBP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	6-UNIMOD:4	ms_run[1]:scan=1.1.9302.11	113.4651	2	1350.6184	1350.6238	R	C	93	105
PSM	VDVGKDQEFTVK	1637	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9444.11	117.2438	2	1363.6954	1363.6984	K	S	983	995
PSM	AHSSMVGVNLPQK	1638	sp|P00558|PGK1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9434.11	116.974	2	1366.6994	1366.7027	R	A	172	185
PSM	SGYGFNEPEQSR	1639	sp|Q5BKZ1|ZN326_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9403.11	116.1521	2	1369.5862	1369.5898	R	F	91	103
PSM	VLIGGDETPEGQR	1640	sp|O60701|UGDH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9255.11	112.2241	2	1369.6770	1369.6838	R	A	178	191
PSM	TNAENEFVTIKK	1641	sp|P04264|K2C1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9520.11	119.2894	2	1392.7212	1392.7249	R	D	278	290
PSM	TLSGAQDSEAAFAK	1642	sp|Q15554|TERF2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9454.11	117.5139	2	1394.6646	1394.6678	K	L	336	350
PSM	YMPQNPHIIATK	1643	sp|Q16576-2|RBBP7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9516.5	119.1719	3	1411.7266	1411.7282	R	T	175	187
PSM	CFLGSSETADANR	1644	sp|P50851|LRBA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	1-UNIMOD:4	ms_run[1]:scan=1.1.9468.11	117.8914	2	1426.6128	1426.6147	K	V	343	356
PSM	LDECEEAFQGTK	1645	sp|P61289-2|PSME3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	4-UNIMOD:4	ms_run[1]:scan=1.1.9478.11	118.161	2	1425.6046	1425.6082	R	V	89	101
PSM	TVFAEHISDECK	1646	sp|P39023|RL3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	11-UNIMOD:4	ms_run[1]:scan=1.1.9441.6	117.1544	3	1434.6442	1434.6449	K	R	104	116
PSM	ALTSELANARDESK	1647	sp|P26038|MOES_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9219.11	111.2666	2	1503.7468	1503.7529	K	K	524	538
PSM	NCECLSCIDCGK	1648	sp|Q9NX58|LYAR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	2-UNIMOD:4,4-UNIMOD:4,7-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.9485.11	118.3492	2	1514.5594	1514.5622	R	D	27	39
PSM	VCHAHPTLSEAFR	1649	sp|P09622|DLDH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	2-UNIMOD:4	ms_run[1]:scan=1.1.9308.9	113.6233	3	1523.7262	1523.7303	R	E	483	496
PSM	TGTITTFEHAHNMR	1650	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9290.5	113.1321	4	1614.7605	1614.7573	K	V	482	496
PSM	VFQSSTSQEQVYNDCAK	1651	sp|P33176|KINH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	15-UNIMOD:4	ms_run[1]:scan=1.1.9391.11	115.8285	2	1989.8656	1989.8738	R	K	51	68
PSM	VHTECCHGDLLECADDR	1652	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	5-UNIMOD:4,6-UNIMOD:4,13-UNIMOD:4	ms_run[1]:scan=1.1.9330.5	114.1977	4	2085.8273	2085.8303	K	A	265	282
PSM	IHGTEEGQQILK	1653	sp|Q14980-2|NUMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8287.6	86.53612	3	1351.7107	1351.7096	R	Q	43	55
PSM	AAGSGELGVTMK	1654	sp|O75369-2|FLNB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9166.10	109.8579	2	1119.5568	1119.5594	K	G	481	493
PSM	HSHTNLSISTGVTK	1655	sp|Q5T7N2|LITD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.7857.3	75.3276	4	1480.7673	1480.7634	K	L	572	586
PSM	IEDVGSDEEDDSGKDK	1656	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.7192.10	57.78067	3	1736.7253	1736.7224	K	K	250	266
PSM	SGGNSYGSGGASYNPGSHGGYGGGSGGGSSYQGK	1657	sp|Q12906-7|ILF3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9178.11	110.1826	4	3011.2237	3011.2303	R	Q	820	854
PSM	RQAVTNPNNTFYATK	1658	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8694.5	97.34785	4	1723.8649	1723.8642	K	R	107	122
PSM	SRAEAESMYQIK	1659	sp|P05787-2|K2C8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8886.6	102.473	3	1411.6777	1411.6765	R	Y	302	314
PSM	TNAENEFVTIKK	1660	sp|P04264|K2C1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9512.4	119.0626	3	1392.7228	1392.7249	R	D	278	290
PSM	IGSCTQQDVELHVQK	1661	sp|P14868|SYDC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	4-UNIMOD:4	ms_run[1]:scan=1.1.9297.9	113.327	3	1740.8443	1740.8465	K	I	127	142
PSM	RVSALNSVHCEHVEDEGESR	1662	sp|Q13085-2|ACACA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	10-UNIMOD:4	ms_run[1]:scan=1.1.8327.7	87.60413	5	2309.0431	2309.0455	K	Y	1702	1722
PSM	NQSFASTHLNQNSSR	1663	sp|O95235|KI20A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.7873.10	75.76292	3	1689.7843	1689.7819	K	S	365	380
PSM	LVEVNGENVEK	1664	sp|O14745|NHRF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8586.2	94.46082	3	1228.6315	1228.6299	R	E	59	70
PSM	ESLAEEHEGLVGEGQR	1665	sp|Q10570|CPSF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9508.8	118.9619	3	1738.8097	1738.8122	R	S	167	183
PSM	EDIYSGGGGGGSR	1666	sp|Q13151|ROA0_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.7438.6	64.2602	3	1210.5256	1210.5215	K	S	177	190
PSM	FESDPATHNEPGVR	1667	sp|Q9NVA2-2|SEP11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.7818.10	74.33768	3	1554.7099	1554.7063	K	L	76	90
PSM	QCVENADLPEGEK	1668	sp|Q99460-2|PSMD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	2-UNIMOD:4	ms_run[1]:scan=1.1.8529.7	92.95945	3	1487.6557	1487.6562	K	K	111	124
PSM	ENQQATSGPNQPSVR	1669	sp|P16989|YBOX3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.7106.9	55.43117	3	1611.7630	1611.7601	K	R	312	327
PSM	AGEAPTENPAPPTQQSSAE	1670	sp|P16989|YBOX3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8252.8	85.62254	3	1880.8339	1880.8388	K	-	354	373
PSM	EIQTTTGNQQVLVR	1671	sp|Q8TC12|RDH11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9459.7	117.6423	3	1585.8370	1585.8424	K	K	84	98
PSM	QDAQDLYEAGEK	1672	sp|P09525-2|ANXA4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9198.10	110.7093	2	1365.6002	1365.6048	R	K	91	103
PSM	RAAAEVNQDYGLDPK	1673	sp|P07954-2|FUMH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9165.8	109.8275	3	1645.7830	1645.8060	K	I	58	73
PSM	KVVGCSCVVVK	1674	sp|P25398|RS12_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	5-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=1.1.7571.7	67.8312	3	1233.6526	1233.6574	R	D	102	113
PSM	KLEAQETLNEEDK	1675	sp|Q9UIF9-2|BAZ2A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8088.8	81.41745	3	1545.7591	1545.7522	K	A	668	681
PSM	LAAIAESGVER	1676	sp|P28072|PSB6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9086.11	107.7689	2	1114.5952	1114.5982	R	Q	210	221
PSM	SAAMLGNSEDHTALSR	1677	sp|O60749-2|SNX2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.9181.8	110.2574	3	1658.7904	1658.7682	K	A	230	246
PSM	QQIAEDPELTHSSSNK	1678	sp|Q9ULC3|RAB23_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8141.10	82.78249	3	1782.8374	1782.8384	K	I	175	191
PSM	RYDGSQQALDLK	1679	sp|Q9UBU9|NXF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.8971.5	104.7046	3	1392.6979	1392.6997	K	G	219	231
PSM	CCAAADPHECYAK	1680	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.8669.6	96.67543	3	1535.5622	1534.5632	K	V	384	397
PSM	EATNPPVIQEEK	1681	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.8221.8	84.83895	2	1354.678047	1353.677610	R	P	483	495
PSM	CRPLEENTADNEK	1682	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.8299.11	86.86404	3	1557.6733	1557.6724	K	E	2696	2709
PSM	CRPLEENTADNEK	1683	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.8293.11	86.70523	2	1557.6677	1557.6724	K	E	2696	2709
PSM	QEYDESGPSIVHRK	1684	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:28	ms_run[1]:scan=1.1.9183.9	110.3121	3	1628.7662	1626.7632	K	C	360	374
PSM	QDAQSLHGDIPQK	1685	sp|Q9NR30|DDX21_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:28	ms_run[1]:scan=1.1.9464.11	117.7837	2	1419.6752	1418.6782	K	Q	462	475
PSM	SVDPDSPAEASGLR	1686	sp|O14745|NHRF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.9309.9	113.6501	3	1400.666171	1399.657937	R	A	181	195
PSM	HTGPNSPDTANDGFVR	1687	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.8576.10	94.21986	3	1686.795071	1683.760111	K	L	99	115
PSM	ATTATMATSGSAR	1688	sp|P38919|IF4A3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:1	ms_run[1]:scan=1.1.8402.11	89.60302	2	1266.5965	1266.5869	M	K	2	15
PSM	SETAPAAPAAAPPAEK	1689	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:1	ms_run[1]:scan=1.1.8890.6	102.5758	3	1521.7552	1519.7512	M	A	2	18
PSM	SETAPAAPAAAPPAEK	1690	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:1	ms_run[1]:scan=1.1.8838.11	101.228	2	1519.7485	1519.7513	M	A	2	18
PSM	SETAPAETATPAPVEK	1691	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:1	ms_run[1]:scan=1.1.9205.7	110.8887	3	1639.7936	1639.7936	M	S	2	18
PSM	SETAPAETATPAPVEK	1692	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:1	ms_run[1]:scan=1.1.9158.11	109.6442	2	1639.7886	1639.7936	M	S	2	18
PSM	SETAPAETATPAPVEK	1693	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:1	ms_run[1]:scan=1.1.9204.6	110.8607	3	1639.7936	1639.7936	M	S	2	18
PSM	MRAEDGENYDIK	1694	sp|O75347|TBCA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.8381.6	89.04008	3	1440.633371	1439.635093	K	K	40	52
PSM	ASQNRDPAATSVAAAR	1695	sp|O00762|UBE2C_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:1	ms_run[1]:scan=1.1.8144.10	82.85745	2	1626.8062	1626.8069	M	K	2	18
PSM	LNSHMNALHLGSQANR	1696	sp|P11413|G6PD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.9411.4	116.3552	4	1762.872894	1761.869284	R	L	121	137
PSM	FTSDTKPIINK	1697	sp|Q8N1F7|NUP93_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.8008.5	79.27718	3	1263.686471	1262.687053	K	V	601	612
PSM	ASSGAGDPLDSK	1698	sp|Q9Y2R0|COA3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:1	ms_run[1]:scan=1.1.8935.9	103.747	2	1145.5155	1145.5195	M	R	2	14
PSM	LNEQHQLILSK	1699	sp|Q8IYB5|SMAP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.8972.5	104.7315	3	1322.735171	1321.735400	K	L	13	24
PSM	IHEGCEEPATHNALAK	1700	sp|Q00610|CLH1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26	5-UNIMOD:4	ms_run[1]:scan=1.1.7359.6	62.12942	4	1774.820494	1775.826082	R	I	866	882
PSM	EATPVVHETEPESGSQPR	1701	sp|Q9Y520|PRC2C_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.7830.10	74.6484	3	1948.911671	1948.912649	K	P	639	657
PSM	NNASTDYDLSDK	1702	sp|P39023|RL3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.8316.10	87.31573	2	1340.569447	1341.568454	K	S	301	313
PSM	VHHEPQLSDK	1703	sp|O43852-2|CALU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.6861.7	48.90045	3	1188.5902	1188.5887	R	V	28	38
PSM	LGIHEDSQNRK	1704	sp|P07900-2|HS90A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.6925.4	50.5993	3	1295.6596	1295.6582	K	K	569	580
PSM	YHTINGHNAEVRK	1705	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.6942.9	51.07292	3	1537.7689	1537.7749	K	A	162	175
PSM	SDGAPASDSKPGSSEAAPSSK	1706	sp|P80723|BASP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.6803.10	47.33105	3	1931.8726	1931.8708	K	E	164	185
PSM	RMEELHNQEMQK	1707	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7342.3	61.66575	4	1571.7249	1571.7184	R	R	548	560
PSM	KEVVEEAENGR	1708	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7103.6	55.3441	3	1258.6264	1258.6153	K	D	21	32
PSM	VAPAQPSEEGPGR	1709	sp|P23588-2|IF4B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7194.5	57.82693	3	1293.6415	1293.6313	K	K	473	486
PSM	PANKQEDEVMR	1710	sp|O15145|ARPC3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7117.5	55.72512	3	1315.6255	1315.6190	K	A	120	131
PSM	AGGQINHDLHER	1711	sp|Q9NU22|MDN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7111.7	55.56452	3	1345.6519	1345.6487	K	L	82	94
PSM	LMELHGEGSSSGK	1712	sp|P61247|RS3A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	2-UNIMOD:35	ms_run[1]:scan=1.1.7049.5	53.88612	3	1346.6167	1346.6136	K	A	228	241
PSM	RQQPGPSEHIER	1713	sp|P50552|VASP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.6977.7	52.00718	3	1432.7167	1432.7171	K	R	143	155
PSM	ITAAQHSVTGSAVSK	1714	sp|Q13492-2|PICAL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7208.6	58.20682	3	1455.7672	1455.7682	R	T	10	25
PSM	LRPEAQPHPSAGPKPAESK	1715	sp|Q07157-2|ZO1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7015.6	52.96117	4	1996.0573	1996.0490	R	Q	1091	1110
PSM	QPPTAAGRPVDASPR	1716	sp|Q9Y6G9|DC1L1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7304.4	60.68712	3	1518.7921	1518.7903	K	V	386	401
PSM	ATNVTYQAHHVSR	1717	sp|O43252|PAPS1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7073.2	54.5369	4	1482.7385	1482.7328	R	N	25	38
PSM	EVVEEAENGR	1718	sp|P06454-2|PTMA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7345.9	61.75697	2	1130.5222	1130.5204	K	D	22	32
PSM	ETGEHLVHVK	1719	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7219.10	58.5091	2	1147.5984	1147.5986	K	K	2007	2017
PSM	SVSSASEHSTTEPSPAAR	1720	sp|Q9H6K5-2|PRR36_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7043.9	53.7283	3	1799.8291	1799.8286	K	R	208	226
PSM	NRPPLPAGTNSK	1721	sp|P42166|LAP2A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7193.10	57.80797	2	1250.6736	1250.6731	R	G	49	61
PSM	QAGEVTYADAHK	1722	sp|Q13247-3|SRSF6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7247.7	59.2241	3	1288.6090	1288.6048	R	G	132	144
PSM	SVQAGNPGGPGPGGR	1723	sp|Q96AE4-2|FUBP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7070.11	54.47095	2	1306.6386	1306.6378	R	G	344	359
PSM	SSVGPSKPVSQPR	1724	sp|Q9Y657|SPIN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.6967.6	51.73818	3	1324.7137	1324.7099	R	R	38	51
PSM	SVSGTDVQEECR	1725	sp|P49321|NASP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	11-UNIMOD:4	ms_run[1]:scan=1.1.7304.6	60.69378	2	1365.5826	1365.5831	K	E	244	256
PSM	TCVADESAENCDK	1726	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	2-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=1.1.7059.11	54.16891	2	1497.5732	1497.5712	K	S	76	89
PSM	NQTAEKEEFEHQQK	1727	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7086.8	54.89645	4	1744.8097	1744.8016	K	E	584	598
PSM	GGPAEGQLQENDR	1728	sp|Q07157-2|ZO1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7509.11	66.17232	2	1369.6256	1369.6222	K	V	62	75
PSM	LNGHQLENHALK	1729	sp|Q9NZI8|IF2B1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7668.4	70.4344	4	1372.7277	1372.7211	K	V	139	151
PSM	HAEATLGSGNLR	1730	sp|Q9H8S9-2|MOB1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7690.5	71.01289	3	1224.6229	1224.6211	K	Q	31	43
PSM	RSGQVLEVSGSK	1731	sp|P21281|VATB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7390.6	62.96124	3	1245.6685	1245.6677	K	A	82	94
PSM	RGPAEESSSWR	1732	sp|Q14152|EIF3A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7683.8	70.83062	3	1260.5959	1260.5847	R	D	1250	1261
PSM	SESPKEPEQLR	1733	sp|P09651-2|ROA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7392.8	63.01863	3	1298.6479	1298.6466	K	K	4	15
PSM	KPEDWDERPK	1734	sp|P27824-2|CALX_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7554.9	67.37653	3	1298.6293	1298.6255	R	I	318	328
PSM	TLHPDLGTDKDK	1735	sp|P00338-3|LDHA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7448.8	64.53395	3	1338.6790	1338.6779	K	E	242	254
PSM	RLVSDGNINSDR	1736	sp|Q01082-2|SPTB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7543.5	67.07412	3	1344.6799	1344.6746	R	I	1234	1246
PSM	SGSMDPSGAHPSVR	1737	sp|Q07666|KHDR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7449.8	64.5609	3	1383.6223	1383.6201	R	Q	18	32
PSM	VATFHDCEDAAR	1738	sp|Q9P2X0-2|DPM3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	7-UNIMOD:4	ms_run[1]:scan=1.1.7703.8	71.36612	3	1390.5958	1390.5936	R	E	91	103
PSM	VIACDGGGGALGHPK	1739	sp|O75380|NDUS6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	4-UNIMOD:4	ms_run[1]:scan=1.1.7686.7	70.90895	3	1407.6952	1407.6929	R	V	84	99
PSM	IFSGSSHQDLSQK	1740	sp|P60891|PRPS1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7689.6	70.98755	3	1432.6969	1432.6947	K	I	6	19
PSM	NSSYVHGGLDSNGK	1741	sp|Q13283|G3BP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7476.7	65.29134	3	1433.6554	1433.6535	K	P	37	51
PSM	VEQATKPSFESGR	1742	sp|P38159-2|RBMX_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7616.6	69.04065	3	1434.7150	1434.7103	K	R	68	81
PSM	AAAAAAALQAK	1743	sp|P36578|RL4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7514.9	66.30235	2	955.5460	955.5450	K	S	354	365
PSM	FQRPGDPQSAQDK	1744	sp|Q15637-3|SF01_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7370.7	62.4241	3	1472.7022	1472.7008	K	A	294	307
PSM	TPGPGAQSALR	1745	sp|P62263|RS14_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7604.11	68.7289	2	1053.5576	1053.5567	K	A	107	118
PSM	VGAAEEELQK	1746	sp|Q9P2E9|RRBP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7613.11	68.96799	2	1072.5420	1072.5400	K	S	1160	1170
PSM	LTASEQAHPQEPAESAHEPR	1747	sp|Q02952-2|AKA12_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7556.10	67.43215	4	2184.0225	2184.0195	K	L	252	272
PSM	VGPATPSAQVGK	1748	sp|Q13428-4|TCOF_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7578.10	68.02517	2	1110.6036	1110.6033	K	W	529	541
PSM	TGPAAAQVQVGK	1749	sp|Q13428-4|TCOF_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7621.10	69.18217	2	1125.6168	1125.6142	K	Q	459	471
PSM	CATITPDEAR	1750	sp|P48735|IDHP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	1-UNIMOD:4	ms_run[1]:scan=1.1.7596.11	68.51385	2	1132.5186	1132.5183	K	V	113	123
PSM	QNAQCLHGDIAQSQR	1751	sp|Q9BQ39|DDX50_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	5-UNIMOD:4	ms_run[1]:scan=1.1.7628.10	69.37093	3	1724.8057	1724.8013	K	E	413	428
PSM	PSHCTIYVAK	1752	sp|Q9P2J5-2|SYLC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	4-UNIMOD:4	ms_run[1]:scan=1.1.7500.10	65.9334	2	1174.5808	1174.5805	K	N	879	889
PSM	EELEQTYHAK	1753	sp|P20700|LMNB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7471.11	65.16232	2	1246.5848	1246.5829	K	L	262	272
PSM	HVTSEQEWDK	1754	sp|P37268-3|FDFT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7537.11	66.92307	2	1257.5646	1257.5626	K	Y	76	86
PSM	KQELQPGTAYK	1755	sp|P51610-2|HCFC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7406.10	63.40047	2	1261.6684	1261.6666	K	F	1784	1795
PSM	VADNAQQQYVR	1756	sp|Q8TDD1-2|DDX54_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7629.11	69.39957	2	1290.6294	1290.6317	R	S	511	522
PSM	QAASGLVGQENAR	1757	sp|Q9Y265|RUVB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7694.11	71.13022	2	1299.6534	1299.6531	K	E	34	47
PSM	VAEVEGEQVDNK	1758	sp|O95202|LETM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7460.11	64.8638	2	1315.6270	1315.6256	K	A	452	464
PSM	STTSVSEEDVSSR	1759	sp|Q96IZ0|PAWR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7544.11	67.11103	2	1382.6168	1382.6161	K	Y	228	241
PSM	VNEIVETNRPDSK	1760	sp|Q15008-4|PSMD6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7601.11	68.64928	3	1499.7625	1499.7580	K	N	403	416
PSM	TVYHAEEVQCDGR	1761	sp|Q16527|CSRP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	10-UNIMOD:4	ms_run[1]:scan=1.1.7645.10	69.8291	2	1562.6804	1562.6784	R	S	16	29
PSM	AVTEQGHELSNEER	1762	sp|P31946-2|1433B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7406.7	63.39547	3	1597.7374	1597.7332	K	N	28	42
PSM	NYQQNYQNSESGEK	1763	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7360.9	62.16117	3	1687.7107	1687.7074	R	N	157	171
PSM	LDPHNHVLYSNR	1764	sp|P31948|STIP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8055.5	80.53177	4	1463.7313	1463.7269	K	S	33	45
PSM	AHQITDESLESTRR	1765	sp|O00161-2|SNP23_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7878.6	75.89028	4	1641.8085	1641.8070	R	I	13	27
PSM	NCPHVVVGTPGR	1766	sp|O00148|DX39A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	2-UNIMOD:4	ms_run[1]:scan=1.1.7791.5	73.62382	3	1291.6492	1291.6456	K	I	163	175
PSM	LPECEAVCGKPK	1767	sp|P00738|HPT_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	4-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.7766.4	72.9756	3	1386.6640	1386.6635	K	N	142	154
PSM	RAGELTEDEVER	1768	sp|P62269|RS18_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7928.8	77.19338	3	1402.6711	1402.6688	K	V	55	67
PSM	NHIPITEQGDAPR	1769	sp|Q8WXD5|GEMI6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8053.7	80.48129	3	1446.7054	1446.7215	K	T	113	126
PSM	AGFAGDDAPR	1770	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7777.10	73.27237	2	975.4424	975.4410	K	A	19	29
PSM	RQLEEAEEEATR	1771	sp|P35580-3|MYH10_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7893.5	76.28827	3	1459.6915	1459.6902	K	A	1905	1917
PSM	HEQNIDCGGGYVK	1772	sp|P27797|CALR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	7-UNIMOD:4	ms_run[1]:scan=1.1.7781.4	73.3657	3	1475.6488	1475.6463	K	L	99	112
PSM	AEGDVAALNR	1773	sp|P67936|TPM4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7976.7	78.45875	2	1014.5100	1014.5094	K	R	45	55
PSM	AAAEQAISVR	1774	sp|Q01780|EXOSX_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7957.9	77.95637	2	1014.5466	1014.5458	K	Q	759	769
PSM	LTQIQESQVTSHNK	1775	sp|Q92541|RTF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7847.6	75.07365	3	1611.8251	1611.8216	K	E	252	266
PSM	EKLEQNPEESQDIK	1776	sp|Q01860|PO5F1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7779.11	73.32578	3	1685.8132	1685.8108	K	A	127	141
PSM	EGQEIASVSDDHTCR	1777	sp|Q8NFH4|NUP37_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	14-UNIMOD:4	ms_run[1]:scan=1.1.7841.10	74.92699	3	1702.7239	1702.7217	K	I	136	151
PSM	TADGIVSHLKK	1778	sp|P30101|PDIA3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8064.9	80.78015	2	1167.6606	1167.6612	R	Q	120	131
PSM	HQGVMVGMGQK	1779	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7748.4	72.51828	3	1170.5659	1170.5638	R	D	40	51
PSM	LAQQISDEASR	1780	sp|Q93008-1|USP9X_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7869.10	75.65577	2	1216.6074	1216.6048	R	Y	1221	1232
PSM	KEETQPPVALK	1781	sp|Q8NC51-3|PAIRB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7807.10	74.04752	2	1238.6870	1238.6870	K	K	92	103
PSM	VNTLIRPDGEK	1782	sp|P62750|RL23A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8031.8	79.89066	3	1240.6789	1240.6775	K	K	124	135
PSM	LVSDSLSEHEK	1783	sp|Q96KR1|ZFR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7771.11	73.11745	2	1242.6094	1242.6092	K	N	757	768
PSM	LLEQYKEESK	1784	sp|Q00839-2|HNRPU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8010.10	79.33794	2	1265.6498	1265.6503	K	K	646	656
PSM	EAALVQQEEEK	1785	sp|Q15020-4|SART3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7817.10	74.311	2	1272.6228	1272.6197	K	A	551	562
PSM	MDATANDVPSDR	1786	sp|P13667|PDIA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7787.9	73.52798	2	1290.5500	1290.5510	K	Y	583	595
PSM	QTYSTEPNNLK	1787	sp|P46779|RL28_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7830.9	74.64507	2	1293.6204	1293.6201	K	A	23	34
PSM	MDCQETPEGYK	1788	sp|O75369-2|FLNB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	3-UNIMOD:4	ms_run[1]:scan=1.1.7884.9	76.0528	2	1356.5334	1356.5326	K	V	2405	2416
PSM	DTDGGPKEEESPV	1789	sp|P53985|MOT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7750.7	72.57598	2	1358.5848	1358.5838	K	-	488	501
PSM	AQAAAPASVPAQAPK	1790	sp|P47914|RL29_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7896.9	76.3617	3	1376.7442	1376.7412	K	R	135	150
PSM	ELEEEAEEEQR	1791	sp|Q9H2J4|PDCL3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8008.10	79.28551	2	1389.5906	1389.5895	K	I	28	39
PSM	AVAHHTDCTFIR	1792	sp|P62195-2|PRS8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	8-UNIMOD:4	ms_run[1]:scan=1.1.7730.8	72.08197	3	1426.6756	1426.6776	R	V	194	206
PSM	EVYQQQQYGSGGR	1793	sp|Q99729-2|ROAA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7714.11	71.6668	2	1498.6810	1498.6801	K	G	233	246
PSM	SNESVDIQDQEEK	1794	sp|Q5UIP0|RIF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8038.11	80.08365	2	1519.6664	1519.6638	K	V	1576	1589
PSM	QDSINAYNEPNSTK	1795	sp|O60264|SMCA5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8086.11	81.36864	2	1579.7108	1579.7114	R	F	539	553
PSM	VASLEESEGNKQDLK	1796	sp|Q07065|CKAP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7927.11	77.17226	2	1645.8142	1645.8159	K	A	273	288
PSM	VTAIHIDPATHR	1797	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8384.2	89.11356	4	1329.7193	1329.7153	R	Q	1052	1064
PSM	TKFETEQALR	1798	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8183.5	83.86008	3	1221.6400	1221.6353	R	L	167	177
PSM	SNVSDAVAQSTR	1799	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8142.6	82.7996	3	1233.5977	1233.5949	K	I	232	244
PSM	SNVSDAVAQSTR	1800	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8155.4	83.12981	3	1233.5977	1233.5949	K	I	232	244
PSM	DHPLPEVAHVK	1801	sp|P13073|COX41_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8316.3	87.30407	3	1240.6591	1240.6564	R	H	43	54
PSM	FACHSASLTVR	1802	sp|Q15233-2|NONO_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	3-UNIMOD:4	ms_run[1]:scan=1.1.8438.6	90.54227	3	1247.6110	1247.6081	R	N	54	65
PSM	FACHSASLTVR	1803	sp|Q15233-2|NONO_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	3-UNIMOD:4	ms_run[1]:scan=1.1.8441.6	90.62262	3	1247.6110	1247.6081	R	N	54	65
PSM	LYHNEVEIEK	1804	sp|Q14683|SMC1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8457.6	91.0524	3	1272.6388	1272.6350	K	L	228	238
PSM	HLDSVLSDHTR	1805	sp|Q2M389|WASC4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8193.4	84.11383	3	1278.6373	1278.6317	R	N	972	983
PSM	LSFHQTQVSQR	1806	sp|Q969Z0|FAKD4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8343.9	88.02942	3	1329.6799	1329.6790	K	L	305	316
PSM	LLDRDACDTVR	1807	sp|Q9NZL4-3|HPBP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	7-UNIMOD:4	ms_run[1]:scan=1.1.8104.5	81.83235	3	1332.6487	1332.6456	R	V	238	249
PSM	KFDPMGQQTCSAHPAR	1808	sp|Q9NPE3|NOP10_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	10-UNIMOD:4	ms_run[1]:scan=1.1.8208.6	84.49928	4	1829.8173	1829.8301	K	F	19	35
PSM	YICENQDSISSK	1809	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	3-UNIMOD:4	ms_run[1]:scan=1.1.8144.5	82.84911	3	1442.6374	1442.6347	K	L	287	299
PSM	QADVNLVNAK	1810	sp|O43175|SERA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8360.10	88.48373	2	1070.5724	1070.5720	K	L	385	395
PSM	AANGVVLATEK	1811	sp|P25787|PSA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8088.9	81.41911	2	1071.5934	1071.5924	K	K	40	51
PSM	TPASPVVHIR	1812	sp|P14866|HNRPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8356.10	88.37683	2	1075.6130	1075.6138	K	G	98	108
PSM	AQQGPSAQGKPTYFR	1813	sp|Q9H9Z2|LN28A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8407.9	89.72853	3	1634.8144	1634.8165	K	E	178	193
PSM	KAPPLVENEEAEPGR	1814	sp|O14908|GIPC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8457.10	91.05907	3	1634.8234	1634.8264	K	G	10	25
PSM	LASAAYPDPSK	1815	sp|P54577|SYYC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8197.10	84.22739	2	1118.5578	1118.5608	K	Q	336	347
PSM	VDATAETDLAK	1816	sp|P13667|PDIA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8352.11	88.27164	2	1132.5598	1132.5612	K	R	235	246
PSM	LKDDEVAQLK	1817	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8294.3	86.7186	3	1157.6314	1157.6292	K	K	309	319
PSM	TVEVAEGEAVR	1818	sp|Q86UE4|LYRIC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8242.10	85.37023	2	1158.5880	1158.5881	R	T	132	143
PSM	LACDVDQVTR	1819	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	3-UNIMOD:4	ms_run[1]:scan=1.1.8459.11	91.11467	2	1175.5588	1175.5605	R	Q	972	982
PSM	ISEEDELDTK	1820	sp|Q15121-2|PEA15_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8340.10	87.95278	2	1177.5344	1177.5350	K	L	110	120
PSM	QAQILASEAEK	1821	sp|Q9UJZ1-2|STML2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8226.6	84.96606	2	1186.6204	1186.6193	K	A	178	189
PSM	ARTPEAVESPQEASGVR	1822	sp|Q7L190|DPPA4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8300.9	86.88768	3	1782.8785	1782.8860	R	W	213	230
PSM	FEEQGASDLAK	1823	sp|Q7Z2Z2-2|EFL1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8444.11	90.71162	2	1193.5552	1193.5564	K	E	851	862
PSM	SNFSNSADDIK	1824	sp|P45973|CBX5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8289.11	86.59807	2	1196.5292	1196.5309	K	S	92	103
PSM	SGTVDPQELQK	1825	sp|P30626-2|SORCN_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8169.10	83.50025	2	1200.5970	1200.5986	R	A	102	113
PSM	SGTVDPQELQK	1826	sp|P30626-2|SORCN_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8192.9	84.09998	2	1200.6004	1200.5986	R	A	102	113
PSM	LVSSDPEINTK	1827	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8091.9	81.49948	2	1201.6206	1201.6190	R	K	257	268
PSM	TNEAQAIETAR	1828	sp|P61088|UBE2N_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8266.11	85.98489	2	1202.5874	1202.5891	K	A	131	142
PSM	LNDGSQITYEK	1829	sp|O95831|AIFM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8383.11	89.10195	2	1266.6078	1266.6092	K	C	245	256
PSM	INISEGNCPER	1830	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	8-UNIMOD:4	ms_run[1]:scan=1.1.8357.11	88.40514	2	1287.5854	1287.5877	R	I	47	58
PSM	DREEALHQFR	1831	sp|O00571|DDX3X_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8323.11	87.50425	2	1299.6300	1299.6320	R	S	479	489
PSM	FQASQGENLEGK	1832	sp|Q7Z3K3-2|POGZ_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8233.7	85.13708	2	1306.6128	1306.6153	R	Y	957	969
PSM	VTAIHIDPATHR	1833	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8371.10	88.77866	2	1329.7142	1329.7153	R	Q	1052	1064
PSM	ASNGDAWVEAHGK	1834	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8094.11	81.58193	2	1340.6122	1340.6109	R	L	147	160
PSM	NNASTDYDLSDK	1835	sp|P39023|RL3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8340.6	87.94611	3	1341.5692	1341.5684	K	S	301	313
PSM	DTAASGYGTQNIR	1836	sp|Q9Y314|NOSIP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8449.10	90.84423	2	1352.6302	1352.6320	K	L	22	35
PSM	CTSCGVVAENYK	1837	sp|Q9NXA8-2|SIR5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	1-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=1.1.8261.9	85.85582	2	1386.5882	1386.5908	R	S	166	178
PSM	AVVVCPKDEDYK	1838	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	5-UNIMOD:4	ms_run[1]:scan=1.1.8256.6	85.71957	3	1421.6857	1421.6861	K	Q	584	596
PSM	VTSGGVSESPSGFSK	1839	sp|O14757-3|CHK1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8469.11	91.384	2	1424.6756	1424.6784	R	H	278	293
PSM	TFQGPNCPATCGR	1840	sp|Q13685|AAMP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	7-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=1.1.8253.9	85.65137	2	1464.6240	1464.6238	K	V	210	223
PSM	VIECSYTSADGQR	1841	sp|Q9UBM7|DHCR7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	4-UNIMOD:4	ms_run[1]:scan=1.1.8264.10	85.9314	2	1484.6554	1484.6566	K	H	377	390
PSM	DDPENDNSELPTAK	1842	sp|Q93009-3|UBP7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8429.11	90.30878	2	1543.6620	1543.6638	K	E	755	769
PSM	TPGNNLHEVETAQGQR	1843	sp|Q8N9N8|EIF1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8162.9	83.31803	3	1749.8344	1749.8394	R	F	33	49
PSM	AGGAAVVITEPEHTK	1844	sp|Q9P258|RCC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8516.4	92.61269	4	1478.7761	1478.7729	K	E	78	93
PSM	ERHPGSFDVVHVK	1845	sp|P62701|RS4X_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8705.4	97.64336	4	1505.7765	1505.7739	R	D	199	212
PSM	LSKDPNIVIAK	1846	sp|P30101|PDIA3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8701.3	97.53377	3	1196.7142	1196.7128	K	M	423	434
PSM	KLDYGQHVVAGTPGR	1847	sp|P38919|IF4A3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8670.5	96.70084	4	1596.8401	1596.8373	R	V	152	167
PSM	SEHPGLSIGDTAK	1848	sp|P26583|HMGB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8480.7	91.67222	3	1310.6470	1310.6466	K	K	115	128
PSM	NLDGISHAPNAVK	1849	sp|Q92820|GGH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8680.5	96.9701	3	1334.6965	1334.6942	K	T	254	267
PSM	FRPDMEEEEAK	1850	sp|Q99436|PSB7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8507.6	92.37845	3	1379.6035	1379.6027	K	N	185	196
PSM	GHQQLYWSHPR	1851	sp|P62273-2|RS29_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8829.5	100.9832	3	1407.6871	1407.6796	M	K	2	13
PSM	QLAVAEGKPPEAPK	1852	sp|P56192|SYMC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8637.4	95.81316	3	1433.7883	1433.7878	K	G	882	896
PSM	LEHQFAVGEDSGR	1853	sp|O00754-2|MA2B1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8682.6	97.02575	3	1443.6724	1443.6743	R	N	916	929
PSM	HVLVTLGEK	1854	sp|P60660-2|MYL6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8782.6	99.72044	2	994.5792	994.5811	R	M	111	120
PSM	SDPYHATSGALSPAK	1855	sp|P17302|CXA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8642.9	95.9561	3	1500.7204	1500.7209	K	D	244	259
PSM	DLEDKEGEIQAGAK	1856	sp|Q13409-2|DC1I2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8806.6	100.3662	3	1501.7269	1501.7260	R	L	245	259
PSM	ASAVSELSPR	1857	sp|Q9Y2W1|TR150_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8646.9	96.06382	2	1015.5308	1015.5298	R	E	236	246
PSM	SEVATLTAAGK	1858	sp|P36542-2|ATPG_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8498.9	92.14565	2	1046.5602	1046.5608	K	E	116	127
PSM	KQPPVSPGTALVGSQK	1859	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8770.9	99.40244	3	1592.8876	1592.8886	R	E	31	47
PSM	SPDEAYAIAK	1860	sp|Q9P2R7-2|SUCB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8648.8	96.11605	2	1063.5170	1063.5186	K	K	57	67
PSM	TALIHDGLAR	1861	sp|P25398|RS12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8793.3	100.0112	3	1065.5977	1065.5931	K	G	24	34
PSM	IATGQIAGVDK	1862	sp|Q9HC35|EMAL4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8494.9	92.04121	2	1071.5924	1071.5924	R	D	324	335
PSM	SVEAAAELSAK	1863	sp|P20962|PTMS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8610.10	95.09798	2	1074.5454	1074.5557	K	D	5	16
PSM	ELDVEEAHAASTEEK	1864	sp|Q96C86|DCPS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8653.9	96.25182	3	1656.7465	1656.7478	R	E	14	29
PSM	HLSSCAAPAPLTSAER	1865	sp|Q6IBS0|TWF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	5-UNIMOD:4	ms_run[1]:scan=1.1.8809.9	100.4523	3	1666.8088	1666.8097	K	E	137	153
PSM	RLIPDGCGVK	1866	sp|P27635|RL10_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	7-UNIMOD:4	ms_run[1]:scan=1.1.8521.2	92.74022	3	1113.5980	1113.5965	K	Y	189	199
PSM	RLIPDGCGVK	1867	sp|P27635|RL10_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	7-UNIMOD:4	ms_run[1]:scan=1.1.8517.10	92.64888	2	1113.5952	1113.5965	K	Y	189	199
PSM	VLDNAIETEK	1868	sp|Q01082-2|SPTB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8624.10	95.47397	2	1130.5802	1130.5819	K	M	293	303
PSM	TNRPPLSLSR	1869	sp|Q07020-2|RL18_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8568.3	93.99992	3	1139.6446	1139.6411	R	M	27	37
PSM	TNRPPLSLSR	1870	sp|Q07020-2|RL18_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8549.3	93.4891	3	1139.6446	1139.6411	R	M	27	37
PSM	YLAEVAAGDDK	1871	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8725.9	98.18768	2	1150.5494	1150.5506	R	K	128	139
PSM	VVGDVAYDEAK	1872	sp|P11586|C1TC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8636.11	95.79792	2	1164.5644	1164.5663	K	E	252	263
PSM	EISPGSGPGEIR	1873	sp|O43491-4|E41L2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8688.9	97.19273	2	1197.5956	1197.5990	K	K	643	655
PSM	LGSTEVASNVPK	1874	sp|Q9Y5A9-2|YTHD2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8644.9	96.01005	2	1200.6336	1200.6350	K	V	144	156
PSM	AASAAFQENVGR	1875	sp|Q9BTW9-4|TBCD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8585.6	94.44195	2	1219.5908	1219.5945	R	Q	509	521
PSM	HRPELIDYGK	1876	sp|P12814-2|ACTN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8615.4	95.22203	3	1226.6434	1226.6407	R	L	186	196
PSM	LVEVNGENVEK	1877	sp|O14745|NHRF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8580.11	94.32222	2	1228.6276	1228.6299	R	E	59	70
PSM	SFGSTCQLSEK	1878	sp|P11388-4|TOP2A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	6-UNIMOD:4	ms_run[1]:scan=1.1.8641.10	95.93092	2	1242.5526	1242.5551	K	F	468	479
PSM	AGELTEDEVER	1879	sp|P62269|RS18_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8524.9	92.83058	2	1246.5686	1246.5677	R	V	56	67
PSM	FEDVVNQSSPK	1880	sp|Q01085-2|TIAR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8716.10	97.94698	2	1248.5936	1248.5986	R	N	210	221
PSM	GTVIIIANHGDR	1881	sp|Q16851|UGPA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8808.9	100.4253	2	1264.6870	1264.6888	K	I	474	486
PSM	GSLGSQGAKDEPEEELQK	1882	sp|Q13428-4|TCOF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8725.10	98.18935	3	1900.9057	1900.9014	K	G	1442	1460
PSM	VCALLSCTSHK	1883	sp|P15121|ALDR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	2-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=1.1.8590.9	94.57498	2	1274.6090	1274.6111	R	D	298	309
PSM	VVIQSNDDIASR	1884	sp|Q93008-1|USP9X_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8756.10	99.02621	2	1315.6696	1315.6732	R	A	777	789
PSM	EAGDVCYADVQK	1885	sp|Q13242|SRSF9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	6-UNIMOD:4	ms_run[1]:scan=1.1.8668.10	96.65505	2	1353.5852	1353.5871	R	D	133	145
PSM	YIASVQGSTPSPR	1886	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8693.11	97.33102	2	1361.6912	1361.6939	R	Q	11	24
PSM	EEAGGEAAAAAAAER	1887	sp|O14497|ARI1A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8504.10	92.30538	2	1372.6196	1372.6218	R	G	33	48
PSM	FRPDMEEEEAK	1888	sp|Q99436|PSB7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8487.11	91.86179	2	1379.6032	1379.6027	K	N	185	196
PSM	LVQTAAQQVAEDK	1889	sp|Q53FT3|HIKES_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8667.11	96.62998	2	1399.7288	1399.7307	R	F	10	23
PSM	GGGDLPNSQEALQK	1890	sp|O95865|DDAH2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8731.11	98.3527	2	1412.6870	1412.6896	R	L	238	252
PSM	ETYGEMADCCAK	1891	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	9-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.8824.10	100.8585	2	1433.5232	1433.5261	R	Q	106	118
PSM	SDPYHATSGALSPAK	1892	sp|P17302|CXA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8638.11	95.85181	2	1500.7200	1500.7209	K	D	244	259
PSM	SQAPGQPGASQWGSR	1893	sp|Q96EP5-2|DAZP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8624.11	95.47563	2	1512.7048	1512.7070	K	V	195	210
PSM	SGNYPSSLSNETDR	1894	sp|Q9NS86|LANC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8826.11	100.9137	2	1525.6618	1525.6645	R	L	303	317
PSM	GVEEEEEDGEMRE	1895	sp|P62306|RUXF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8486.11	91.83577	2	1536.5858	1536.5886	R	-	74	87
PSM	VDNDENEHQLSLR	1896	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8596.2	94.71674	4	1567.7257	1567.7226	K	T	33	46
PSM	KQPPVSPGTALVGSQK	1897	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8779.8	99.64318	3	1592.8876	1592.8886	R	E	31	47
PSM	SQAEPLSGNKEPLADTSSNQQK	1898	sp|P49750|YLPM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8688.11	97.19607	3	2328.1156	2328.1193	K	N	854	876
PSM	SGVSLAALKK	1899	sp|P16402|H13_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9188.3	110.4335	3	972.5992	972.5968	R	A	56	66
PSM	IIAHAQLLEQHR	1900	sp|P27708|PYR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8853.3	101.6043	4	1427.8029	1427.7997	R	G	843	855
PSM	DHAVVVGVYRPPPK	1901	sp|P22087|FBRL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8993.5	105.2838	4	1532.8505	1532.8464	R	V	305	319
PSM	KFTNAVTLQQHVR	1902	sp|Q9Y467|SALL2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8842.2	101.3174	4	1540.8497	1540.8474	K	M	699	712
PSM	SGSSFVHQASFK	1903	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8870.5	102.0585	3	1280.6224	1280.6150	K	F	1447	1459
PSM	ITDSAGHILYSK	1904	sp|P49755|TMEDA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9045.6	106.6726	3	1303.6795	1303.6772	K	E	76	88
PSM	HAASTVQILGAEK	1905	sp|Q9Y2X3|NOP58_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8860.3	101.7912	3	1323.7147	1323.7146	K	A	311	324
PSM	RFASGGCDNLIK	1906	sp|P55735-2|SEC13_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	7-UNIMOD:4	ms_run[1]:scan=1.1.8906.6	102.9855	3	1336.6576	1336.6558	K	L	167	179
PSM	CTGGEVGATSALAPK	1907	sp|P30050-2|RL12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	1-UNIMOD:4	ms_run[1]:scan=1.1.8984.6	105.0485	3	1417.6879	1417.6871	R	I	17	32
PSM	EFHLNESGDPSSK	1908	sp|Q01105|SET_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8860.6	101.7962	3	1445.6419	1445.6423	K	S	155	168
PSM	TGIDLGTTGR	1909	sp|Q14498-2|RBM39_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9190.7	110.4929	2	989.5120	989.5142	R	L	347	357
PSM	ELRDEEQTAESIK	1910	sp|Q14566|MCM6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9041.7	106.5673	3	1546.7449	1546.7474	K	N	314	327
PSM	TGLAVTVGQAK	1911	sp|Q13428-4|TCOF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9021.7	106.0324	2	1043.5968	1043.5975	K	S	706	717
PSM	AQVADVVVSR	1912	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8869.7	102.0359	2	1042.5766	1042.5771	K	W	1073	1083
PSM	HQAFEAELHANADR	1913	sp|Q13813|SPTN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8986.10	105.1072	3	1607.7430	1607.7440	K	I	1592	1606
PSM	EQIVPKPEEEVAQK	1914	sp|P18621-3|RL17_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8984.8	105.0518	3	1622.8516	1622.8515	K	K	154	168
PSM	ALAAGGYDVEK	1915	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8959.9	104.3891	2	1092.5432	1092.5451	K	N	68	79
PSM	LTAGLKPGQDANLTQK	1916	sp|Q7Z392-3|TPC11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9015.9	105.8754	3	1653.9031	1653.9050	K	T	789	805
PSM	EAVAPVQEESDLEKK	1917	sp|Q13409-2|DC1I2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9173.9	110.045	3	1670.8318	1670.8363	K	R	42	57
PSM	EEGETADTVGCCSLR	1918	sp|P11387|TOP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	11-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.9013.7	105.8187	3	1682.6872	1682.6876	K	V	494	509
PSM	VLTVINQTQK	1919	sp|P42766|RL35_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8845.8	101.4056	2	1142.6642	1142.6659	R	E	57	67
PSM	VLTVINQTQK	1920	sp|P42766|RL35_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8848.7	101.4812	2	1142.6642	1142.6659	R	E	57	67
PSM	VLTVINQTQK	1921	sp|P42766|RL35_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8843.8	101.3534	2	1142.6642	1142.6659	R	E	57	67
PSM	VLTVINQTQK	1922	sp|P42766|RL35_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8853.9	101.6143	2	1142.6642	1142.6659	R	E	57	67
PSM	VLTVINQTQK	1923	sp|P42766|RL35_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8840.11	101.2804	2	1142.6642	1142.6659	R	E	57	67
PSM	VLTVINQTQK	1924	sp|P42766|RL35_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8841.8	101.3015	2	1142.6642	1142.6659	R	E	57	67
PSM	LSDDNTIGKEEIQQR	1925	sp|Q13813|SPTN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8943.10	103.9622	3	1744.8541	1744.8591	K	L	1830	1845
PSM	KGEFETGFEK	1926	sp|Q8IYD1|ERF3B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9095.10	107.9998	2	1170.5532	1170.5557	R	G	316	326
PSM	NAMGSLASQATK	1927	sp|P55036|PSMD4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9164.9	109.8023	2	1177.5742	1177.5761	R	D	354	366
PSM	KIDGAEPLTPEETEEK	1928	sp|P28370|SMCA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9084.9	107.7134	3	1784.8651	1784.8680	K	E	834	850
PSM	AESEEGPDVLR	1929	sp|Q15437|SC23B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8836.10	101.1739	2	1200.5612	1200.5622	R	W	536	547
PSM	ELAAQLNEEAK	1930	sp|Q9Y5B9|SP16H_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9062.10	107.1336	2	1214.6118	1214.6142	K	R	480	491
PSM	NKLDHYAIIK	1931	sp|P62750|RL23A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9157.2	109.6025	3	1213.6840	1213.6819	R	F	69	79
PSM	ELAAQLNEEAK	1932	sp|Q9Y5B9|SP16H_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9042.8	106.5955	2	1214.6118	1214.6142	K	R	480	491
PSM	AVENSSTAIGIR	1933	sp|P25788-2|PSA3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8839.9	101.2509	2	1216.6388	1216.6411	K	C	30	42
PSM	EEETSIDVAGKPNEVTK	1934	sp|P53985|MOT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8972.11	104.7414	3	1844.8975	1844.9003	K	A	463	480
PSM	AHVVPCFDASK	1935	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	6-UNIMOD:4	ms_run[1]:scan=1.1.9146.5	109.3118	3	1229.5870	1229.5863	K	V	1152	1163
PSM	TTQQDLSALQK	1936	sp|Q9UPN3|MACF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9163.9	109.7753	2	1231.6374	1231.6408	R	N	3644	3655
PSM	HGGVIHIYVDK	1937	sp|Q14498-2|RBM39_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9022.6	106.0575	3	1236.6619	1236.6615	K	N	451	462
PSM	NDVNWSQPGEK	1938	sp|Q13492-2|PICAL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8854.10	101.6425	2	1272.5732	1272.5735	K	K	560	571
PSM	ENGVTDDLDAPK	1939	sp|Q9BQ39|DDX50_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9056.11	106.9748	2	1272.5792	1272.5834	R	A	49	61
PSM	GLSEDTTEETLK	1940	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9185.4	110.3563	3	1321.6231	1321.6249	K	E	578	590
PSM	VLEEANQAINPK	1941	sp|Q92841-3|DDX17_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9075.4	107.467	3	1324.7008	1324.6986	K	L	457	469
PSM	VLEEANQAINPK	1942	sp|Q92841-3|DDX17_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9062.11	107.1353	2	1324.6938	1324.6986	K	L	457	469
PSM	TNLDESDVQPVK	1943	sp|Q9Y3I0|RTCB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8907.5	103.0095	3	1343.6572	1343.6569	R	E	129	141
PSM	VVTDTDETELAR	1944	sp|P05198|IF2A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8841.9	101.3032	2	1347.6502	1347.6518	K	Q	277	289
PSM	LNQPPEDGISSVK	1945	sp|O43684-2|BUB3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9174.11	110.0753	2	1382.7010	1382.7041	K	F	9	22
PSM	NGQVIGIGAGQQSR	1946	sp|P31939-2|PUR9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8834.11	101.1234	2	1383.7190	1383.7219	K	I	437	451
PSM	MGITEYNNQCR	1947	sp|P41252|SYIC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	10-UNIMOD:4	ms_run[1]:scan=1.1.9085.7	107.7363	2	1384.5824	1384.5863	K	A	111	122
PSM	TNHIYVSSDDIK	1948	sp|Q6P2Q9|PRP8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8915.4	103.2141	3	1390.6732	1390.6729	R	E	2087	2099
PSM	SNLNSLDEQEGVK	1949	sp|O75223|GGCT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9160.9	109.6947	2	1431.6816	1431.6841	K	S	89	102
PSM	YELISETGGSHDK	1950	sp|Q12906-7|ILF3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8936.11	103.7769	2	1434.6582	1434.6627	K	R	545	558
PSM	SSGASVTTQPTEFK	1951	sp|Q9BY77|PDIP3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8849.10	101.5121	2	1438.6892	1438.6940	K	I	405	419
PSM	DQTPDENDQVIVK	1952	sp|Q9NZI8|IF2B1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8881.11	102.3526	2	1499.7064	1499.7104	R	I	526	539
PSM	YSPTSPTYSPTSPK	1953	sp|P24928|RPB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8971.11	104.7146	2	1511.7096	1511.7144	K	Y	1909	1923
PSM	APVPGTPDSLSSGSSR	1954	sp|Q9UJZ1-2|STML2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9159.10	109.6695	2	1513.7328	1513.7373	K	D	277	293
PSM	YEQGTGCWQGPNR	1955	sp|P14314-2|GLU2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	7-UNIMOD:4	ms_run[1]:scan=1.1.9137.10	109.0838	2	1551.6474	1551.6525	K	S	462	475
PSM	NADGTICYDSTHYK	1956	sp|P14550|AK1A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	7-UNIMOD:4	ms_run[1]:scan=1.1.9101.9	108.156	3	1643.6860	1643.6886	K	E	128	142
PSM	RAAAEVNQDYGLDPK	1957	sp|P07954-2|FUMH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9141.8	109.1843	3	1645.8049	1645.8060	K	I	58	73
PSM	EGQGEGETQEAAAATAAAR	1958	sp|P58107|EPIPL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9041.11	106.574	2	1816.8214	1816.8187	R	R	3681	3700
PSM	ALEQKPDDAQYYCQR	1959	sp|Q9Y2Z0-2|SGT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	13-UNIMOD:4	ms_run[1]:scan=1.1.8921.11	103.3809	2	1883.8446	1883.8472	K	A	37	52
PSM	SVDPDSPAEASGLR	1960	sp|O14745|NHRF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9316.10	113.8395	2	1399.6582	1399.6579	R	A	181	195
PSM	GHYNNVSCAVFHPR	1961	sp|P53621-2|COPA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	8-UNIMOD:4	ms_run[1]:scan=1.1.9533.4	119.6273	4	1656.7573	1656.7579	R	Q	247	261
PSM	SVHFPGQAVGTR	1962	sp|Q06210|GFPT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9217.4	111.2012	3	1254.6493	1254.6469	K	R	191	203
PSM	IAHLAQIEDDR	1963	sp|A6NHR9|SMHD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9357.3	114.9026	3	1279.6534	1279.6520	K	A	1726	1737
PSM	GHTDSVQDISFDHSGK	1964	sp|P43034|LIS1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9311.7	113.7006	4	1728.7741	1728.7704	K	L	148	164
PSM	YAVTTGDHGIIR	1965	sp|P53621-2|COPA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9429.5	116.8295	3	1301.6740	1301.6728	K	T	560	572
PSM	LNQLKPGLQYK	1966	sp|Q12906-7|ILF3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9337.6	114.384	3	1300.7518	1300.7503	R	L	409	420
PSM	VILGSEAAQQHPEEVR	1967	sp|Q9NY33-4|DPP3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9300.4	113.3993	4	1761.8993	1761.9009	R	G	96	112
PSM	KLEEEGEQFVK	1968	sp|P22307-7|NLTP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9376.2	115.4091	3	1334.6737	1334.6718	K	K	399	410
PSM	IQTQPGYANTLR	1969	sp|Q00325-2|MPCP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9322.7	113.9917	3	1360.7068	1360.7099	R	D	189	201
PSM	GAVHQLCQSLAGK	1970	sp|P09417-2|DHPR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	7-UNIMOD:4	ms_run[1]:scan=1.1.9279.5	112.8397	3	1367.6971	1367.6980	K	N	124	137
PSM	TVEGVLIVHEHR	1971	sp|O43809|CPSF5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9457.8	117.5901	3	1387.7581	1387.7572	R	L	79	91
PSM	CVSSPHFQVAER	1972	sp|Q15173-2|2A5B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	1-UNIMOD:4	ms_run[1]:scan=1.1.9208.5	110.9646	3	1415.6647	1415.6616	R	A	362	374
PSM	NISHDTFGTTYGR	1973	sp|Q9H7B2|RPF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9443.7	117.21	3	1467.6715	1467.6743	K	I	253	266
PSM	NISHDTFGTTYGR	1974	sp|Q9H7B2|RPF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9462.8	117.7247	3	1467.6715	1467.6743	K	I	253	266
PSM	LVLVGDGGTGK	1975	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9383.6	115.6044	2	1014.5696	1014.5710	K	T	13	24
PSM	SLLSAEEAAK	1976	sp|Q7KZF4|SND1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9475.9	118.077	2	1017.5316	1017.5342	K	Q	642	652
PSM	ALTSELANAR	1977	sp|P26038|MOES_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9421.10	116.6265	2	1044.5534	1044.5563	K	D	524	534
PSM	HWGGNVLGPK	1978	sp|P62424|RL7A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9346.8	114.6223	2	1063.5552	1063.5563	R	S	236	246
PSM	TGTITTFEHAHNMR	1979	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9287.5	113.0514	3	1614.7567	1614.7573	K	V	482	496
PSM	LVIVGDGACGK	1980	sp|P08134|RHOC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	9-UNIMOD:4	ms_run[1]:scan=1.1.9331.9	114.2306	2	1087.5686	1087.5696	K	T	8	19
PSM	LLCGGGIAADR	1981	sp|P05091-2|ALDH2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	3-UNIMOD:4	ms_run[1]:scan=1.1.9208.10	110.9729	2	1101.5572	1101.5601	K	G	337	348
PSM	ALAAAGYDVEK	1982	sp|P16402|H13_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9293.9	113.2193	2	1106.5578	1106.5608	K	N	66	77
PSM	SSDEAVILCK	1983	sp|Q9UNM6-2|PSD13_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	9-UNIMOD:4	ms_run[1]:scan=1.1.9243.9	111.9058	2	1120.5404	1120.5434	K	T	108	118
PSM	EAIEGTYIDK	1984	sp|P62280|RS11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9532.10	119.6105	2	1137.5512	1137.5553	K	K	49	59
PSM	YATALYSAASK	1985	sp|P48047|ATPO_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9383.8	115.6078	2	1144.5746	1144.5764	R	Q	41	52
PSM	VNVPVIGGHAGK	1986	sp|P40926|MDHM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9516.2	119.1669	3	1146.6517	1146.6510	R	T	192	204
PSM	PAVCYQAITK	1987	sp|Q49A26-3|GLYR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	4-UNIMOD:4	ms_run[1]:scan=1.1.9477.11	118.1341	2	1149.5818	1149.5852	K	K	228	238
PSM	SGASEANLIVAK	1988	sp|P46013|KI67_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9359.8	114.9642	2	1158.6216	1158.6244	R	S	648	660
PSM	EGIVQTEQIR	1989	sp|Q6P1J9|CDC73_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9199.8	110.7323	2	1171.6176	1171.6197	K	S	162	172
PSM	RLTELETAVR	1990	sp|Q13561-2|DCTN2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9458.10	117.6203	2	1186.6642	1186.6670	K	C	235	245
PSM	VLVDQTTGLSR	1991	sp|Q15717-2|ELAV1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9488.10	118.4281	2	1187.6490	1187.6510	R	G	164	175
PSM	MLSGIGAEGEAR	1992	sp|Q13112|CAF1B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.9430.10	116.8645	2	1189.596247	1189.576122	K	S	212	224
PSM	VMLGETNPADSKPGTIR	1993	sp|P15531-2|NDKA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	2-UNIMOD:35	ms_run[1]:scan=1.1.9375.8	115.3921	3	1800.9004	1800.9040	R	G	114	131
PSM	READGSETPEPFAAEAK	1994	sp|Q7KZF4|SND1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9460.9	117.6726	3	1803.8239	1803.8275	R	F	233	250
PSM	EAVLSCSQALK	1995	sp|Q6PGP7|TTC37_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	6-UNIMOD:4	ms_run[1]:scan=1.1.9314.8	113.7829	2	1204.6024	1204.6122	K	I	324	335
PSM	TEEGPTLSYGR	1996	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9330.10	114.206	2	1208.5652	1208.5673	R	D	150	161
PSM	DQVANSAFVER	1997	sp|P07900-2|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9324.11	114.0507	2	1234.5920	1234.5942	K	L	622	633
PSM	SLDVNQDSELK	1998	sp|Q99584|S10AD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9230.9	111.5588	2	1246.6018	1246.6041	K	F	62	73
PSM	CNTDDTIGDLK	1999	sp|Q9BZL1|UBL5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	1-UNIMOD:4	ms_run[1]:scan=1.1.9239.11	111.8029	2	1250.5490	1250.5449	K	K	18	29
PSM	AISSTEAVLNNR	2000	sp|Q5T8P6-2|RBM26_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9455.10	117.5393	2	1273.6596	1273.6626	K	F	586	598
PSM	TTQFSCTLGEK	2001	sp|Q01469|FABP5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	6-UNIMOD:4	ms_run[1]:scan=1.1.9465.10	117.809	2	1270.5832	1270.5864	K	F	62	73
PSM	LPTDLTACDNR	2002	sp|Q96RS6-2|NUDC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	8-UNIMOD:4	ms_run[1]:scan=1.1.9524.10	119.3952	2	1274.5874	1274.5925	R	L	75	86
PSM	EGIREETVSLR	2003	sp|P20618|PSB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9393.10	115.8807	2	1287.6744	1287.6783	K	K	229	240
PSM	ICNQVLVCER	2004	sp|Q9P2R7-2|SUCB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	2-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.9390.9	115.7983	2	1289.6158	1289.6220	R	K	129	139
PSM	EALQDVEDENQ	2005	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9521.11	119.3163	2	1288.5392	1288.5419	K	-	245	256
PSM	VCDEPHPLLVK	2006	sp|P35250-2|RFC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	2-UNIMOD:4	ms_run[1]:scan=1.1.9300.3	113.3977	3	1305.6745	1305.6751	K	E	220	231
PSM	QSTDEEVTSLAK	2007	sp|P23193|TCEA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9397.10	115.9888	2	1306.6224	1306.6252	K	S	56	68
PSM	QSTDEEVTSLAK	2008	sp|P23193|TCEA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9378.10	115.4762	2	1306.6224	1306.6252	K	S	56	68
PSM	EAQLYAAQAHLK	2009	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9410.4	116.3285	3	1341.7039	1341.7041	K	L	536	548
PSM	LLEEENQESLR	2010	sp|P48681|NEST_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9395.11	115.9365	2	1358.6658	1358.6677	R	S	883	894
PSM	AEAGGGWEGSASYK	2011	sp|Q969T9|WBP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9314.9	113.7846	2	1368.5932	1368.5946	K	L	98	112
PSM	SGYGFNEPEQSR	2012	sp|Q5BKZ1|ZN326_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9422.11	116.6544	2	1369.5862	1369.5898	R	F	91	103
PSM	VLIGGDETPEGQR	2013	sp|O60701|UGDH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9236.11	111.723	2	1369.6770	1369.6838	R	A	178	191
PSM	IAAENELNQSYK	2014	sp|O15397|IPO8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9406.11	116.2329	2	1378.6710	1378.6728	R	I	20	32
PSM	TWEQQQEVVSR	2015	sp|Q9UJU6-2|DBNL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9311.11	113.7073	2	1388.6636	1388.6684	R	N	237	248
PSM	YGDGGSTFQSTTGHCVHMR	2016	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	15-UNIMOD:4	ms_run[1]:scan=1.1.9349.10	114.7036	3	2096.8768	2096.8793	R	G	276	295
PSM	SVDPDSPAEASGLR	2017	sp|O14745|NHRF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9336.9	114.3625	2	1399.6544	1399.6579	R	A	181	195
PSM	VASSPVMVSNPATR	2018	sp|P51610-2|HCFC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9453.11	117.4868	2	1414.7232	1414.7238	K	M	526	540
PSM	INEVQTDVGVDTK	2019	sp|Q12792-4|TWF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9210.10	111.0257	2	1416.7026	1416.7097	K	H	61	74
PSM	SQGGEPTYNVAVGR	2020	sp|P35080|PROF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9323.10	114.0228	2	1433.6862	1433.6899	K	A	92	106
PSM	LNEIVGNEDTVSR	2021	sp|P35250-2|RFC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9522.11	119.343	2	1444.7114	1444.7158	K	L	47	60
PSM	LNEIVGNEDTVSR	2022	sp|P35250-2|RFC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9541.11	119.8473	2	1444.7114	1444.7158	K	L	47	60
PSM	LGNYAGAVQDCER	2023	sp|O43765|SGTA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	11-UNIMOD:4	ms_run[1]:scan=1.1.9352.11	114.7844	2	1451.6422	1451.6463	K	A	138	151
PSM	TEQGPQVDETQFK	2024	sp|P05091-2|ALDH2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9511.10	119.0457	2	1505.6986	1505.6998	K	K	309	322
PSM	EYAEDDNIYQQK	2025	sp|Q96FW1|OTUB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9249.11	112.068	2	1514.6468	1514.6525	K	I	60	72
PSM	KVEELQACVETAR	2026	sp|Q14980-2|NUMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	8-UNIMOD:4	ms_run[1]:scan=1.1.9227.11	111.4816	2	1531.7584	1531.7664	R	Q	651	664
PSM	EDQSILCTGESGAGK	2027	sp|P35580-3|MYH10_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	7-UNIMOD:4	ms_run[1]:scan=1.1.9439.11	117.1088	2	1550.6838	1550.6882	R	T	170	185
PSM	YTPSQQGVAFNSGAK	2028	sp|Q13573|SNW1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9296.11	113.3035	2	1553.7424	1553.7474	R	Q	179	194
PSM	YQVSSLCGTDNEDK	2029	sp|Q9UBW7|ZMYM2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	7-UNIMOD:4	ms_run[1]:scan=1.1.9418.11	116.5497	2	1614.6794	1614.6832	R	I	1262	1276
PSM	QLEVEPEEPEAENK	2030	sp|P36776|LONM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9474.11	118.0532	2	1639.7562	1639.7577	R	H	219	233
PSM	YSNSEVVTGSGLDSQK	2031	sp|Q96F07|CYFP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9438.11	117.0818	2	1669.7772	1669.7795	R	S	366	382
PSM	EDLNCQEEEDPMNK	2032	sp|O75821|EIF3G_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	5-UNIMOD:4	ms_run[1]:scan=1.1.9277.11	112.7973	2	1749.6766	1749.6821	K	L	135	149
PSM	HQAFEAELSANQSR	2033	sp|Q13813|SPTN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9460.5	117.6659	3	1586.7418	1586.7437	K	I	614	628
PSM	ILELSGSSSEDSEK	2034	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9492.3	118.5239	3	1479.6913	1479.6940	R	V	3359	3373
PSM	QDHAQQLATAAEER	2035	sp|Q14980-2|NUMA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8689.8	97.21817	3	1566.7378	1566.7386	R	E	579	593
PSM	LAQGHTTVDELAR	2036	sp|Q15149|PLEC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8541.7	93.28038	3	1409.7292	1409.7263	R	R	2809	2822
PSM	CPPGVVPACHNSK	2037	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	1-UNIMOD:4,9-UNIMOD:4	ms_run[1]:scan=1.1.7200.7	57.99443	3	1421.6578	1421.6544	R	D	634	647
PSM	GSVEEPKPEEPK	2038	sp|Q02952-2|AKA12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7232.4	58.83617	3	1324.6555	1324.6510	K	R	561	573
PSM	FGQGGAGPVGGQGPR	2039	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8228.3	85.00352	3	1340.6488	1340.6586	R	G	667	682
PSM	EYINECDSDYHEER	2040	sp|Q93008-1|USP9X_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	6-UNIMOD:4	ms_run[1]:scan=1.1.8843.9	101.3551	3	1857.7072	1857.7111	R	T	859	873
PSM	AEAGPEGVAPAPEGEKK	2041	sp|Q9Y4L1|HYOU1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7480.10	65.4045	3	1635.8143	1635.8104	K	Q	670	687
PSM	VLEEANQAINPK	2042	sp|Q92841-3|DDX17_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9069.5	107.311	3	1324.7008	1324.6986	K	L	457	469
PSM	IIHTSVWAGQK	2043	sp|Q6P2Q9|PRP8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9229.7	111.5286	3	1238.6776	1238.6772	K	R	1821	1832
PSM	VDEVPDGAVKPPTNK	2044	sp|O75475|PSIP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8716.9	97.94532	3	1564.8082	1564.8097	R	L	25	40
PSM	AEGDVAALNR	2045	sp|P67936|TPM4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7996.3	78.96484	2	1014.5100	1014.5094	K	R	45	55
PSM	GETVNDCHAEIISR	2046	sp|P55265-2|DSRAD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	7-UNIMOD:4	ms_run[1]:scan=1.1.8623.9	95.4454	3	1599.7312	1599.7311	K	R	877	891
PSM	GCPEDAAVCAVDK	2047	sp|P11717|MPRI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	2-UNIMOD:4,9-UNIMOD:4	ms_run[1]:scan=1.1.9358.11	114.9425	2	1390.5798	1390.5857	R	N	530	543
PSM	TPTSSPASSPLVAK	2048	sp|Q14684|RRP1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8443.11	90.68478	2	1341.7120	1341.7140	K	K	728	742
PSM	KAEPSEVDMNSPK	2049	sp|Q9NR30|DDX21_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7447.7	64.50512	3	1430.6428	1430.6711	K	S	61	74
PSM	ENTAAENGLTVR	2050	sp|Q12789-3|TF3C1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8286.9	86.51437	2	1273.6236	1273.6262	K	L	1144	1156
PSM	PLSSVQENIQQK	2051	sp|P52732|KIF11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8855.7	101.664	3	1369.7194	1369.7201	K	S	746	758
PSM	IDDIADGAVKPPPNK	2052	sp|Q7Z4V5-2|HDGR2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9251.9	112.1169	3	1548.8116	1548.8148	R	Y	25	40
PSM	NDIASHPPVEGSYAPR	2053	sp|Q7KZF4|SND1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9462.11	117.7297	3	1708.8121	1708.8169	R	R	716	732
PSM	QDAQSLLAPGK	2054	sp|Q9UDR5|AASS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9543.8	119.8939	2	1126.5960	1126.5982	R	F	323	334
PSM	KTDAVYDPAEYDK	2055	sp|Q9UDR5|AASS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9515.9	119.1516	3	1513.6918	1513.6936	R	H	274	287
PSM	SGGTEGLLAEK	2056	sp|Q9UHB9|SRP68_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8832.7	101.0645	2	1060.5378	1060.5400	R	L	267	278
PSM	KPLLESGTLGTK	2057	sp|P22314|UBA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9230.5	111.5522	3	1242.7201	1242.7183	R	G	593	605
PSM	ALEQKPDDAQYYCQR	2058	sp|Q9Y2Z0-2|SGT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	13-UNIMOD:4	ms_run[1]:scan=1.1.8934.11	103.7237	3	1883.8450	1883.8472	K	A	37	52
PSM	SVDPDSPAEASGLR	2059	sp|O14745|NHRF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9320.3	113.9328	3	1399.6747	1399.6579	R	A	181	195
PSM	RVVLASASPR	2060	sp|O95671-2|ASML_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7420.3	63.76782	3	1054.6273	1054.6247	K	R	14	24
PSM	EAHEPLAVADAK	2061	sp|Q9Y2X3|NOP58_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7952.6	77.81682	3	1249.6318	1249.6302	K	L	82	94
PSM	DETGELSSADEK	2062	sp|Q92900-2|RENT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7676.11	70.65385	2	1279.5444	1279.5415	K	R	582	594
PSM	VAEAHENIIHGSGATGK	2063	sp|Q08257|QOR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7375.6	62.5561	4	1689.8485	1689.8434	K	M	308	325
PSM	IATGQIAGVDK	2064	sp|Q9HC35|EMAL4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8513.8	92.54053	2	1071.5924	1071.5924	R	D	324	335
PSM	DAEGSTCLHLAAK	2065	sp|Q9H9B1|EHMT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	7-UNIMOD:4	ms_run[1]:scan=1.1.8794.4	100.0398	3	1371.6454	1371.6452	K	K	836	849
PSM	HELQANCYEEVK	2066	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	7-UNIMOD:4	ms_run[1]:scan=1.1.8567.4	93.975	3	1518.6838	1518.6773	K	D	133	145
PSM	SEMTPEELQK	2067	sp|P62316|SMD2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.8746.11	98.7576	2	1190.5508	1190.5489	K	R	9	19
PSM	LPSRPGAQGVEPQNLR	2068	sp|Q8WXI9|P66B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9456.8	117.563	3	1717.9192	1717.9223	K	T	225	241
PSM	RAEYFDGSEPVQNR	2069	sp|Q9HCS7|SYF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9200.9	110.7604	3	1666.7698	1666.7699	R	V	466	480
PSM	KGDSNANSDVCAAALR	2070	sp|Q8IZL8|PELP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	11-UNIMOD:4	ms_run[1]:scan=1.1.8080.11	81.20808	3	1647.7633	1647.7635	R	G	512	528
PSM	TGVHHYSGNNIELGTACGK	2071	sp|P62888|RL30_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	17-UNIMOD:4	ms_run[1]:scan=1.1.9002.8	105.5273	3	2013.9085	2013.9327	K	Y	69	88
PSM	MKDTDSEEEIR	2072	sp|P0DP23|CALM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7279.11	60.05707	2	1351.5990	1351.5925	K	E	77	88
PSM	VAAASGHCGAFSGSDSSR	2073	sp|Q9NZB2-6|F120A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	8-UNIMOD:4	ms_run[1]:scan=1.1.7350.9	61.89213	3	1722.7438	1722.7380	R	T	940	958
PSM	SLTEHGVAATDGR	2074	sp|O75970-2|MPDZ_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7429.7	64.01823	3	1312.6405	1312.6371	K	L	1510	1523
PSM	RVAIDNTNPDAASR	2075	sp|Q96T60-2|PNKP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.7495.11	65.80283	3	1498.7494	1498.7488	K	A	379	393
PSM	IIEEAPAPGIK	2076	sp|Q96RQ3|MCCA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9453.9	117.4834	2	1136.6396	1136.6441	K	S	285	296
PSM	LSANQQNILK	2077	sp|P57088|TMM33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.9023.7	106.0859	2	1127.6284	1127.6298	K	F	149	159
PSM	CPTPGCNSLGHLTGK	2078	sp|O95251|KAT7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	1-UNIMOD:4,6-UNIMOD:4	ms_run[1]:scan=1.1.9428.4	116.8012	3	1597.7359	1597.7341	K	H	185	200
PSM	NHAVVCQGCHNAIDPEVQR	2079	sp|Q9UGI8|TES_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	6-UNIMOD:4,9-UNIMOD:4	ms_run[1]:scan=1.1.8492.10	91.99062	4	2203.0101	2203.0011	K	V	356	375
PSM	QEPERNECFLQHK	2080	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:28,8-UNIMOD:4	ms_run[1]:scan=1.1.9526.10	119.4492	3	1697.7592	1696.7622	K	D	118	131
PSM	TDNAGDQHGGGGGGGGGAGAAGGGGGGENYDDPHK	2081	sp|P14866|HNRPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.7161.11	56.93805	4	2981.178894	2980.195259	K	T	63	98
PSM	LCECSFNDPNAK	2082	sp|Q96KR1|ZFR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	2-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=1.1.8943.11	103.9639	2	1454.601047	1453.596600	K	E	586	598
PSM	AAAAAGTATSQR	2083	sp|Q9Y2Z0|SGT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:1	ms_run[1]:scan=1.1.7864.11	75.5236	2	1117.5552	1116.5522	M	F	2	14
PSM	VIGSGCNLDSAR	2084	sp|Q6ZMR3|LDH6A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	6-UNIMOD:4	ms_run[1]:scan=1.1.8308.11	87.10567	2	1248.592047	1247.592835	R	F	158	170
PSM	YGDGGSTFQSTTGHCVHMR	2085	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	15-UNIMOD:4	ms_run[1]:scan=1.1.9406.6	116.2245	4	2097.878094	2096.879257	R	G	276	295
PSM	HYAHTDCPGHADYVK	2086	sp|P49411|EFTU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	7-UNIMOD:4	ms_run[1]:scan=1.1.7454.6	64.69295	4	1770.764094	1769.758003	R	N	121	136
PSM	FTNAVTLQQHVR	2087	sp|Q9Y467|SALL2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.9459.6	117.6406	3	1413.750671	1412.752447	K	M	700	712
PSM	ADTLTPEECQQFKK	2088	sp|Q16181|SEPT7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	9-UNIMOD:4	ms_run[1]:scan=1.1.9071.8	107.3687	3	1694.799371	1693.798136	K	Q	196	210
PSM	QAGEVTYADAHK	2089	sp|Q13247|SRSF6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:28	ms_run[1]:scan=1.1.8582.8	94.36847	2	1271.5757	1271.5777	R	E	132	144
PSM	QQQEELEAEHGTGDKPAAPR	2090	sp|Q13895|BYST_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:28	ms_run[1]:scan=1.1.9041.10	106.5723	3	2172.9974	2173.0031	R	E	64	84
PSM	GAVHQLCQSLAGK	2091	sp|P09417|DHPR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	7-UNIMOD:4	ms_run[1]:scan=1.1.9259.4	112.3165	3	1368.695171	1367.697969	K	N	155	168
PSM	ASQNRDPAATSVAAAR	2092	sp|O00762|UBE2C_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:1	ms_run[1]:scan=1.1.8156.9	83.16402	3	1626.8039	1626.8069	M	K	2	18
PSM	QVHPDTGISSK	2093	sp|Q96A08|H2B1A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:28	ms_run[1]:scan=1.1.7776.11	73.24802	2	1150.5637	1150.5613	K	A	49	60
PSM	EFENPEVPREDQQQQHQQR	2094	sp|O60216|RAD21_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.8663.10	96.52098	4	2422.110494	2421.105763	K	D	419	438
PSM	QLEEEQAVRPK	2095	sp|P14635|CCNB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:28	ms_run[1]:scan=1.1.9494.10	118.5895	2	1308.6618	1308.6669	R	Y	180	191
PSM	EAGEQGDIEPR	2096	sp|Q13283|G3BP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.7351.10	61.92082	2	1198.527247	1199.541845	R	R	321	332
PSM	RLHGLDEEAEQK	2097	sp|P33991|MCM4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.7444.8	64.42592	3	1422.714071	1423.705556	K	L	428	440
PSM	LGDQGPPEEAEDR	2098	sp|O00592|PODXL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.7780.11	73.35155	2	1410.602447	1411.621552	K	F	445	458
PSM	QDAQSLHGDIPQK	2099	sp|Q9NR30|DDX21_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.7952.11	77.82515	2	1434.705847	1435.705556	K	Q	462	475
PSM	AEAAVESAVAGPQGR	2100	sp|Q9UHJ6|SHPK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.8703.11	97.60101	2	1410.702647	1411.705556	R	E	44	59
PSM	KVTQLDLDGPK	2101	sp|Q13442|HAP28_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.9072.4	107.3882	3	1211.675771	1212.671403	K	E	95	106
PSM	FGGPVHHQAQR	2102	sp|Q15717-2|ELAV1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.6848.2	48.5372	4	1232.6213	1232.6163	R	F	234	245
PSM	RDQALTEEHAR	2103	sp|P12814-2|ACTN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.6841.2	48.34663	4	1324.6533	1324.6483	R	Q	614	625
PSM	HVLTGSADNSCR	2104	sp|Q13347|EIF3I_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	11-UNIMOD:4	ms_run[1]:scan=1.1.6875.6	49.28035	3	1315.5979	1315.5939	K	L	66	78
PSM	EAGGGGVGGPGAK	2105	sp|Q8NC51-3|PAIRB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.6731.4	45.3687	2	1012.4950	1012.4938	K	S	40	53
PSM	HGATHVFASK	2106	sp|O60264|SMCA5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.6885.6	49.54842	2	1053.5364	1053.5356	R	E	656	666
PSM	SHRPQQNVGVQGAATR	2107	sp|O75362|ZN217_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.6944.10	51.12863	3	1704.8860	1704.8768	K	Q	820	836
PSM	DSVAQGTTNVHSSEHAGR	2108	sp|P46013|KI67_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.6923.11	50.5558	3	1851.8479	1851.8460	K	N	173	191
PSM	VLSTVHTHSSVK	2109	sp|Q13155-2|AIMP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.6881.10	49.44893	2	1293.7046	1293.7041	R	S	79	91
PSM	KTEAPAAPAAQETK	2110	sp|P80723|BASP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.6909.8	50.16648	3	1411.7344	1411.7307	K	S	150	164
PSM	KYHNVGLSK	2111	sp|Q14103-3|HNRPD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.6987.3	52.25907	3	1044.5764	1044.5716	K	C	243	252
PSM	YHTINGHNAEVR	2112	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7205.4	58.12485	4	1409.6849	1409.6800	K	K	162	174
PSM	IIRPSETAGR	2113	sp|P19388|RPAB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7180.4	57.44418	3	1098.6190	1098.6145	K	Y	193	203
PSM	IIRPSETAGR	2114	sp|P19388|RPAB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7181.3	57.4698	3	1098.6190	1098.6145	K	Y	193	203
PSM	IIRPSETAGR	2115	sp|P19388|RPAB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7184.3	57.55138	3	1098.6190	1098.6145	K	Y	193	203
PSM	CCAAADPHECYAK	2116	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	1-UNIMOD:4,2-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.7243.3	59.11815	4	1551.5917	1551.5905	K	V	384	397
PSM	VDSFHESTEGK	2117	sp|Q8WWY3|PRP31_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7161.5	56.92805	3	1234.5487	1234.5466	R	V	305	316
PSM	QKPITPETAEK	2118	sp|P60953|CDC42_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7038.7	53.5879	3	1240.6690	1240.6663	K	L	134	145
PSM	HKSETDTSLIR	2119	sp|P40227-2|TCPZ_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7327.4	61.27887	3	1285.6669	1285.6626	K	G	153	164
PSM	HKSETDTSLIR	2120	sp|P40227-2|TCPZ_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7347.8	61.80938	3	1285.6669	1285.6626	K	G	153	164
PSM	GAPAAATAPAPTAHK	2121	sp|Q92522|H1X_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.6969.6	51.7916	3	1330.7014	1330.6993	R	A	129	144
PSM	VHSQGPHHVCELCNK	2122	sp|P56270-2|MAZ_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	10-UNIMOD:4,13-UNIMOD:4	ms_run[1]:scan=1.1.7047.6	53.83332	4	1800.8225	1800.8148	K	G	412	427
PSM	RGGADVNIR	2123	sp|P08621|RU17_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7105.8	55.40213	2	956.5182	956.5152	R	H	201	210
PSM	AMEAVAAQGK	2124	sp|P18669|PGAM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7153.10	56.71802	2	974.4870	974.4855	K	A	242	252
PSM	IHNAENIQPGEQK	2125	sp|Q04637-3|IF4G1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7167.8	57.09632	3	1476.7333	1476.7321	K	Y	541	554
PSM	VIHAIANSGK	2126	sp|O95453-2|PARN_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7030.4	53.36363	3	1008.5542	1008.5716	R	L	212	222
PSM	CCAAADPHECYAK	2127	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	1-UNIMOD:4,2-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.7216.8	58.4244	3	1551.5926	1551.5905	K	V	384	397
PSM	RMEELHNQEMQK	2128	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7343.8	61.70113	3	1571.7214	1571.7184	R	R	548	560
PSM	VLADPSDDTK	2129	sp|Q15149|PLEC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7307.4	60.7648	2	1059.5082	1059.5084	R	G	2979	2989
PSM	HGSNIEAMSK	2130	sp|Q9BWD1-2|THIC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7099.10	55.24212	2	1072.5024	1072.4971	R	L	253	263
PSM	IAGDQSTLQR	2131	sp|Q92485|ASM3B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7310.6	60.83777	2	1087.5634	1087.5622	R	Y	382	392
PSM	HECGAAFTSK	2132	sp|Q13620-1|CUL4B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	3-UNIMOD:4	ms_run[1]:scan=1.1.7034.8	53.47982	2	1106.4840	1106.4815	K	L	617	627
PSM	PAASLAVHTDK	2133	sp|Q13610|PWP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7317.8	61.02167	3	1108.5916	1108.5877	K	V	291	302
PSM	HAEMVHTGLK	2134	sp|Q01518-2|CAP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7224.10	58.64062	2	1121.5708	1121.5652	K	L	71	81
PSM	LGIHEDSTNR	2135	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7235.4	58.91442	3	1140.5575	1140.5523	K	R	439	449
PSM	LKGTEDELDK	2136	sp|P09493-3|TPM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7214.9	58.3716	2	1146.5764	1146.5768	K	Y	50	60
PSM	PATLTTTSATSK	2137	sp|O43670-2|ZN207_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7248.9	59.25335	2	1177.6180	1177.6190	K	L	336	348
PSM	HQGVMVGMGQK	2138	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	5-UNIMOD:35	ms_run[1]:scan=1.1.7239.7	59.02327	2	1186.5584	1186.5587	R	D	40	51
PSM	KLEQCNTELK	2139	sp|Q9UQE7|SMC3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	5-UNIMOD:4	ms_run[1]:scan=1.1.7198.5	57.93628	3	1261.6354	1261.6336	R	K	968	978
PSM	ELRENTQTTIK	2140	sp|P61978-2|HNRPK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7248.10	59.25502	2	1331.7056	1331.7045	K	L	169	180
PSM	AEEEAATPGGGVER	2141	sp|Q9Y467|SALL2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7315.11	60.97383	2	1371.6282	1371.6266	K	K	461	475
PSM	NPQNSSQSADGLR	2142	sp|P0DN76|U2AF5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7133.11	56.17385	2	1372.6306	1372.6331	R	C	54	67
PSM	THVDSHGHNVFK	2143	sp|P49736|MCM2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7068.11	54.41618	2	1376.6622	1376.6586	R	E	205	217
PSM	EQTFSGGTSQDTK	2144	sp|Q9Y2W1|TR150_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7147.11	56.5552	2	1384.6110	1384.6107	K	A	203	216
PSM	QRPGQQVATCVR	2145	sp|O75534-2|CSDE1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	10-UNIMOD:4	ms_run[1]:scan=1.1.7206.11	58.1628	2	1398.7156	1398.7150	K	L	466	478
PSM	YHTINGHNAEVR	2146	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7216.11	58.4294	2	1409.6808	1409.6800	K	K	162	174
PSM	TPPSEEDSAEAER	2147	sp|O43765|SGTA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7110.11	55.5437	2	1416.6046	1416.6004	R	L	81	94
PSM	ETYGEMADCCAK	2148	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	6-UNIMOD:35,9-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.7350.10	61.8938	2	1449.5234	1449.5210	R	Q	106	118
PSM	FQRPGDPQSAQDK	2149	sp|Q15637-3|SF01_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7350.11	61.89547	2	1472.6722	1472.7008	K	A	294	307
PSM	TCNCETEDYGEK	2150	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	2-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=1.1.7210.11	58.26758	2	1504.5454	1504.5446	K	F	369	381
PSM	SVSGTDVQEECREK	2151	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	11-UNIMOD:4	ms_run[1]:scan=1.1.7160.9	56.90753	3	1622.7235	1622.7206	K	G	244	258
PSM	HIENIHLSGK	2152	sp|Q96JM2-3|ZN462_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7682.4	70.79767	3	1146.6136	1146.6145	R	T	457	467
PSM	GAGTDDHTLIR	2153	sp|P08758|ANXA5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7626.4	69.30715	3	1154.5738	1154.5680	K	V	261	272
PSM	KNYEDEDSLK	2154	sp|P11388-4|TOP2A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7481.5	65.4232	3	1239.5671	1239.5619	K	T	601	611
PSM	YDHQAEEDLR	2155	sp|Q15417|CNN3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7544.5	67.10104	3	1274.5549	1274.5527	K	N	24	34
PSM	DPNDVRPIQAR	2156	sp|Q9H307|PININ_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7595.6	68.4783	3	1279.6642	1279.6633	R	L	33	44
PSM	RALANSLACQGK	2157	sp|P04075-2|ALDOA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	9-UNIMOD:4	ms_run[1]:scan=1.1.7580.6	68.07267	3	1287.6769	1287.6717	K	Y	385	397
PSM	KPALQSSVVATSK	2158	sp|Q9H307|PININ_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7549.8	67.24046	3	1314.7528	1314.7507	K	E	109	122
PSM	NIEEHASADVEK	2159	sp|P61006-2|RAB8A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7434.6	64.15165	3	1340.6242	1340.6208	R	M	105	117
PSM	GPSSVEDIK	2160	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7672.6	70.54182	2	930.4684	930.4658	K	A	240	249
PSM	SSFREEDNTYR	2161	sp|O43747-2|AP1G1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7694.9	71.12688	3	1402.6141	1402.6113	R	C	36	47
PSM	ATHDGAPELGAGGTR	2162	sp|Q9BXW7-2|HDHD5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7465.8	64.9943	3	1408.6726	1408.6695	K	Q	302	317
PSM	NIDEHANEDVER	2163	sp|P61026|RAB10_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7373.7	62.504	3	1439.6287	1439.6277	R	M	106	118
PSM	MRPGVACSVSQAQK	2164	sp|P32969|RL9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	7-UNIMOD:4	ms_run[1]:scan=1.1.7511.10	66.22385	3	1517.7469	1517.7443	R	D	128	142
PSM	EDSVKPGAHLTVK	2165	sp|P51991|ROA3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7557.3	67.44752	4	1379.7469	1379.7409	R	K	114	127
PSM	HIHITQATETTTTR	2166	sp|Q14677-2|EPN4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7484.9	65.511	3	1608.8230	1608.8220	K	H	243	257
PSM	LGVIEDHSNR	2167	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7595.10	68.48497	2	1138.5742	1138.5731	K	T	494	504
PSM	NCLALADDKK	2168	sp|O75367-3|H2AY_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	2-UNIMOD:4	ms_run[1]:scan=1.1.7668.11	70.44607	2	1146.5704	1146.5703	K	L	295	305
PSM	ILTTASSHEFEHTKK	2169	sp|Q16851|UGPA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7662.11	70.28886	3	1727.8834	1727.8842	K	D	39	54
PSM	TLHTEELTSK	2170	sp|Q5T7N2|LITD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7591.11	68.37822	2	1157.5926	1157.5928	R	E	596	606
PSM	SHEGETAYIR	2171	sp|Q07955|SRSF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7504.9	66.0375	2	1161.5442	1161.5414	R	V	182	192
PSM	AIEENNNFSK	2172	sp|P16949-2|STMN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7649.11	69.93842	2	1164.5428	1164.5411	K	M	86	96
PSM	EGVKFDESEK	2173	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7692.11	71.0766	2	1166.5454	1166.5455	K	T	594	604
PSM	EDIYSGGGGGGSR	2174	sp|Q13151|ROA0_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7455.9	64.72504	2	1210.5236	1210.5215	K	S	177	190
PSM	LSSDCEDQIR	2175	sp|Q92896|GSLG1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	5-UNIMOD:4	ms_run[1]:scan=1.1.7695.9	71.15358	2	1221.5290	1221.5296	R	I	980	990
PSM	TQIQSQESDLK	2176	sp|Q9UBC2-2|EP15R_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7693.11	71.1034	2	1275.6280	1275.6306	K	S	482	493
PSM	LSNTGEYESQR	2177	sp|Q8N490-2|PNKD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7357.10	62.0826	2	1282.5812	1282.5789	R	F	113	124
PSM	LCVQNSPQEAR	2178	sp|P33240-2|CSTF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	2-UNIMOD:4	ms_run[1]:scan=1.1.7577.10	67.99825	2	1300.6194	1300.6194	K	N	149	160
PSM	NLSSTTDDEAPR	2179	sp|O00515|LAD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7455.10	64.7267	2	1304.5872	1304.5844	R	L	36	48
PSM	QGCDCECLGGGR	2180	sp|Q9NRX4-2|PHP14_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	3-UNIMOD:4,5-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=1.1.7380.11	62.69937	2	1367.5018	1367.5017	K	I	67	79
PSM	EGQNYQQNCIK	2181	sp|O96000-2|NDUBA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	9-UNIMOD:4	ms_run[1]:scan=1.1.7413.10	63.58983	2	1380.6092	1380.6092	R	E	111	122
PSM	SGSMDPSGAHPSVR	2182	sp|Q07666|KHDR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7430.7	64.0452	3	1383.6223	1383.6201	R	Q	18	32
PSM	SYCNDQSTGDIK	2183	sp|P00492|HPRT_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	3-UNIMOD:4	ms_run[1]:scan=1.1.7406.11	63.40213	2	1386.5730	1386.5722	K	V	104	116
PSM	YTHAANTVVYSSNK	2184	sp|Q6UXN9|WDR82_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7512.11	66.25218	3	1553.7490	1553.7474	R	I	71	85
PSM	NYQQNYQNSESGEK	2185	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7374.11	62.53758	2	1687.7120	1687.7074	R	N	157	171
PSM	RVLIAAHGNSLR	2186	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7864.5	75.5136	4	1305.7677	1305.7629	K	G	180	192
PSM	TLHPDLGTDK	2187	sp|P00338-3|LDHA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7787.2	73.51632	3	1095.5605	1095.5560	K	D	242	252
PSM	TLHPDLGTDK	2188	sp|P00338-3|LDHA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7807.3	74.03585	3	1095.5605	1095.5560	K	D	242	252
PSM	LDPHNHVLYSNR	2189	sp|P31948|STIP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8035.5	79.99313	4	1463.7285	1463.7269	K	S	33	45
PSM	LDPHNHVLYSNR	2190	sp|P31948|STIP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8034.3	79.963	4	1463.7285	1463.7269	K	S	33	45
PSM	LDPHNHVLYSNR	2191	sp|P31948|STIP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8033.5	79.93932	4	1463.7285	1463.7269	K	S	33	45
PSM	YALTGDEVKK	2192	sp|P62701|RS4X_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7970.4	78.29655	3	1122.5944	1122.5921	K	I	54	64
PSM	SETAPAETATPAPVEK	2193	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7967.11	78.22853	2	1597.7820	1597.7835	M	S	2	18
PSM	SVSLVGEDERK	2194	sp|Q96GQ7|DDX27_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7773.7	73.1631	3	1217.6248	1217.6252	R	M	563	574
PSM	IHFHNLQGEK	2195	sp|Q8TC12|RDH11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7938.4	77.44659	3	1221.6259	1221.6254	R	F	185	195
PSM	HTVDDGLDIRK	2196	sp|Q86VP6|CAND1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8051.7	80.42744	3	1267.6567	1267.6521	K	A	1073	1084
PSM	RESQSVEEALK	2197	sp|P49915|GUAA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7867.6	75.59563	3	1274.6482	1274.6466	K	K	278	289
PSM	AKLEEQAQQIR	2198	sp|P02649|APOE_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7841.4	74.91698	3	1312.7113	1312.7099	R	L	259	270
PSM	GDVTAEEAAGASPAK	2199	sp|P49006|MRP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7757.5	72.74758	3	1372.6510	1372.6470	R	A	11	26
PSM	VYIASSSGSTAIKK	2200	sp|O75368|SH3L1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7776.10	73.24635	3	1410.7741	1410.7718	R	K	5	19
PSM	AGFAGDDAPR	2201	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7736.5	72.23087	2	975.4422	975.4410	K	A	19	29
PSM	AGFAGDDAPR	2202	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7716.7	71.71197	2	975.4424	975.4410	K	A	19	29
PSM	TAVCDIPPR	2203	sp|Q9BVA1|TBB2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	4-UNIMOD:4	ms_run[1]:scan=1.1.8018.9	79.54445	2	1027.5166	1027.5121	K	G	351	360
PSM	NGRVEIIANDQGNR	2204	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8021.9	79.62425	3	1554.7894	1554.7862	K	I	47	61
PSM	GGVTEISAADK	2205	sp|Q9NQW7-2|XPP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7865.10	75.54887	2	1046.5260	1046.5244	K	A	355	366
PSM	AAEGVSAADMAK	2206	sp|Q9NW13|RBM28_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7934.9	77.35095	2	1119.5234	1119.5230	K	R	454	466
PSM	AVETVHNLCCNENK	2207	sp|Q8IXH7-4|NELFD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	9-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.7848.9	75.10445	3	1686.7444	1686.7454	K	G	380	394
PSM	VGSVLQEGCGK	2208	sp|P31040-2|SDHA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	9-UNIMOD:4	ms_run[1]:scan=1.1.7912.9	76.7723	2	1132.5558	1132.5547	R	I	480	491
PSM	LFSGPNAANNK	2209	sp|Q96SI9-2|STRBP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7970.10	78.30655	2	1131.5646	1131.5672	K	K	560	571
PSM	SEDLDNSIDK	2210	sp|Q9UQE7|SMC3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7991.6	78.84721	2	1134.5046	1134.5040	R	T	880	890
PSM	VTLTSEEEAR	2211	sp|P00338-3|LDHA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8079.10	81.17979	2	1133.5576	1133.5564	K	L	335	345
PSM	SGELAQEYDK	2212	sp|Q14683|SMC1A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8024.10	79.70623	2	1138.5134	1138.5142	R	R	161	171
PSM	CCTESLVNR	2213	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	1-UNIMOD:4,2-UNIMOD:4	ms_run[1]:scan=1.1.7862.10	75.46882	2	1137.4924	1137.4907	K	R	500	509
PSM	SGELAQEYDK	2214	sp|Q14683|SMC1A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8043.9	80.2151	2	1138.5134	1138.5142	R	R	161	171
PSM	VATSSLDQTVK	2215	sp|Q9BV38|WDR18_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8015.10	79.46735	2	1147.6090	1147.6085	R	L	189	200
PSM	TPVTDPATGAVK	2216	sp|P49748-2|ACADV_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7852.11	75.21188	2	1155.6174	1155.6136	K	E	243	255
PSM	IANPVEGSTDR	2217	sp|Q15366-2|PCBP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7976.10	78.46375	2	1157.5672	1157.5677	K	Q	324	335
PSM	EDKYEEEIK	2218	sp|P06753-2|TPM3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7839.8	74.87772	2	1181.5530	1181.5452	K	L	182	191
PSM	FCDNSSAIQGK	2219	sp|O15067|PUR4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	2-UNIMOD:4	ms_run[1]:scan=1.1.7769.10	73.06351	2	1225.5392	1225.5397	K	E	269	280
PSM	IINDNATYCR	2220	sp|O00567|NOP56_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	9-UNIMOD:4	ms_run[1]:scan=1.1.7979.11	78.54314	2	1238.5708	1238.5713	K	L	203	213
PSM	NTLANSCGTGIR	2221	sp|Q96RE7|NACC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	7-UNIMOD:4	ms_run[1]:scan=1.1.7870.11	75.6841	2	1262.6030	1262.6037	R	S	410	422
PSM	SCYDLSCHAR	2222	sp|P41250|GARS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	2-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=1.1.7884.8	76.05113	2	1267.5062	1267.5074	R	A	465	475
PSM	VAHMETSLGQAR	2223	sp|P48681|NEST_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7967.7	78.22187	3	1298.6407	1298.6401	R	E	197	209
PSM	AAQVAQDEEIAR	2224	sp|Q8IVM0-2|CCD50_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7914.9	76.82387	2	1299.6460	1299.6419	R	L	372	384
PSM	HTNYTMEHIR	2225	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7757.4	72.74592	3	1300.6024	1300.5982	K	V	724	734
PSM	QLEEAEEEATR	2226	sp|P35580-3|MYH10_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8037.11	80.05662	2	1303.5912	1303.5891	R	A	1906	1917
PSM	QLYETTDTTTR	2227	sp|Q9UIA9|XPO7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8002.10	79.1302	2	1327.6254	1327.6256	K	L	17	28
PSM	DTPTSAGPNSFNK	2228	sp|Q8WW12|PCNP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8062.11	80.72993	2	1334.6106	1334.6103	R	G	138	151
PSM	VQIAANEETQER	2229	sp|P49321|NASP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7807.11	74.04919	2	1386.6810	1386.6739	K	E	456	468
PSM	TAPGMGDQSGCYR	2230	sp|Q9BWF3|RBM4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	11-UNIMOD:4	ms_run[1]:scan=1.1.7923.10	77.06517	2	1398.5692	1398.5656	R	C	152	165
PSM	RAGELTEDEVER	2231	sp|P62269|RS18_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7888.11	76.15955	2	1402.6696	1402.6688	K	V	55	67
PSM	YSGGNYRDNYDN	2232	sp|P98179|RBM3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7922.11	77.04012	2	1436.5618	1436.5593	R	-	146	158
PSM	NIIHGSDSVESAEK	2233	sp|P15531-2|NDKA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7974.6	78.4049	3	1484.7106	1484.7107	R	E	140	154
PSM	ITPAHDQNDYEVGQR	2234	sp|P26640|SYVC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7963.10	78.11983	3	1741.8007	1741.8020	K	H	592	607
PSM	ITPAHDQNDYEVGQR	2235	sp|P26640|SYVC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7969.10	78.2801	2	1741.7784	1741.8020	K	H	592	607
PSM	VMQQQQQTTQQQLPQK	2236	sp|Q15459|SF3A1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7749.11	72.55383	2	1940.9724	1940.9738	K	V	116	132
PSM	VTAIHIDPATHR	2237	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8361.3	88.49875	4	1329.7193	1329.7153	R	Q	1052	1064
PSM	GIHVETLETEKK	2238	sp|O95453-2|PARN_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8312.3	87.19801	4	1382.7437	1382.7405	K	E	163	175
PSM	TPASPVVHIR	2239	sp|P14866|HNRPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8328.4	87.62576	3	1075.6171	1075.6138	K	G	98	108
PSM	AALSEEELEKK	2240	sp|Q04637-3|IF4G1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8363.5	88.55569	3	1245.6460	1245.6452	K	S	1195	1206
PSM	FACHSASLTVR	2241	sp|Q15233-2|NONO_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	3-UNIMOD:4	ms_run[1]:scan=1.1.8437.4	90.51189	3	1247.6110	1247.6081	R	N	54	65
PSM	ISSDLDGHPVPK	2242	sp|P29401-2|TKT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8435.4	90.4582	3	1263.6493	1263.6459	K	Q	103	115
PSM	GNLGAGNGNLQGPR	2243	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24		ms_run[1]:scan=1.1.8142.8	82.80293	3	1324.6942	1323.6642	R	H	374	388
PSM	ALLQQQPEDDSK	2244	sp|Q9UHB9|SRP68_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8185.3	83.90791	3	1370.6698	1370.6678	R	R	405	417
PSM	AVESGQLVSVHEK	2245	sp|Q9BRU9|UTP23_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8299.9	86.8607	3	1381.7215	1381.7201	K	E	160	173
PSM	KGQTHTLEDFQR	2246	sp|Q99714-2|HCD2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8288.7	86.5646	3	1458.7222	1458.7215	K	V	105	117
PSM	GGGALSAVAATK	2247	sp|P61011|SRP54_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8417.7	89.98318	2	1001.5486	1001.5506	K	S	256	268
PSM	LGLGEGAEEK	2248	sp|P18754-2|RCC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8143.9	82.83012	2	1001.5052	1001.5029	R	S	357	367
PSM	GEFKDEEETVTTK	2249	sp|Q14677-2|EPN4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8436.7	90.49017	3	1511.6986	1511.6991	K	H	230	243
PSM	GGEIQPVSVK	2250	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8228.5	85.01019	2	1012.5550	1012.5553	K	V	57	67
PSM	GGEIQPVSVK	2251	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8248.5	85.51755	2	1012.5550	1012.5553	K	V	57	67
PSM	TAVCDIPPR	2252	sp|Q9BVA1|TBB2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	4-UNIMOD:4	ms_run[1]:scan=1.1.8331.7	87.7104	2	1027.5116	1027.5121	K	G	351	360
PSM	TAVCDIPPR	2253	sp|Q9BVA1|TBB2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	4-UNIMOD:4	ms_run[1]:scan=1.1.8388.10	89.23378	2	1027.5118	1027.5121	K	G	351	360
PSM	TAVCDIPPR	2254	sp|Q9BVA1|TBB2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	4-UNIMOD:4	ms_run[1]:scan=1.1.8174.5	83.62285	2	1027.5122	1027.5121	K	G	351	360
PSM	TAVCDIPPR	2255	sp|Q9BVA1|TBB2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	4-UNIMOD:4	ms_run[1]:scan=1.1.8369.8	88.72145	2	1027.5222	1027.5121	K	G	351	360
PSM	GDSEPLSEAAQAHTR	2256	sp|O75150-4|BRE1B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8421.11	90.09473	3	1567.7206	1567.7226	R	E	217	232
PSM	YLAEVASGEK	2257	sp|Q04917|1433F_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8350.9	88.2151	2	1065.5342	1065.5342	R	K	133	143
PSM	AAPGAEFAPNK	2258	sp|Q15233-2|NONO_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8398.9	89.49593	2	1071.5342	1071.5349	R	R	368	379
PSM	AAPGAEFAPNK	2259	sp|Q15233-2|NONO_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8379.8	88.98995	2	1071.5342	1071.5349	R	R	368	379
PSM	MLQVASQASR	2260	sp|Q969T9|WBP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8102.8	81.78467	2	1089.5592	1089.5601	R	G	126	136
PSM	VVGCSCVVVK	2261	sp|P25398|RS12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	4-UNIMOD:4,6-UNIMOD:4	ms_run[1]:scan=1.1.8215.7	84.6795	2	1105.5606	1105.5624	K	D	103	113
PSM	VDATAETDLAK	2262	sp|P13667|PDIA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8371.8	88.77533	2	1132.5598	1132.5612	K	R	235	246
PSM	AGGPTTPLSPTR	2263	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8264.7	85.9264	2	1153.6086	1153.6091	R	L	15	27
PSM	NTTGVTEEALK	2264	sp|Q13813|SPTN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8169.9	83.49858	2	1161.5858	1161.5877	R	E	2316	2327
PSM	NQLQSVAAACK	2265	sp|Q5T4S7-2|UBR4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	10-UNIMOD:4	ms_run[1]:scan=1.1.8410.10	89.80728	2	1188.5852	1188.5921	R	V	95	106
PSM	SEDGEIVSTPR	2266	sp|Q12769|NU160_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8201.9	84.3259	2	1188.5604	1188.5622	R	L	949	960
PSM	EGALCEENMR	2267	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	5-UNIMOD:4	ms_run[1]:scan=1.1.8260.9	85.82693	2	1207.4974	1207.4961	K	G	689	699
PSM	SGLQTDYATEK	2268	sp|P46013|KI67_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8310.10	87.1569	2	1211.5642	1211.5670	K	E	264	275
PSM	GASQAGMLAPGTR	2269	sp|Q15417|CNN3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8387.11	89.20865	2	1215.6014	1215.6030	K	R	213	226
PSM	AYTGFSSNSER	2270	sp|O15355|PPM1G_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8139.6	82.73145	2	1217.5300	1217.5313	K	G	210	221
PSM	GASQAGMLAPGTR	2271	sp|Q15417|CNN3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8368.11	88.69973	2	1215.6014	1215.6030	K	R	213	226
PSM	VVEATNSVTAVR	2272	sp|P46100|ATRX_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8269.9	86.06049	2	1244.6698	1244.6725	K	I	2335	2347
PSM	RNPALYASNVR	2273	sp|Q8NF37|PCAT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8090.10	81.47435	2	1259.6758	1259.6734	K	R	285	296
PSM	LITAADTTAEQR	2274	sp|Q9NPF5|DMAP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8165.9	83.39577	2	1288.6592	1288.6623	K	R	271	283
PSM	YSPGYNTEVGDK	2275	sp|O95299|NDUAA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8370.11	88.7534	2	1328.5848	1328.5885	K	W	339	351
PSM	RLAPEYEAAATR	2276	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8379.10	88.99329	2	1346.6918	1346.6942	K	L	62	74
PSM	QSVENDIHGLRK	2277	sp|P05783|K1C18_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8380.11	89.02175	2	1394.7242	1394.7266	R	V	176	188
PSM	LHNAIEGGTQLSR	2278	sp|O60832|DKC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8286.10	86.51604	2	1394.7256	1394.7266	R	A	159	172
PSM	YLAEVACGDDRK	2279	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	7-UNIMOD:4	ms_run[1]:scan=1.1.8177.10	83.71111	3	1395.6466	1395.6452	R	Q	128	140
PSM	SLDNNYSTPNER	2280	sp|O60716-11|CTND1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8142.11	82.80793	2	1408.6190	1408.6219	K	G	845	857
PSM	WDQTADQTPGATPK	2281	sp|O75533|SF3B1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8378.11	88.96825	2	1514.6964	1514.7001	R	K	200	214
PSM	QGEDNSTAQDTEELEK	2282	sp|Q86UE4|LYRIC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8291.11	86.65172	2	1792.7640	1792.7599	K	E	452	468
PSM	VSVADHSLHLSK	2283	sp|Q13162|PRDX4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8814.2	100.5756	4	1291.6921	1291.6884	R	A	67	79
PSM	TPLRPLDPTR	2284	sp|Q04637-3|IF4G1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8765.4	99.25937	3	1164.6631	1164.6615	K	L	607	617
PSM	FGVAPDHPEVK	2285	sp|P22570-3|ADRO_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8690.3	97.2368	3	1194.6052	1194.6033	R	N	123	134
PSM	IFHELTQTDK	2286	sp|P11586|C1TC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8583.5	94.38911	3	1230.6265	1230.6245	R	A	464	474
PSM	SPQYCQVIHR	2287	sp|Q13228-4|SBP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	5-UNIMOD:4	ms_run[1]:scan=1.1.8786.5	99.82648	3	1286.6203	1286.6190	K	L	95	105
PSM	RVDATAGWSAAGK	2288	sp|Q10570|CPSF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8673.6	96.78267	3	1288.6531	1288.6524	K	S	423	436
PSM	LPANHPLLTGQR	2289	sp|P38606-2|VATA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8569.3	94.02634	3	1315.7374	1315.7361	K	V	188	200
PSM	FRPDMEEEEAK	2290	sp|Q99436|PSB7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8487.4	91.85011	3	1379.6035	1379.6027	K	N	185	196
PSM	APLKPYPVSPSDK	2291	sp|P41252|SYIC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8631.7	95.65714	3	1397.7553	1397.7554	K	V	1039	1052
PSM	NIVEAAAVR	2292	sp|Q5JNZ5|RS26L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8816.8	100.6398	2	941.5298	941.5294	R	D	43	52
PSM	ADGYVLEGK	2293	sp|P62241|RS8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8636.8	95.79292	2	950.4716	950.4709	R	E	185	194
PSM	AEELGQELK	2294	sp|Q14980-2|NUMA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8821.8	100.7745	2	1015.5174	1015.5186	R	A	1322	1331
PSM	GVEEEEEDGEMRE	2295	sp|P62306|RUXF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8493.8	92.01347	3	1536.5869	1536.5886	R	-	74	87
PSM	LDSPAGTALSPSGHTK	2296	sp|P32322-3|P5CR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8641.7	95.92592	3	1537.7740	1537.7736	K	L	319	335
PSM	ILTTSEDSNAQEIK	2297	sp|Q9H6V9-2|LDAH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8782.7	99.7221	3	1547.7640	1547.7679	K	D	100	114
PSM	TPPVFASEGK	2298	sp|Q96PZ0-2|PUS7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8707.8	97.70403	2	1031.5268	1031.5288	K	Y	616	626
PSM	AGITTTLNSR	2299	sp|P33992|MCM5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8633.6	95.70905	2	1032.5544	1032.5564	K	C	472	482
PSM	LYPTSCHTACTLR	2300	sp|Q08431-2|MFGM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	6-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.8641.8	95.92758	3	1578.7285	1578.7283	R	F	95	108
PSM	DVLPQKEEINQGGR	2301	sp|Q5T7N2|LITD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8776.7	99.56075	3	1581.8080	1581.8111	K	K	315	329
PSM	IAQITGPPDR	2302	sp|Q96AE4-2|FUBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8601.9	94.85786	2	1066.5760	1066.5771	R	C	321	331
PSM	LQQTTQLIK	2303	sp|Q9NUQ3-2|TXLNG_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8721.6	98.07471	2	1071.6272	1071.6288	K	E	176	185
PSM	RLIPDGCGVK	2304	sp|P27635|RL10_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	7-UNIMOD:4	ms_run[1]:scan=1.1.8502.4	92.24236	3	1113.5980	1113.5965	K	Y	189	199
PSM	STVEGIQASVK	2305	sp|P18206|VINC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8830.11	101.0192	2	1117.5970	1117.5979	K	T	656	667
PSM	GTVRPANDFNPDADAK	2306	sp|P08133-2|ANXA6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8561.9	93.82253	3	1686.7753	1686.7962	K	A	323	339
PSM	ELLASAPTGSGK	2307	sp|Q9Y2R4|DDX52_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8543.9	93.33753	2	1129.5962	1129.5979	R	T	204	216
PSM	LQAAVDGPMDK	2308	sp|P51572-2|BAP31_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8684.10	97.08663	2	1143.5582	1143.5594	K	K	300	311
PSM	IVGPSGAAVPCK	2309	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	11-UNIMOD:4	ms_run[1]:scan=1.1.8580.10	94.32055	2	1154.6106	1154.6118	K	V	1008	1020
PSM	VVGDVAYDEAK	2310	sp|P11586|C1TC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8617.8	95.28255	2	1164.5644	1164.5663	K	E	252	263
PSM	TGDVEDSTVLK	2311	sp|Q9UNN5|FAF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8607.11	95.01933	2	1162.5696	1162.5718	K	S	147	158
PSM	SSENPNEVFR	2312	sp|P45974-2|UBP5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8815.8	100.6126	2	1177.5378	1177.5363	R	F	453	463
PSM	VESLDVDSEAK	2313	sp|P49321|NASP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8625.9	95.49903	2	1190.5648	1190.5666	K	K	34	45
PSM	TVFAEHISDECKR	2314	sp|P39023|RL3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	11-UNIMOD:4	ms_run[1]:scan=1.1.8816.2	100.6298	4	1590.7461	1590.7460	K	R	104	117
PSM	ELGVSTNANYK	2315	sp|Q8WVY7|UBCP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8673.11	96.791	2	1194.5868	1194.5880	K	I	196	207
PSM	EISPGSGPGEIR	2316	sp|O43491-4|E41L2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8669.8	96.67876	2	1197.5956	1197.5990	K	K	643	655
PSM	VNWATTPSSQK	2317	sp|Q01085-2|TIAR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8722.11	98.11007	2	1217.6014	1217.6040	K	K	97	108
PSM	FVTSNTQELGK	2318	sp|Q9BXP5-2|SRRT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8598.11	94.78312	2	1222.6188	1222.6194	K	D	700	711
PSM	DGQVINETSQHHDDLE	2319	sp|P08670|VIME_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8817.7	100.665	3	1835.7898	1835.7922	R	-	451	467
PSM	TTANAIYCPPK	2320	sp|O00231-2|PSD11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	8-UNIMOD:4	ms_run[1]:scan=1.1.8788.11	99.89028	2	1234.6018	1234.6016	R	L	195	206
PSM	TTANAIYCPPK	2321	sp|O00231-2|PSD11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	8-UNIMOD:4	ms_run[1]:scan=1.1.8729.10	98.29715	2	1234.5884	1234.6016	R	L	195	206
PSM	TNQELQEINR	2322	sp|P07355-2|ANXA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8510.10	92.4646	2	1243.6134	1243.6156	R	V	154	164
PSM	VELVTGEEDEK	2323	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8655.11	96.30882	2	1246.5928	1246.5929	K	V	2023	2034
PSM	VCALLSCTSHK	2324	sp|P15121|ALDR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	2-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=1.1.8610.11	95.09965	2	1274.6090	1274.6111	R	D	298	309
PSM	ASHEEVEGLVEK	2325	sp|Q08380|LG3BP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8692.10	97.30233	2	1325.6472	1325.6463	R	I	334	346
PSM	IYIDSNNNPER	2326	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8608.10	95.04446	2	1333.6234	1333.6262	K	F	882	893
PSM	EAGDVCYADVQK	2327	sp|Q13242|SRSF9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	6-UNIMOD:4	ms_run[1]:scan=1.1.8678.9	96.9229	2	1353.5852	1353.5871	R	D	133	145
PSM	GHQQLYWSHPR	2328	sp|P62273-2|RS29_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8810.7	100.476	3	1407.6808	1407.6796	M	K	2	13
PSM	SIRPDNMSEYSK	2329	sp|Q13547|HDAC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8489.11	91.91402	2	1425.6548	1425.6558	R	Q	78	90
PSM	GEDEEENNLEVR	2330	sp|P04843|RPN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8504.11	92.30705	2	1431.6084	1431.6113	K	E	90	102
PSM	ETYGEMADCCAK	2331	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	9-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.8805.11	100.3475	2	1433.5232	1433.5261	R	Q	106	118
PSM	TKQDEVNAAWQR	2332	sp|Q13813|SPTN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8597.6	94.74908	3	1444.7089	1444.7059	K	L	228	240
PSM	DTPGHGSGWAETPR	2333	sp|O75533|SF3B1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8507.11	92.38678	2	1466.6532	1466.6539	R	T	302	316
PSM	AGALQCSPSDAYTK	2334	sp|Q9Y490|TLN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	6-UNIMOD:4	ms_run[1]:scan=1.1.8720.11	98.05592	2	1467.6630	1467.6664	K	K	1934	1948
PSM	VYAVATSTNTPCAR	2335	sp|Q10570|CPSF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	12-UNIMOD:4	ms_run[1]:scan=1.1.8648.11	96.12105	2	1509.7212	1509.7246	K	I	1033	1047
PSM	NREEFEDQSLEK	2336	sp|Q12830-2|BPTF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8660.11	96.44273	2	1522.6898	1522.6899	K	D	593	605
PSM	LYPTSCHTACTLR	2337	sp|Q08431-2|MFGM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	6-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.8660.9	96.4394	3	1578.7285	1578.7283	R	F	95	108
PSM	ATTDPNECLICHR	2338	sp|Q9UJQ4|SALL4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	8-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=1.1.8803.11	100.2937	2	1585.6972	1585.6977	K	V	561	574
PSM	QIVGTPVNSEDSDTR	2339	sp|Q5QJE6|TDIF2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8620.11	95.36816	2	1616.7632	1616.7642	K	Q	228	243
PSM	YEDFKEEGSENAVK	2340	sp|Q9NTK5|OLA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8618.10	95.3127	2	1643.7272	1643.7315	K	A	350	364
PSM	LVAGEMGQNEPDQGGQR	2341	sp|Q99714-2|HCD2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8513.9	92.5422	3	1784.8102	1784.8112	R	G	131	148
PSM	IGQQPQQPGAPPQQDYTK	2342	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8753.11	98.94663	3	1979.9662	1979.9701	K	A	629	647
PSM	QESENSCNKEEEPVFTR	2343	sp|Q9Y520-4|PRC2C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	7-UNIMOD:4	ms_run[1]:scan=1.1.8661.10	96.46751	3	2081.8915	2081.8960	K	Q	614	631
PSM	ESEAVEWQQK	2344	sp|P26038|MOES_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8832.11	101.0712	2	1232.5654	1232.5673	K	A	439	449
PSM	KVTLGDTLTR	2345	sp|Q9UKV3-5|ACINU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8922.2	103.3918	3	1102.6342	1102.6346	K	R	957	967
PSM	DLHDANTDLIGRHPK	2346	sp|P53985|MOT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8866.5	101.954	4	1700.8625	1700.8594	K	Q	225	240
PSM	ILSHLQQDSLK	2347	sp|Q9NY93-2|DDX56_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9152.5	109.4731	3	1280.7106	1280.7088	R	L	145	156
PSM	KANAEELANNLK	2348	sp|Q86XP3|DDX42_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8839.3	101.2409	3	1313.6953	1313.6939	K	Q	508	520
PSM	RFASGGCDNLIK	2349	sp|P55735-2|SEC13_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	7-UNIMOD:4	ms_run[1]:scan=1.1.8933.3	103.6839	3	1336.6576	1336.6558	K	L	167	179
PSM	ERIEIEQNYAK	2350	sp|Q5T0N5-2|FBP1L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9186.5	110.3844	3	1391.7010	1391.7044	K	Q	34	45
PSM	IAVAHNGELVNAAR	2351	sp|Q06203|PUR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8843.5	101.3484	3	1433.7730	1433.7739	K	L	117	131
PSM	QADNPHVALYQAR	2352	sp|Q9Y4L1|HYOU1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8897.10	102.7616	3	1481.7376	1481.7375	K	F	107	120
PSM	RQQEQQVPILEK	2353	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9158.7	109.6376	3	1494.8143	1494.8154	R	F	1105	1117
PSM	GTGIVSAPVPK	2354	sp|P15880|RS2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9082.8	107.659	2	1024.5908	1024.5917	R	K	201	212
PSM	FQETSDEFEAARK	2355	sp|Q14683|SMC1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9164.6	109.7973	3	1556.7040	1556.7107	K	R	1038	1051
PSM	AVDDGVNTFK	2356	sp|P50990-2|TCPQ_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8936.9	103.7736	2	1064.5134	1064.5139	R	V	372	382
PSM	AVDDGVNTFK	2357	sp|P50990-2|TCPQ_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8955.8	104.2801	2	1064.5134	1064.5139	R	V	372	382
PSM	SLAPSIHGHDYVK	2358	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8840.2	101.2654	4	1422.7277	1422.7256	K	K	302	315
PSM	RANENSNIQVLSER	2359	sp|Q6UN15-5|FIP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9037.7	106.4604	3	1628.8198	1628.8230	R	S	316	330
PSM	FALACNASDK	2360	sp|P35250-2|RFC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	5-UNIMOD:4	ms_run[1]:scan=1.1.8869.9	102.0392	2	1095.5062	1095.5019	R	I	133	143
PSM	AAAQQLGEVVK	2361	sp|O14981|BTAF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9095.9	107.9982	2	1112.6106	1112.6190	K	L	24	35
PSM	KPGDLSDELR	2362	sp|Q13435|SF3B2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8971.2	104.6996	3	1128.5824	1128.5775	K	I	605	615
PSM	VTADVINAAEK	2363	sp|O43175|SERA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9111.9	108.4105	2	1129.5954	1129.5979	K	L	59	70
PSM	VLTVINQTQK	2364	sp|P42766|RL35_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8846.10	101.4348	2	1142.6642	1142.6659	R	E	57	67
PSM	VLTVINQTQK	2365	sp|P42766|RL35_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8837.11	101.2017	2	1142.6642	1142.6659	R	E	57	67
PSM	VLTVINQTQK	2366	sp|P42766|RL35_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8838.8	101.223	2	1142.6642	1142.6659	R	E	57	67
PSM	VLTVINQTQK	2367	sp|P42766|RL35_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8849.8	101.5087	2	1142.6642	1142.6659	R	E	57	67
PSM	VLTVINQTQK	2368	sp|P42766|RL35_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8842.9	101.3291	2	1142.6642	1142.6659	R	E	57	67
PSM	VLTVINQTQK	2369	sp|P42766|RL35_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8852.9	101.5882	2	1142.6642	1142.6659	R	E	57	67
PSM	VLTVINQTQK	2370	sp|P42766|RL35_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8851.8	101.5607	2	1142.6642	1142.6659	R	E	57	67
PSM	DMVGIAQTGSGK	2371	sp|Q92841-3|DDX17_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9140.8	109.1583	2	1162.5622	1162.5652	R	T	131	143
PSM	TFGETHPFTK	2372	sp|P09960|LKHA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8882.7	102.3717	2	1163.5566	1163.5611	K	L	356	366
PSM	GEFVTTVQQR	2373	sp|P40925-3|MDHC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8990.7	105.2076	2	1163.5910	1163.5935	K	G	239	249
PSM	MIAAVDTDSPR	2374	sp|Q07812-2|BAX_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8833.10	101.0955	2	1174.5632	1174.5652	R	E	79	90
PSM	VAFCGAPEEGR	2375	sp|Q8IZ83|A16A1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	4-UNIMOD:4	ms_run[1]:scan=1.1.8938.10	103.8287	2	1191.5344	1191.5343	K	A	246	257
PSM	LISETTSVCKPEQVAK	2376	sp|Q06136|KDSR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	9-UNIMOD:4	ms_run[1]:scan=1.1.8917.8	103.2724	3	1788.9229	1788.9291	R	Q	237	253
PSM	TCSEAIQQLR	2377	sp|Q9P2W9|STX18_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	2-UNIMOD:4	ms_run[1]:scan=1.1.8895.6	102.7121	2	1204.5828	1204.5870	R	T	106	116
PSM	ITHCPTLLTR	2378	sp|A6NHR9|SMHD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	4-UNIMOD:4	ms_run[1]:scan=1.1.8838.3	101.2147	3	1210.6396	1210.6492	K	D	1853	1863
PSM	IEAGYIQTGDR	2379	sp|Q9Y450|HBS1L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9182.8	110.2839	2	1221.5938	1221.5990	K	L	509	520
PSM	HPGSFDVVHVK	2380	sp|P62701|RS4X_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9002.2	105.5173	3	1220.6317	1220.6302	R	D	201	212
PSM	SYELQESNVR	2381	sp|Q9NVA2-2|SEP11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8892.4	102.6353	2	1223.5776	1223.5782	R	L	94	104
PSM	EQVANSAFVER	2382	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9059.6	107.0467	3	1248.6130	1248.6098	K	V	492	503
PSM	VLRDNIQGITK	2383	sp|P62805|H4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9090.2	107.8576	3	1255.7257	1255.7248	K	P	22	33
PSM	VGIPVTDENGNR	2384	sp|Q9H9B4|SFXN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8907.11	103.0195	2	1269.6286	1269.6313	K	L	203	215
PSM	NFGSYVTHETK	2385	sp|P63167|DYL1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8970.10	104.6861	2	1281.5958	1281.5990	R	H	61	72
PSM	TEGYEAGLAPQR	2386	sp|O75312|ZPR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8958.9	104.3622	2	1290.6150	1290.6204	K	-	448	460
PSM	NGETELCMEGR	2387	sp|O95433|AHSA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	7-UNIMOD:4	ms_run[1]:scan=1.1.8930.9	103.6144	2	1294.5266	1294.5282	K	G	295	306
PSM	MQVDQEEPHVEEQQQQTPAENK	2388	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9100.9	108.1269	4	2621.1597	2621.1664	K	A	522	544
PSM	SQLNSQSVEITK	2389	sp|O60763-2|USO1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8860.11	101.8045	2	1332.6854	1332.6885	K	L	810	822
PSM	DVQNFPAATDEK	2390	sp|O60610|DIAP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9150.11	109.4292	2	1333.6134	1333.6150	R	D	1072	1084
PSM	LCTSVTESEVAR	2391	sp|O75439|MPPB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	2-UNIMOD:4	ms_run[1]:scan=1.1.9124.11	108.7511	2	1350.6410	1350.6449	R	A	388	400
PSM	LLATEQEDAAVAK	2392	sp|Q9P2E9|RRBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8990.10	105.2126	2	1357.7072	1357.7089	K	S	708	721
PSM	RVETALESCGLK	2393	sp|Q01970-2|PLCB3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	9-UNIMOD:4	ms_run[1]:scan=1.1.9056.5	106.9648	3	1361.6992	1361.6973	K	F	118	130
PSM	VACAEEWQESR	2394	sp|O75663|TIPRL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	3-UNIMOD:4	ms_run[1]:scan=1.1.9069.11	107.321	2	1363.5742	1363.5826	K	T	85	96
PSM	SPEVLSGGEDGAVR	2395	sp|Q86W42-3|THOC6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9162.10	109.75	2	1371.6600	1371.6630	R	L	180	194
PSM	LAAVTYNGVDNNK	2396	sp|Q16181-2|SEPT7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9138.11	109.1114	2	1377.6848	1377.6888	K	N	313	326
PSM	GVEAVGSYAENQR	2397	sp|Q12996|CSTF3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9181.11	110.2624	2	1378.6438	1378.6477	K	I	152	165
PSM	YQSFNNQSDLEK	2398	sp|P49642|PRI1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9149.11	109.4025	2	1471.6520	1471.6579	R	E	57	69
PSM	LHYCVSCAIHSK	2399	sp|Q5JNZ5|RS26L_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	4-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=1.1.8847.7	101.4555	3	1473.688271	1473.685690	K	V	71	83
PSM	EVQSALSTAAADDSK	2400	sp|Q9Y232|CDYL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8999.10	105.4511	2	1491.7024	1491.7053	R	L	374	389
PSM	SSFYPDGGDQETAK	2401	sp|Q9NYF8-2|BCLF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9146.11	109.3218	2	1500.6336	1500.6369	R	T	317	331
PSM	EATSSTSNFSSLSSK	2402	sp|Q9P2D1|CHD7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9139.11	109.1373	2	1531.6976	1531.7002	R	F	2450	2465
PSM	DINAYNCEEPTEK	2403	sp|P30041|PRDX6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	7-UNIMOD:4	ms_run[1]:scan=1.1.9019.9	105.9821	3	1581.6604	1581.6617	K	L	85	98
PSM	SSSTALTTNVTEQTEK	2404	sp|Q8WYP5-2|ELYS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9020.11	106.0124	2	1695.8110	1695.8163	K	D	1377	1393
PSM	KPNVGCQQDSEELLK	2405	sp|A0AVT1|UBA6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	6-UNIMOD:4	ms_run[1]:scan=1.1.9079.8	107.5794	3	1743.8515	1743.8461	R	L	342	357
PSM	GFDTSSSSSNSAASSSFK	2406	sp|P49790-3|NU153_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9035.9	106.4102	3	1752.7411	1752.7439	K	F	918	936
PSM	QEQQEGPVGPAPSRPALQEK	2407	sp|Q8TDD1-2|DDX54_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8922.11	103.4068	3	2145.0799	2145.0814	R	Q	612	632
PSM	MQVDQEEPHVEEQQQQTPAENK	2408	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9102.11	108.1817	3	2621.1583	2621.1664	K	A	522	544
PSM	LVLVGDGGTGK	2409	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9397.4	115.9788	3	1014.5725	1014.5710	K	T	13	24
PSM	SVDPDSPAEASGLR	2410	sp|O14745|NHRF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9297.10	113.3286	2	1399.6554	1399.6579	R	A	181	195
PSM	HEILLSQSVR	2411	sp|P54886-2|P5CS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9196.2	110.6432	3	1180.6588	1180.6564	R	Q	129	139
PSM	FQEHIIQAPK	2412	sp|Q9UHD1-2|CHRD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9483.3	118.2821	3	1209.6517	1209.6506	K	P	73	83
PSM	HTLSYVDVGTGK	2413	sp|P31040-2|SDHA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9418.3	116.5363	3	1275.6475	1275.6459	K	V	577	589
PSM	LNQLKPGLQYK	2414	sp|Q12906-7|ILF3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9298.4	113.3455	3	1300.7518	1300.7503	R	L	409	420
PSM	TSLMNQYVNKK	2415	sp|P51149|RAB7A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9321.4	113.9607	3	1324.6831	1324.6809	K	F	22	33
PSM	MKQDAQVVLYR	2416	sp|P78527|PRKDC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9382.4	115.5741	3	1349.7100	1349.7125	K	S	2763	2774
PSM	DVACGANHTLVLDSQKR	2417	sp|Q9P258|RCC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	4-UNIMOD:4	ms_run[1]:scan=1.1.9203.6	110.8344	4	1882.9301	1882.9319	R	V	334	351
PSM	RVGGVQSLGGTGALR	2418	sp|P17174-2|AATC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9395.5	115.9265	3	1426.8010	1426.8005	K	I	79	94
PSM	SGVSLAALKK	2419	sp|P16402|H13_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9207.2	110.9332	3	972.5992	972.5968	R	A	56	66
PSM	SYCAEIAHNVSSK	2420	sp|P62910|RL32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	3-UNIMOD:4	ms_run[1]:scan=1.1.9230.7	111.5555	3	1464.6628	1464.6667	K	N	94	107
PSM	QASVADYEETVKK	2421	sp|P49419-2|AL7A1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9202.6	110.808	3	1466.7238	1466.7253	R	A	54	67
PSM	TPAEQLLSK	2422	sp|O75400-2|PR40A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9511.7	119.0407	2	985.5436	985.5444	K	C	149	158
PSM	FEHCNFNDVTTR	2423	sp|P13987|CD59_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	4-UNIMOD:4	ms_run[1]:scan=1.1.9490.7	118.4768	3	1538.6569	1538.6572	K	L	67	79
PSM	AIAHYEQSADYYK	2424	sp|P54920|SNAA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9419.7	116.5691	3	1557.7069	1557.7099	K	G	141	154
PSM	VHTECCHGDLLECADDR	2425	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	5-UNIMOD:4,6-UNIMOD:4,13-UNIMOD:4	ms_run[1]:scan=1.1.9362.7	115.0424	4	2085.8273	2085.8303	K	A	265	282
PSM	ALTSELANAR	2426	sp|P26038|MOES_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9440.9	117.1324	2	1044.5534	1044.5563	K	D	524	534
PSM	VHTECCHGDLLECADDR	2427	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	5-UNIMOD:4,6-UNIMOD:4,13-UNIMOD:4	ms_run[1]:scan=1.1.9322.11	113.9984	4	2085.8273	2085.8303	K	A	265	282
PSM	IHCTQTLLEGDGPK	2428	sp|P29762|RABP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	3-UNIMOD:4	ms_run[1]:scan=1.1.9285.6	112.9996	3	1567.7647	1567.7664	K	T	94	108
PSM	VFQGCGPPKPLPAGR	2429	sp|O75487|GPC4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	5-UNIMOD:4	ms_run[1]:scan=1.1.9350.7	114.7249	3	1579.8277	1579.8293	K	I	337	352
PSM	IEDVTPIPSDSTRR	2430	sp|P62263|RS14_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9481.8	118.2366	3	1584.8119	1584.8107	R	K	129	143
PSM	EAALGAGFSDK	2431	sp|P55084-2|ECHB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9441.9	117.1594	2	1064.5124	1064.5138	R	T	96	107
PSM	LVIVGDGACGK	2432	sp|P08134|RHOC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	9-UNIMOD:4	ms_run[1]:scan=1.1.9312.9	113.7309	2	1087.5686	1087.5696	K	T	8	19
PSM	VTAQGPGLEPSGNIANK	2433	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9426.7	116.7532	3	1651.8529	1651.8529	K	T	384	401
PSM	TLFANTGGTVK	2434	sp|Q9UKA9-2|PTBP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9523.9	119.3667	2	1107.5882	1107.5924	R	A	473	484
PSM	VDCANGIGALK	2435	sp|O95394-3|AGM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	3-UNIMOD:4	ms_run[1]:scan=1.1.9308.10	113.625	2	1116.5580	1116.5597	K	L	210	221
PSM	EAALAEVADEK	2436	sp|Q15003|CND2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9477.10	118.1325	2	1144.5558	1144.5611	K	M	675	686
PSM	GGGFGGNDNFGR	2437	sp|P09651-2|ROA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9358.10	114.9408	2	1153.4884	1153.4901	R	G	207	219
PSM	VLVDQTTGLSR	2438	sp|Q15717-2|ELAV1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9504.9	118.856	2	1187.6490	1187.6510	R	G	164	175
PSM	EAAENSLVAYK	2439	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9475.3	118.067	3	1193.5927	1193.5928	K	A	143	154
PSM	ALSTDPAAPNLK	2440	sp|Q9Y490|TLN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9370.10	115.2616	2	1196.6390	1196.6401	K	S	1321	1333
PSM	AAGPLLTDECR	2441	sp|Q9BQ69|MACD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	10-UNIMOD:4	ms_run[1]:scan=1.1.9328.11	114.1552	2	1201.5768	1201.5761	R	T	190	201
PSM	QDEVNAAWQR	2442	sp|Q13813|SPTN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9401.8	116.0933	2	1215.5642	1215.5632	K	L	230	240
PSM	HIYYITGETK	2443	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1000663, ProteinPilot, ]	24		ms_run[1]:scan=1.1.9284.9	112.9783	2	1223.6140470956602	1223.61863832087	K	D	490	500
PSM	DQVANSAFVER	2444	sp|P07900-2|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9344.10	114.5734	2	1234.5920	1234.5942	K	L	622	633
PSM	LTPLSHEVISR	2445	sp|P41091|IF2G_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9527.10	119.476	2	1250.6954	1250.6983	K	Q	28	39
PSM	ELVDDSVNNVR	2446	sp|P22061-2|PIMT_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9434.10	116.9724	2	1258.6082	1258.6153	K	K	114	125
PSM	NSVVEASEAAYK	2447	sp|Q04917|1433F_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9423.8	116.6756	2	1266.6028	1266.6092	K	E	144	156
PSM	TTQFSCTLGEK	2448	sp|Q01469|FABP5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	6-UNIMOD:4	ms_run[1]:scan=1.1.9446.11	117.2977	2	1270.5832	1270.5864	K	F	62	73
PSM	TSDVGGYYYEK	2449	sp|P46821|MAP1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9486.8	118.371	2	1280.5532	1280.5561	R	I	1898	1909
PSM	EFTESQLQEGK	2450	sp|Q01995|TAGL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9232.11	111.6159	2	1294.6002	1294.6041	R	H	162	173
PSM	VCDEPHPLLVK	2451	sp|P35250-2|RFC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	2-UNIMOD:4	ms_run[1]:scan=1.1.9297.4	113.3186	3	1305.6745	1305.6751	K	E	220	231
PSM	VCDEPHPLLVK	2452	sp|P35250-2|RFC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	2-UNIMOD:4	ms_run[1]:scan=1.1.9305.5	113.5359	3	1305.6748	1305.6751	K	E	220	231
PSM	VCDEPHPLLVK	2453	sp|P35250-2|RFC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	2-UNIMOD:4	ms_run[1]:scan=1.1.9303.6	113.4836	3	1305.6748	1305.6751	K	E	220	231
PSM	VCDEPHPLLVK	2454	sp|P35250-2|RFC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	2-UNIMOD:4	ms_run[1]:scan=1.1.9306.3	113.5595	3	1305.6748	1305.6751	K	E	220	231
PSM	NCGGDAIQEDLK	2455	sp|Q5VZK9-2|CARL1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	2-UNIMOD:4	ms_run[1]:scan=1.1.9356.11	114.8894	2	1318.5778	1318.5823	R	S	707	719
PSM	VGELKDDDFER	2456	sp|P36507|MP2K2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9353.4	114.7989	3	1321.6210	1321.6150	K	I	64	75
PSM	GLSEDTTEETLK	2457	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9201.10	110.7883	2	1321.6202	1321.6249	K	E	578	590
PSM	IIYGGSVTGATCK	2458	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	12-UNIMOD:4	ms_run[1]:scan=1.1.9449.10	117.3772	2	1325.6636	1325.6649	R	E	244	257
PSM	DAQELYAAGENR	2459	sp|P50995-2|ANX11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9466.11	117.8376	2	1335.6012	1335.6055	R	L	327	339
PSM	ASTSDYQVISDR	2460	sp|Q8NFH5-2|NUP35_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9436.11	117.0279	2	1340.6202	1340.6208	K	Q	278	290
PSM	SVQTTLQTDEVK	2461	sp|O94905|ERLN2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9318.10	113.8921	2	1347.6858	1347.6882	R	N	61	73
PSM	EDEVEEWQHR	2462	sp|P15311|EZRI_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9487.10	118.4012	2	1355.5718	1355.5742	K	A	439	449
PSM	GAVHQLCQSLAGK	2463	sp|P09417-2|DHPR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	7-UNIMOD:4	ms_run[1]:scan=1.1.9265.9	112.4805	2	1367.6942	1367.6980	K	N	124	137
PSM	VETYLNENLRK	2464	sp|Q9UQE7|SMC3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9482.4	118.257	3	1377.7249	1377.7252	R	R	828	839
PSM	VASSPVMVSNPATR	2465	sp|P51610-2|HCFC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9473.10	118.0246	2	1414.7232	1414.7238	K	M	526	540
PSM	DQDLEPGAPSMGAK	2466	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9496.11	118.645	2	1414.6376	1414.6398	R	S	1464	1478
PSM	HYTFASGSPDNIK	2467	sp|O43660-2|PLRG1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9403.5	116.1421	3	1435.6744	1435.6732	R	Q	375	388
PSM	QQPNPGNELCYK	2468	sp|Q14166|TTL12_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	10-UNIMOD:4	ms_run[1]:scan=1.1.9314.10	113.7863	2	1446.6534	1446.6561	K	V	89	101
PSM	KGPSGYGFNLHSDK	2469	sp|O14745|NHRF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9267.11	112.536	2	1505.7192	1505.7263	K	S	159	173
PSM	YEQGTGCWQGPNR	2470	sp|P14314-2|GLU2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	7-UNIMOD:4	ms_run[1]:scan=1.1.9194.10	110.6036	2	1551.6476	1551.6525	K	S	462	475
PSM	LSDGEINAQESTYK	2471	sp|Q2KHR3|QSER1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9437.10	117.0532	2	1553.7174	1553.7209	R	V	585	599
PSM	YSNSALGHVNCTIK	2472	sp|Q9NQC3-4|RTN4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	11-UNIMOD:4	ms_run[1]:scan=1.1.9350.6	114.7232	3	1562.7517	1562.7511	K	E	859	873
PSM	NTASQNSILEEGETK	2473	sp|Q15398-3|DLGP5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9369.11	115.2364	2	1619.7662	1619.7638	K	I	771	786
PSM	LRENVFQEHQTLK	2474	sp|Q14247|SRC8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9394.8	115.9044	3	1640.8582	1640.8634	K	E	58	71
PSM	HGFEAASIKEER	2475	sp|P35580-3|MYH10_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7972.8	78.35588	3	1372.6729	1372.6735	R	G	43	55
PSM	HQAFEAELSANQSR	2476	sp|Q13813|SPTN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9461.11	117.7029	2	1586.7386	1586.7437	K	I	614	628
PSM	KVEELQACVETAR	2477	sp|Q14980-2|NUMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	8-UNIMOD:4	ms_run[1]:scan=1.1.9230.8	111.5572	3	1531.7629	1531.7664	R	Q	651	664
PSM	VAVTEGCQPSR	2478	sp|O75369-2|FLNB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	7-UNIMOD:4	ms_run[1]:scan=1.1.7185.7	57.58533	3	1202.5753	1202.5714	K	V	1320	1331
PSM	RQQEQQVPILEK	2479	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9234.10	111.6678	3	1494.8101	1494.8154	R	F	1105	1117
PSM	RQQEQQVPILEK	2480	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9196.8	110.6532	3	1494.8101	1494.8154	R	F	1105	1117
PSM	RQQEQQVPILEK	2481	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9215.8	111.1547	3	1494.8101	1494.8154	R	F	1105	1117
PSM	NSEPAGLETPEAK	2482	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8462.11	91.19518	2	1341.6356	1341.6412	R	V	890	903
PSM	KGSSLEIVSACR	2483	sp|Q5T7N2|LITD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	11-UNIMOD:4	ms_run[1]:scan=1.1.8927.10	103.5364	2	1305.6702	1305.6711	K	V	734	746
PSM	PRHQEGEIFDTEK	2484	sp|Q02878|RL6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8111.8	82.01295	3	1584.7507	1584.7532	K	E	225	238
PSM	ADGATSDDLDLHDDR	2485	sp|Q07157-2|ZO1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8928.9	103.5613	3	1614.6718	1614.6758	K	L	805	820
PSM	NPELPNAAQAQK	2486	sp|O60264|SMCA5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8370.6	88.74506	3	1279.6519	1279.6520	R	E	803	815
PSM	RPLEDGDQPDAK	2487	sp|Q96AE4-2|FUBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7019.8	53.07138	3	1339.6411	1339.6368	K	K	65	77
PSM	ELAQIAGRPTEDEDEK	2488	sp|O15355|PPM1G_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8778.5	99.61134	4	1799.8505	1799.8537	K	E	113	129
PSM	KTDAVYDPAEYDK	2489	sp|Q9UDR5|AASS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9494.7	118.5845	3	1513.6918	1513.6936	R	H	274	287
PSM	HKSETDTSLIR	2490	sp|P40227-2|TCPZ_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7332.5	61.41765	2	1285.6634	1285.6626	K	G	153	164
PSM	LVEVNGENVEK	2491	sp|O14745|NHRF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8583.11	94.39912	2	1228.6276	1228.6299	R	E	59	70
PSM	SHSAPSEVGFSDAR	2492	sp|Q86V48|LUZP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8333.8	87.76534	3	1445.6521	1445.6535	K	H	903	917
PSM	VVDSMEDEVQR	2493	sp|Q9Y285|SYFA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8927.10	103.5364	2	1305.5834	1305.5871	R	R	128	139
PSM	RTSSAQVEGGVHSLHSYEK	2494	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8480.10	91.67722	4	2071.0077	2071.0083	K	R	493	512
PSM	TTHFVEGGDAGNREDQINR	2495	sp|P18124|RL7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8335.8	87.81876	4	2114.9681	2114.9730	K	L	224	243
PSM	LLQHGINADDK	2496	sp|Q96P70|IPO9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7562.5	67.58563	3	1222.6339	1222.6306	K	R	866	877
PSM	SIDSNPYDTDK	2497	sp|P46459-2|NSF_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8252.8	85.62254	2	1253.5428	1253.5412	K	M	12	23
PSM	ETANAIVSQQTPQR	2498	sp|P40938-2|RFC3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8591.8	94.60387	2	1541.7758	1541.7798	R	L	257	271
PSM	SGGNEVSIEER	2499	sp|Q15061|WDR43_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7847.9	75.07865	2	1175.5410	1175.5418	K	L	431	442
PSM	SLQEQADAAEER	2500	sp|P09493-5|TPM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8349.11	88.19199	2	1345.6092	1345.6109	R	A	16	28
PSM	LLACIASRPGQCGR	2501	sp|P62241|RS8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	4-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.9400.7	116.0648	3	1557.7852	1557.7868	K	A	171	185
PSM	GDVTAEEAAGASPAK	2502	sp|P49006|MRP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7769.8	73.06018	3	1372.6510	1372.6470	R	A	11	26
PSM	RYVAAAFPSACGK	2503	sp|Q16822-2|PCKGM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	11-UNIMOD:4	ms_run[1]:scan=1.1.9475.8	118.0753	3	1396.6942	1396.6921	K	T	296	309
PSM	NADGLIVASR	2504	sp|Q9UJA5|TRM6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9132.6	108.9487	2	1014.5432	1014.5458	R	F	368	378
PSM	DCHLAQVPSHTVVAR	2505	sp|P02787|TRFE_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	2-UNIMOD:4	ms_run[1]:scan=1.1.9086.5	107.7589	4	1688.8421	1688.8417	K	S	259	274
PSM	TGVHHYSGNNIELGTACGK	2506	sp|P62888|RL30_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	17-UNIMOD:4	ms_run[1]:scan=1.1.8652.7	96.2217	4	2013.9301	2013.9327	K	Y	69	88
PSM	VYRIEGDETSTEAATR	2507	sp|P52434-3|RPAB3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8820.9	100.7492	3	1796.8522	1796.8540	K	L	60	76
PSM	KLVEALCAAGHR	2508	sp|P23919-2|KTHY_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	7-UNIMOD:4	ms_run[1]:scan=1.1.8642.4	95.94777	3	1323.7108	1323.7081	R	A	25	37
PSM	RSIADSEESEAYK	2509	sp|Q9BY42|RTF2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7943.6	77.58	3	1483.6855	1483.6790	K	S	267	280
PSM	GHTDSVQDISFDHSGK	2510	sp|P43034|LIS1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9301.2	113.4231	4	1728.7741	1728.7704	K	L	148	164
PSM	KPHIYYGSLEEK	2511	sp|O43172-2|PRP4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9031.8	106.3018	3	1462.7455	1462.7456	K	E	26	38
PSM	KLGGSQEDQIK	2512	sp|P37837|TALDO_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7117.11	55.73512	2	1201.6340	1201.6302	R	N	71	82
PSM	SQGGEPTYNVAVGR	2513	sp|P35080|PROF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9360.11	114.9958	2	1433.6852	1433.6899	K	A	92	106
PSM	GVQVETISPGDGR	2514	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9324.7	114.044	3	1313.6611	1313.6576	M	T	2	15
PSM	QAGEVTFADAHRPK	2515	sp|Q13243-3|SRSF5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8282.10	86.40912	3	1525.7620	1525.7637	R	L	127	141
PSM	VAVAGCCHGELDK	2516	sp|Q9UK59|DBR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	6-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=1.1.7530.6	66.72636	3	1414.6387	1414.6333	R	I	3	16
PSM	EGIESGDPGTDDGR	2517	sp|Q12797-10|ASPH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7546.11	67.16472	2	1403.5846	1403.5801	K	F	484	498
PSM	PAPPATPGAPTSPAEHR	2518	sp|Q96GE9-2|DMAC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.7944.11	77.61436	3	1652.8273	1652.8271	K	L	26	43
PSM	IQEVADELQK	2519	sp|P18085|ARF4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.9274.10	112.7171	2	1171.6052	1171.6084	R	M	100	110
PSM	SAGEEEDGPVLTDEQK	2520	sp|Q66PJ3-2|AR6P4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.8751.11	98.8926	2	1702.7484	1702.7533	R	S	324	340
PSM	EDQTEYLEER	2521	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.9433.11	116.9471	2	1311.561647	1310.562640	K	R	166	176
PSM	HIYYITGETK	2522	sp|Q58FG0|HS905_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.9264.9	112.4545	2	1224.621047	1223.618639	K	D	175	185
PSM	VNGDASPAAAESGAK	2523	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.7142.11	56.41822	2	1344.617847	1343.631723	K	E	41	56
PSM	IIEDCSNSEETVK	2524	sp|Q93008|USP9X_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	5-UNIMOD:4	ms_run[1]:scan=1.1.7796.11	73.76168	2	1523.676847	1522.682104	K	L	2289	2302
PSM	RDPHLACVAYER	2525	sp|Q00610|CLH1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	7-UNIMOD:4	ms_run[1]:scan=1.1.8599.3	94.79573	4	1486.726894	1485.714681	K	G	912	924
PSM	TPTQTNGSNVPFKPR	2526	sp|P78347|GTF2I_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.9081.9	107.6342	3	1643.821871	1642.842718	R	G	703	718
PSM	VEIIANDQGNR	2527	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.8264.9	85.92973	2	1228.621647	1227.620764	R	I	50	61
PSM	MESYHKPDQQK	2528	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:1	ms_run[1]:scan=1.1.7529.10	66.70602	2	1431.6461	1431.6447	-	L	1	12
PSM	FHHTFSTEIAK	2529	sp|P13667|PDIA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.8574.7	94.1618	3	1317.641471	1316.651336	K	F	336	347
PSM	ERHPGSFDVVHVK	2530	sp|P62701|RS4X_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.8678.10	96.92457	2	1506.775247	1505.773911	R	D	199	212
PSM	QEYVDYSESAKK	2531	sp|O60832|DKC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:28	ms_run[1]:scan=1.1.9493.11	118.5642	2	1428.6418	1428.6404	K	E	414	426
PSM	RMEELHNQEVQK	2532	sp|Q15233|NONO_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.7189.5	57.69078	4	1541.755294	1539.746375	R	R	325	337
PSM	QLDECASAITK	2533	sp|Q9NTJ3|SMC4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	5-UNIMOD:4	ms_run[1]:scan=1.1.8710.11	97.78915	2	1235.588847	1234.586353	K	A	912	923
PSM	GGGGGQDNGLEGLGNDSR	2534	sp|P08621|RU17_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.9506.11	118.9131	2	1659.704847	1658.724454	R	D	394	412
PSM	STTTGHLIYK	2535	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.7726.10	71.98237	2	1120.594047	1119.592424	K	C	21	31
PSM	TAVCDIPPR	2536	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	4-UNIMOD:4	ms_run[1]:scan=1.1.8621.8	95.39003	2	1026.528447	1027.512065	K	G	351	360
PSM	TAVCDIPPR	2537	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	4-UNIMOD:4	ms_run[1]:scan=1.1.8350.7	88.21177	2	1028.519447	1027.512065	K	G	351	360
PSM	ATETVELHK	2538	sp|P82979|SARNP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:1	ms_run[1]:scan=1.1.8642.11	95.95943	2	1068.5423	1068.5446	M	L	2	11
PSM	HYAHTDCPGHADYVK	2539	sp|P49411|EFTU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	7-UNIMOD:4	ms_run[1]:scan=1.1.7474.8	65.23873	4	1770.764094	1769.758003	R	N	121	136
PSM	AATAAADFTAK	2540	sp|Q9Y3F4|STRAP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.8078.10	81.15307	2	1037.518247	1036.518925	K	V	74	85
PSM	SQKQEEENPAEETGEEK	2541	sp|O43768|ENSA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:1	ms_run[1]:scan=1.1.7563.11	67.62254	2	2003.8572	2002.8602	M	Q	2	19
PSM	EGNPEEDLTADK	2542	sp|P40121|CAPG_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.8817.9	100.6684	2	1317.571047	1316.573205	K	A	232	244
PSM	SGGTPYIGSK	2543	sp|Q8ND56|LS14A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:1	ms_run[1]:scan=1.1.9036.8	106.4352	2	1008.5032	1007.4922	M	I	2	12
PSM	VDCDQHSDIAQR	2544	sp|Q9BS26|ERP44_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	3-UNIMOD:4	ms_run[1]:scan=1.1.6996.11	52.50697	2	1443.624647	1442.620841	R	Y	90	102
PSM	QKPITPETAEK	2545	sp|P60953|CDC42_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:28	ms_run[1]:scan=1.1.7704.11	71.39805	2	1223.6391	1223.6392	K	L	134	145
PSM	STSVPQGHTWTQR	2546	sp|Q9NYJ1|COA4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:1	ms_run[1]:scan=1.1.9524.11	119.3969	2	1525.7217	1525.7268	M	V	2	15
PSM	VQEAVESMVK	2547	sp|Q96C01|F136A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.9226.8	111.4498	2	1119.565247	1118.564160	R	S	9	19
PSM	AENPSLENHR	2548	sp|O00505|IMA4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:1	ms_run[1]:scan=1.1.7605.10	68.75362	2	1208.5632	1207.5572	M	I	2	12
PSM	PVAVALDTK	2549	sp|P14618|KPYM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.8662.8	96.49077	2	912.528247	912.528033	R	G	107	116
PSM	DQTPDENDQVIVK	2550	sp|Q9NZI8|IF2B1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.8901.11	102.8658	2	1498.678447	1499.710367	R	I	526	539
PSM	HLTHAQSTLDAK	2551	sp|Q15125|EBP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.6914.7	50.30223	3	1320.6802	1320.6786	K	A	210	222
PSM	HGRPGIGATHSSR	2552	sp|P62841|RS15_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.6723.5	45.15247	3	1331.6821	1331.6807	K	F	128	141
PSM	AGAHLQGGAK	2553	sp|P04406|G3P_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.6626.2	42.61278	3	908.4877	908.4828	K	R	108	118
PSM	RPLEDGDQPDAKK	2554	sp|Q96AE4-2|FUBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.6831.8	48.08397	3	1467.7357	1467.7317	K	V	65	78
PSM	IDASKNEEDEGHSNSSPR	2555	sp|Q14103-3|HNRPD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.6728.9	45.28876	4	1970.8605	1970.8566	K	H	68	86
PSM	RSEVVESTTESQDK	2556	sp|Q5UIP0|RIF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.6939.8	50.98955	3	1593.7543	1593.7482	R	E	1421	1435
PSM	TATPQQAQEVHEK	2557	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.6916.8	50.35868	3	1465.7200	1465.7161	K	L	213	226
PSM	APQHTAVGFK	2558	sp|O43242|PSMD3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7346.4	61.77577	3	1054.5589	1054.5560	K	Q	316	326
PSM	IIRPSETAGR	2559	sp|P19388|RPAB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7178.3	57.38782	3	1098.6190	1098.6145	K	Y	193	203
PSM	IIRPSETAGR	2560	sp|P19388|RPAB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7183.2	57.5228	3	1098.6190	1098.6145	K	Y	193	203
PSM	IIRPSETAGR	2561	sp|P19388|RPAB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7182.3	57.4972	3	1098.6190	1098.6145	K	Y	193	203
PSM	RVETSEHFR	2562	sp|P42167|LAP2B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7066.8	54.35653	3	1159.5796	1159.5734	K	I	261	270
PSM	LGIHEDSQNR	2563	sp|P07900-2|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7181.4	57.47147	3	1167.5656	1167.5632	K	K	569	579
PSM	IAGHPLAQNER	2564	sp|Q9UMY4-2|SNX12_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7062.5	54.24157	3	1204.6372	1204.6312	K	C	130	141
PSM	RGFSDSGGGPPAK	2565	sp|Q9H307|PININ_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7119.4	55.77825	3	1231.5988	1231.5946	R	Q	63	76
PSM	KPYCNAHYPK	2566	sp|Q14847-2|LASP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	4-UNIMOD:4	ms_run[1]:scan=1.1.7062.6	54.24323	3	1276.6066	1276.6022	K	Q	50	60
PSM	GATYGKPVHHGVNQLK	2567	sp|P61313|RL15_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7177.5	57.3639	4	1704.9085	1704.9060	K	F	78	94
PSM	HTNPIVENGQTHPCQK	2568	sp|Q9Y5L0-1|TNPO3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	14-UNIMOD:4	ms_run[1]:scan=1.1.7110.8	55.5387	4	1858.8793	1858.8744	R	V	655	671
PSM	HSLDASQGTATGPR	2569	sp|O00330|ODPX_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7068.4	54.40452	3	1396.6726	1396.6695	K	G	195	209
PSM	EDSQRPGAHLTVK	2570	sp|P09651-2|ROA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7258.5	59.50785	3	1436.7397	1436.7372	R	K	93	106
PSM	PNMVTPGHACTQK	2571	sp|P04075-2|ALDOA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	10-UNIMOD:4	ms_run[1]:scan=1.1.7245.9	59.17595	3	1439.6671	1439.6650	K	F	285	298
PSM	TDKDTEITCSER	2572	sp|P16422|EPCAM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	9-UNIMOD:4	ms_run[1]:scan=1.1.7120.9	55.81395	3	1453.6399	1453.6355	R	V	127	139
PSM	LKDELASTK	2573	sp|P51572-2|BAP31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7185.10	57.59033	2	1003.5556	1003.5549	K	Q	258	267
PSM	LKDELASTK	2574	sp|P51572-2|BAP31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7187.7	57.63972	2	1003.5556	1003.5549	K	Q	258	267
PSM	LKDELASTK	2575	sp|P51572-2|BAP31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7186.10	57.61755	2	1003.5556	1003.5549	K	Q	258	267
PSM	KYHNVGLSK	2576	sp|Q14103-3|HNRPD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.6968.6	51.76488	3	1044.5764	1044.5716	K	C	243	252
PSM	SEHPPLCGR	2577	sp|Q15393|SF3B3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	7-UNIMOD:4	ms_run[1]:scan=1.1.7114.2	55.63835	3	1051.4908	1051.4869	R	D	1150	1159
PSM	SEHPPLCGR	2578	sp|Q15393|SF3B3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	7-UNIMOD:4	ms_run[1]:scan=1.1.7111.4	55.55952	3	1051.4908	1051.4869	R	D	1150	1159
PSM	LEGSSGGIGER	2579	sp|Q9Y5B6|PAXB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7341.10	61.65032	2	1060.5156	1060.5149	R	Y	430	441
PSM	LDELRDEGK	2580	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7320.9	61.10417	2	1073.5370	1073.5353	K	A	206	215
PSM	SAHAGTYEVR	2581	sp|P51571|SSRD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7108.4	55.47742	3	1089.5263	1089.5203	K	F	96	106
PSM	ALTQTGGPHVK	2582	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7095.3	55.1239	3	1107.6082	1107.6037	R	A	1284	1295
PSM	IHEATGMPAGK	2583	sp|Q15459|SF3A1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7119.11	55.78992	2	1110.5506	1110.5492	K	Q	744	755
PSM	GSGTAEVELKK	2584	sp|P14618-2|KPYM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7202.11	58.05568	2	1117.5986	1117.5979	K	G	126	137
PSM	SLHSATTIGNK	2585	sp|P51610-2|HCFC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7089.4	54.96825	3	1127.5969	1127.5935	R	M	256	267
PSM	VQESADELQK	2586	sp|P84085|ARF5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7328.9	61.31265	2	1145.5588	1145.5564	R	M	100	110
PSM	VQVVDEEGDQQHQEGK	2587	sp|Q02447-2|SP3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7355.10	62.02883	3	1823.8303	1823.8286	R	R	566	582
PSM	IVQAEGEAEAAK	2588	sp|Q99623|PHB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7338.10	61.57052	2	1214.6156	1214.6142	K	M	225	237
PSM	KLEQCNTELK	2589	sp|Q9UQE7|SMC3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	5-UNIMOD:4	ms_run[1]:scan=1.1.7195.11	57.86433	2	1261.6312	1261.6336	R	K	968	978
PSM	PAPPQTEQVESK	2590	sp|Q15061|WDR43_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7246.11	59.20503	2	1309.6516	1309.6514	K	R	417	429
PSM	EAMEDGEIDGNK	2591	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	3-UNIMOD:35	ms_run[1]:scan=1.1.7060.11	54.19647	2	1322.5300	1322.5296	K	V	628	640
PSM	CTESEEEEVTK	2592	sp|P54578-2|UBP14_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	1-UNIMOD:4	ms_run[1]:scan=1.1.7188.11	57.67362	2	1339.5488	1339.5449	K	G	222	233
PSM	VGGTSDVEVNEKK	2593	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7054.10	54.03057	2	1360.6858	1360.6834	K	D	406	419
PSM	PGPTPSGTNVGSSGR	2594	sp|P60468|SC61B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7222.10	58.58858	2	1369.6594	1369.6586	M	S	2	17
PSM	DDREAQSICER	2595	sp|P63010-2|AP2B1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	9-UNIMOD:4	ms_run[1]:scan=1.1.7310.11	60.8461	2	1377.5966	1377.5943	K	V	233	244
PSM	PAFGQQHQQQPK	2596	sp|P49750|YLPM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7037.11	53.56702	2	1392.6930	1392.6898	K	S	842	854
PSM	EPGCGCCSVCAR	2597	sp|P18065|IBP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	4-UNIMOD:4,6-UNIMOD:4,7-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.7260.10	59.56813	2	1411.5122	1411.5101	R	L	81	93
PSM	SCCSCCPVGCAK	2598	sp|Q8N339|MT1M_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	2-UNIMOD:4,3-UNIMOD:4,5-UNIMOD:4,6-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.7091.11	55.03227	2	1444.5040	1444.5026	K	C	32	44
PSM	SQSAAVTPSSTTSSTR	2599	sp|Q16186|ADRM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7036.11	53.53963	2	1566.7496	1566.7486	R	A	211	227
PSM	VAHSDKPGSTSTASFR	2600	sp|Q9P0L0|VAPA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7181.11	57.48314	2	1646.8032	1646.8013	K	D	206	222
PSM	NQTAEKEEFEHQQK	2601	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7105.5	55.39713	4	1744.8097	1744.8016	K	E	584	598
PSM	VNNASYCPHCGEESSK	2602	sp|Q9H9B1|EHMT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	7-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.7182.10	57.50887	3	1837.7407	1837.7359	R	A	621	637
PSM	SGKPAELLK	2603	sp|P29401-2|TKT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7540.2	66.98869	3	941.5594	941.5545	R	M	603	612
PSM	GAGTDDHTLIR	2604	sp|P08758|ANXA5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7645.2	69.81577	3	1154.5738	1154.5680	K	V	261	272
PSM	VFTTVGSAEKR	2605	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7666.5	70.38392	3	1193.6425	1193.6404	R	A	1695	1706
PSM	EGPDLDRPGSDR	2606	sp|Q7Z4V5-2|HDGR2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7579.7	68.04729	3	1312.6048	1312.6008	R	Q	642	654
PSM	KGDECELLGHSK	2607	sp|P49411|EFTU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	5-UNIMOD:4	ms_run[1]:scan=1.1.7640.7	69.68948	3	1371.6469	1371.6452	K	N	286	298
PSM	EQCCYNCGKPGHLAR	2608	sp|P62633-2|CNBP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	3-UNIMOD:4,4-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=1.1.7388.8	62.91042	4	1848.7873	1848.7818	R	D	88	103
PSM	ALLQSSASR	2609	sp|Q9UQ80|PA2G4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7536.7	66.8895	2	931.5108	931.5087	K	K	356	365
PSM	YHDEADQSALQR	2610	sp|Q12789-3|TF3C1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7486.9	65.56405	3	1431.6433	1431.6378	R	M	1246	1258
PSM	PGSDTIKPNVDDSK	2611	sp|P32119|PRDX2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7391.9	62.99325	3	1471.7173	1471.7155	K	E	178	192
PSM	ATEGMVVADK	2612	sp|Q99436|PSB7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7622.6	69.20251	2	1019.4938	1019.4957	R	N	63	73
PSM	LVEPGSPAEK	2613	sp|O14745|NHRF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7464.6	64.96404	2	1025.5406	1025.5393	R	A	41	51
PSM	VSGGPSLEQR	2614	sp|Q9Y262|EIF3L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7583.8	68.15698	2	1028.5240	1028.5251	K	F	144	154
PSM	VSGTLDTPEK	2615	sp|Q9BYG3|MK67I_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7414.9	63.61514	2	1045.5300	1045.5292	K	T	217	227
PSM	ITGNPVVTNR	2616	sp|Q9HCE1|MOV10_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7657.10	70.1529	2	1069.5912	1069.5880	R	I	261	271
PSM	IANPVEGSSGR	2617	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7705.8	71.41978	2	1085.5466	1085.5465	K	Q	315	326
PSM	IVAVTGAEAQK	2618	sp|P49588|SYAC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7644.10	69.80219	2	1085.6088	1085.6081	R	A	752	763
PSM	SPAAECLSEK	2619	sp|Q12931|TRAP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	6-UNIMOD:4	ms_run[1]:scan=1.1.7421.11	63.80842	2	1090.4970	1090.4964	R	E	568	578
PSM	QQQEELEAEHGTGDKPAAPR	2620	sp|Q13895|BYST_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7653.10	70.0448	4	2190.0329	2190.0301	R	E	64	84
PSM	ADGGTQVIDTK	2621	sp|P09622|DLDH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7376.9	62.5881	2	1103.5472	1103.5459	K	N	167	178
PSM	TPVSITEHPK	2622	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7480.11	65.40617	2	1107.5940	1107.5924	K	I	1688	1698
PSM	SPPGQVTEAVK	2623	sp|P15121|ALDR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7661.9	70.2589	2	1111.5880	1111.5873	K	V	23	34
PSM	ELNEDKLEK	2624	sp|O00567|NOP56_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7396.9	63.12867	2	1116.5670	1116.5662	R	L	222	231
PSM	VRVELSNGEK	2625	sp|P84103|SRSF3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7488.11	65.61975	2	1129.6092	1129.6091	R	R	76	86
PSM	NKYEDEINK	2626	sp|P05787-2|K2C8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7532.4	66.7767	3	1151.5492	1151.5458	R	R	205	214
PSM	VIQHNALEDR	2627	sp|O60313-13|OPA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7414.10	63.6168	2	1193.6170	1193.6153	R	S	688	698
PSM	YLAEVASGEKK	2628	sp|Q04917|1433F_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7614.10	68.99343	2	1193.6290	1193.6292	R	N	133	144
PSM	ILGTAGTEEGQK	2629	sp|Q08257|QOR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7500.11	65.93507	2	1202.6154	1202.6143	K	I	176	188
PSM	QKLEEDAEMK	2630	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7436.11	64.21418	2	1219.5760	1219.5754	K	S	215	225
PSM	FATCSDDGTVR	2631	sp|Q9C0J8|WDR33_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	4-UNIMOD:4	ms_run[1]:scan=1.1.7603.11	68.70235	2	1227.5196	1227.5190	K	I	217	228
PSM	YSTSGSSGLTTGK	2632	sp|Q16891-2|MIC60_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7478.11	65.35197	2	1244.5898	1244.5885	R	I	33	46
PSM	TYGEPESAGPSR	2633	sp|P50402|EMD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7442.11	64.37679	2	1249.5588	1249.5575	R	A	104	116
PSM	TYGEPESAGPSR	2634	sp|P50402|EMD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7423.11	63.86272	2	1249.5588	1249.5575	R	A	104	116
PSM	MIGQATAADQEK	2635	sp|Q13015|AF1Q_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7515.10	66.33068	2	1261.6000	1261.5972	K	N	48	60
PSM	YNAQCQETIR	2636	sp|P21741|MK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	5-UNIMOD:4	ms_run[1]:scan=1.1.7622.11	69.21085	2	1281.5776	1281.5772	R	V	112	122
PSM	ESQTQDNITVR	2637	sp|Q92900-2|RENT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7630.11	69.42664	2	1289.6208	1289.6212	K	W	322	333
PSM	GGGEQETQELASK	2638	sp|Q96QR8|PURB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7465.11	64.9993	2	1332.6216	1332.6157	R	R	25	38
PSM	ETMVTSTTEPSR	2639	sp|P14314-2|GLU2B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7655.11	70.10052	2	1337.6148	1337.6133	K	C	485	497
PSM	SSPELEDTATSSK	2640	sp|P46013|KI67_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7609.11	68.86105	2	1350.6172	1350.6151	K	R	2827	2840
PSM	EDGSGDRGDGPFR	2641	sp|P13010|XRCC5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7666.7	70.38725	3	1363.5784	1363.5753	K	L	172	185
PSM	ELTNQQEASVER	2642	sp|Q14203-6|DCTN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7625.11	69.29185	2	1402.6698	1402.6688	R	Q	526	538
PSM	NSSQSEEDDIER	2643	sp|Q12983|BNIP3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7364.11	62.27172	2	1407.5886	1407.5750	K	R	156	168
PSM	IFSGSSHQDLSQK	2644	sp|P60891|PRPS1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7690.11	71.02288	2	1432.6958	1432.6947	K	I	6	19
PSM	LAEEESCREDVTR	2645	sp|Q92896|GSLG1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	7-UNIMOD:4	ms_run[1]:scan=1.1.7435.10	64.1854	3	1592.7139	1592.7100	K	V	112	125
PSM	GCPVNTEPSGPTCEK	2646	sp|P53701|CCHL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	2-UNIMOD:4,13-UNIMOD:4	ms_run[1]:scan=1.1.7523.10	66.54483	2	1631.6938	1631.6920	K	K	34	49
PSM	ETYVEQEQGENANDRNDR	2647	sp|Q9Y2L1|RRP44_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7661.11	70.26221	3	2165.9209	2165.9209	R	A	130	148
PSM	ALTHIDHSLSR	2648	sp|P56192|SYMC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7824.2	74.48027	4	1248.6609	1248.6575	R	Q	120	131
PSM	IAVAAQNCYK	2649	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	8-UNIMOD:4	ms_run[1]:scan=1.1.7999.3	79.04148	3	1136.5675	1136.5648	K	V	97	107
PSM	STESLQANVQR	2650	sp|P26373|RL13_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7825.5	74.51753	3	1231.6186	1231.6157	K	L	106	117
PSM	IAPAEGPDVSER	2651	sp|Q9Y6M1-1|IF2B2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8067.4	80.85114	3	1239.6100	1239.6095	K	M	420	432
PSM	QEPERNECFLQHK	2652	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	8-UNIMOD:4	ms_run[1]:scan=1.1.8066.6	80.82813	4	1713.7909	1713.7893	K	D	118	131
PSM	ERLEQEQLER	2653	sp|Q8N8S7|ENAH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7923.7	77.06017	3	1328.6710	1328.6684	R	E	184	194
PSM	KPVEELTEEEK	2654	sp|Q9Y2R9|RT07_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7719.7	71.79138	3	1329.6673	1329.6663	R	Y	53	64
PSM	SRAEAALEEESR	2655	sp|Q969G3-2|SMCE1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7725.6	71.94971	3	1346.6452	1346.6426	K	Q	147	159
PSM	SAEEVEEIKAEK	2656	sp|Q8WUA2|PPIL4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8020.7	79.59413	3	1360.6771	1360.6721	R	E	204	216
PSM	RPAEDTDRETVAGIPNK	2657	sp|Q68CP9-3|ARID2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8052.4	80.44939	4	1867.9413	1867.9388	K	V	1517	1534
PSM	SHVYSLEGQDCK	2658	sp|Q9NXE4-4|NSMA3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	11-UNIMOD:4	ms_run[1]:scan=1.1.7978.9	78.51397	3	1421.6248	1421.6245	K	Y	615	627
PSM	AGFAGDDAPR	2659	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7817.8	74.30766	2	975.4552	975.4410	K	A	19	29
PSM	FSEGTSADREIQR	2660	sp|P62333|PRS10_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7957.7	77.95303	3	1494.7057	1494.7063	R	T	243	256
PSM	AEAGPEGVAPAPEGEK	2661	sp|Q9Y4L1|HYOU1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8068.11	80.88927	3	1507.7179	1507.7154	K	K	670	686
PSM	IHPVSTMVK	2662	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7728.2	72.0205	3	1010.5627	1010.5583	R	G	271	280
PSM	TAVCDIPPR	2663	sp|Q9BVA1|TBB2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	4-UNIMOD:4	ms_run[1]:scan=1.1.8056.9	80.5654	2	1027.5126	1027.5121	K	G	351	360
PSM	TAVCDIPPR	2664	sp|Q9BVA1|TBB2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	4-UNIMOD:4	ms_run[1]:scan=1.1.7996.4	78.9665	2	1027.5118	1027.5121	K	G	351	360
PSM	TAVCDIPPR	2665	sp|Q9BVA1|TBB2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	4-UNIMOD:4	ms_run[1]:scan=1.1.7952.10	77.82349	2	1027.5120	1027.5121	K	G	351	360
PSM	TAVCDIPPR	2666	sp|Q9BVA1|TBB2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	4-UNIMOD:4	ms_run[1]:scan=1.1.8075.9	81.07143	2	1027.5132	1027.5121	K	G	351	360
PSM	TAVCDIPPR	2667	sp|Q9BVA1|TBB2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	4-UNIMOD:4	ms_run[1]:scan=1.1.8037.8	80.05161	2	1027.5166	1027.5121	K	G	351	360
PSM	KNIILEEGK	2668	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8071.8	80.96367	2	1042.6030	1042.6022	K	E	45	54
PSM	ALEEAMEQK	2669	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8020.10	79.59914	2	1047.4930	1047.4906	R	A	1484	1493
PSM	IAPPETPDSK	2670	sp|Q9NZI8|IF2B1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7749.8	72.54884	2	1053.5338	1053.5342	K	V	441	451
PSM	IAPPETPDSK	2671	sp|Q9NZI8|IF2B1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7728.8	72.0305	2	1053.5356	1053.5342	K	V	441	451
PSM	EGELTVAQGR	2672	sp|Q03252|LMNB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7931.8	77.2715	2	1058.5364	1058.5356	R	V	139	149
PSM	DPSQQELPR	2673	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7885.10	76.08038	2	1068.5218	1068.5200	R	L	1172	1181
PSM	DPSQQELPR	2674	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7905.9	76.59333	2	1068.5218	1068.5200	R	L	1172	1181
PSM	LQAANAEDIK	2675	sp|Q02818|NUCB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7865.11	75.55054	2	1071.5560	1071.5560	K	S	72	82
PSM	QQVVLENAAK	2676	sp|Q01780|EXOSX_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7946.9	77.6629	2	1098.5880	1098.6033	R	K	769	779
PSM	MGAGLGHGMDR	2677	sp|P52272-2|HNRPM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7829.4	74.6229	2	1100.4898	1100.4855	R	V	380	391
PSM	VVQSLEQTAR	2678	sp|Q15631|TSN_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7812.10	74.17744	2	1129.6090	1129.6091	K	E	27	37
PSM	IAVAAQNCYK	2679	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	8-UNIMOD:4	ms_run[1]:scan=1.1.7997.7	78.99709	2	1136.5644	1136.5648	K	V	97	107
PSM	GGPTPQEAIQR	2680	sp|Q9H444|CHM4B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8024.11	79.7079	2	1152.5876	1152.5887	K	L	18	29
PSM	IANPVEGSTDR	2681	sp|Q15366-2|PCBP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7996.9	78.97483	2	1157.5672	1157.5677	K	Q	324	335
PSM	LQEELSENDK	2682	sp|O95347|SMC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7759.9	72.80862	2	1203.5650	1203.5619	K	K	263	273
PSM	AEETEQMIEK	2683	sp|Q9HCJ6|VAT1L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7943.8	77.58334	2	1206.5454	1206.5438	K	E	9	19
PSM	KYDEELEER	2684	sp|Q01995|TAGL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7802.9	73.91319	2	1209.5512	1209.5513	K	L	21	30
PSM	HVGDLGNVTADK	2685	sp|P00441|SODC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8084.6	81.30703	3	1224.6124	1224.6099	R	D	81	93
PSM	AAMDNSEIAGEK	2686	sp|Q16891-2|MIC60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7744.11	72.42615	2	1234.5478	1234.5499	K	K	247	259
PSM	IIEDQQESLNK	2687	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7942.11	77.56226	2	1315.6614	1315.6619	K	W	318	329
PSM	EAQELSQNSAIK	2688	sp|Q9NR30|DDX21_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7886.10	76.10623	2	1316.6572	1316.6572	K	Q	450	462
PSM	EVLDEDTDEEK	2689	sp|Q9Y3P9|RBGP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7802.10	73.91485	2	1320.5558	1320.5569	K	E	990	1001
PSM	TIQVDNTDAEGR	2690	sp|P28838-2|AMPL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7783.8	73.4239	2	1317.6164	1317.6161	K	L	326	338
PSM	ILQEDPTNTAAR	2691	sp|Q15006|EMC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8034.11	79.97633	2	1327.6738	1327.6732	R	K	113	125
PSM	ANEGTVGVSAATER	2692	sp|P05186|PPBT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7901.11	76.49397	2	1360.6600	1360.6583	K	S	123	137
PSM	AQEEAERLEADR	2693	sp|P15311|EZRI_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7844.8	75.00017	3	1415.6644	1415.6640	R	M	382	394
PSM	ETGYVVERPSTTK	2694	sp|Q9NYF8-2|BCLF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7946.6	77.6579	3	1465.7458	1465.7413	K	D	461	474
PSM	ETGYVVERPSTTK	2695	sp|Q9NYF8-2|BCLF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7926.11	77.14603	2	1465.7460	1465.7413	K	D	461	474
PSM	AEAGPEGVAPAPEGEK	2696	sp|Q9Y4L1|HYOU1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8053.11	80.48795	2	1507.7170	1507.7154	K	K	670	686
PSM	LASAAYPDPSK	2697	sp|P54577|SYYC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8217.7	84.73373	2	1118.5636	1118.5608	K	Q	336	347
PSM	EDITHSAQHALR	2698	sp|Q96SI9-2|STRBP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8272.2	86.12877	4	1376.6829	1376.6797	K	L	290	302
PSM	THEDIEAQIR	2699	sp|O75533|SF3B1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8363.3	88.55235	3	1210.5946	1210.5942	K	E	7	17
PSM	THEDIEAQIR	2700	sp|O75533|SF3B1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8382.5	89.06523	3	1210.5946	1210.5942	K	E	7	17
PSM	RTSSAQVEGGVHSLHSYEK	2701	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8472.4	91.45325	5	2071.0141	2071.0083	K	R	493	512
PSM	VRQQAADLISR	2702	sp|O75533|SF3B1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8180.5	83.7824	3	1255.7005	1255.6997	K	T	947	958
PSM	IREQNLQDIK	2703	sp|P35611-2|ADDA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8299.6	86.8557	3	1255.6882	1255.6884	K	T	506	516
PSM	INISEGNCPER	2704	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	8-UNIMOD:4	ms_run[1]:scan=1.1.8367.4	88.66132	3	1287.5896	1287.5877	R	I	47	58
PSM	GYDDRDYYSR	2705	sp|P62995-3|TRA2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8440.6	90.59595	3	1308.5368	1308.5371	R	S	129	139
PSM	LRPESALAQAQK	2706	sp|O94826|TOM70_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8317.5	87.33414	3	1310.7298	1310.7306	R	C	430	442
PSM	RLAPEYEAAATR	2707	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8341.7	87.97377	3	1346.6944	1346.6942	K	L	62	74
PSM	QAHLTNQYMQR	2708	sp|P11940-2|PABP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8121.5	82.26624	3	1388.6617	1388.6619	R	M	375	386
PSM	HRDFVAEPMGEK	2709	sp|O75531|BAF_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8358.6	88.42357	3	1414.6612	1414.6663	K	P	7	19
PSM	FGAVEGAVAK	2710	sp|Q9H7Z7|PGES2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8357.7	88.39847	2	947.5046	947.5076	K	Y	270	280
PSM	EYGEQIDPSTHR	2711	sp|Q9Y2B0|CNPY2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8163.9	83.34395	3	1430.6437	1430.6426	K	K	91	103
PSM	AEDAVEAIR	2712	sp|Q9BWF3|RBM4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8443.6	90.67645	2	972.4860	972.4876	R	G	121	130
PSM	EHDPVGQMVNNPK	2713	sp|P55060-3|XPO2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8316.4	87.30573	3	1463.6800	1463.6827	K	I	913	926
PSM	IDVGEAEPR	2714	sp|P54577|SYYC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8373.6	88.82553	2	984.4874	984.4876	K	T	392	401
PSM	HLPSTEPDPHVVR	2715	sp|Q9BUJ2-2|HNRL1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8262.7	85.8748	3	1482.7579	1482.7579	K	I	271	284
PSM	VASEAPLEHKPQVEASSPR	2716	sp|Q8TD19|NEK9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8266.7	85.97822	4	2031.0381	2031.0385	K	L	853	872
PSM	TAVCDIPPR	2717	sp|Q9BVA1|TBB2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	4-UNIMOD:4	ms_run[1]:scan=1.1.8466.8	91.29813	2	1027.5128	1027.5121	K	G	351	360
PSM	TAVCDIPPR	2718	sp|Q9BVA1|TBB2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	4-UNIMOD:4	ms_run[1]:scan=1.1.8428.9	90.27866	2	1027.5112	1027.5121	K	G	351	360
PSM	TAVCDIPPR	2719	sp|Q9BVA1|TBB2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	4-UNIMOD:4	ms_run[1]:scan=1.1.8447.10	90.79066	2	1027.5122	1027.5121	K	G	351	360
PSM	TAVCDIPPR	2720	sp|Q9BVA1|TBB2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	4-UNIMOD:4	ms_run[1]:scan=1.1.8312.9	87.20802	2	1027.5110	1027.5121	K	G	351	360
PSM	TAVCDIPPR	2721	sp|Q9BVA1|TBB2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	4-UNIMOD:4	ms_run[1]:scan=1.1.8293.8	86.70023	2	1027.5118	1027.5121	K	G	351	360
PSM	TAVCDIPPR	2722	sp|Q9BVA1|TBB2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	4-UNIMOD:4	ms_run[1]:scan=1.1.8234.4	85.16243	2	1027.5128	1027.5121	K	G	351	360
PSM	TAVCDIPPR	2723	sp|Q9BVA1|TBB2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	4-UNIMOD:4	ms_run[1]:scan=1.1.8154.8	83.11066	2	1027.5130	1027.5121	K	G	351	360
PSM	EKDIQEESTFSSR	2724	sp|P42704|LPPRC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8311.6	87.17657	3	1554.7303	1554.7162	K	K	65	78
PSM	LDPAASVTGSK	2725	sp|P46013|KI67_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8340.8	87.94945	2	1044.5428	1044.5451	K	R	1442	1453
PSM	VVLIGGKPDR	2726	sp|P61978-2|HNRPK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8119.2	82.21025	3	1052.6377	1052.6342	R	V	192	202
PSM	QADVNLVNAK	2727	sp|O43175|SERA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8341.10	87.97877	2	1070.5724	1070.5720	K	L	385	395
PSM	IMATPEQVGK	2728	sp|P12956-2|XRCC6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8278.6	86.29562	2	1072.5580	1072.5587	K	M	411	421
PSM	TPASPVVHIR	2729	sp|P14866|HNRPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8337.8	87.87228	2	1075.6130	1075.6138	K	G	98	108
PSM	LGESLQSAER	2730	sp|O95235|KI20A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8316.7	87.31073	2	1088.5472	1088.5462	K	A	751	761
PSM	VLEAVSANPGR	2731	sp|Q9NXH9-2|TRM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8354.9	88.32173	2	1111.5980	1111.5986	R	F	382	393
PSM	AFEEDQVAGR	2732	sp|O43818|U3IP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8295.8	86.75343	2	1120.5142	1120.5149	R	L	102	112
PSM	LGSLVENNER	2733	sp|B5ME19|EIFCL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8264.6	85.92474	2	1129.5818	1129.5727	K	V	864	874
PSM	GASFVTSTNPR	2734	sp|P49916-3|DNLI3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8274.10	86.1954	2	1135.5444	1135.5622	K	K	127	138
PSM	KWPQQVVQK	2735	sp|P52926|HMGA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8333.4	87.75867	3	1139.6485	1139.6451	R	K	82	91
PSM	ILDYSCSQDRDTQK	2736	sp|Q93008-1|USP9X_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	6-UNIMOD:4	ms_run[1]:scan=1.1.8287.11	86.54445	3	1727.7778	1727.7785	K	I	535	549
PSM	VLIAAHGNSLR	2737	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8397.10	89.47165	2	1149.6600	1149.6618	R	G	181	192
PSM	AGGPTTPLSPTR	2738	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8283.9	86.43425	2	1153.6086	1153.6091	R	L	15	27
PSM	IEEELGDEAR	2739	sp|P09104-2|ENOG_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8439.9	90.57402	2	1159.5332	1159.5357	R	F	370	380
PSM	HWDHLTQVK	2740	sp|P30084|ECHM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8284.3	86.45087	3	1162.5913	1162.5883	K	K	119	128
PSM	YIDNQVVSTK	2741	sp|Q9H467|CUED2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8264.8	85.92807	2	1165.5940	1165.5979	R	G	247	257
PSM	TIEESEETLK	2742	sp|O95347|SMC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8426.9	90.22518	2	1177.5656	1177.5714	K	N	751	761
PSM	FDDGDVTECK	2743	sp|Q93008-1|USP9X_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	9-UNIMOD:4	ms_run[1]:scan=1.1.8278.10	86.30228	2	1184.4652	1184.4656	K	M	1900	1910
PSM	IKEENFVSPK	2744	sp|O00425|IF2B3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8355.8	88.3468	2	1189.6316	1189.6343	K	E	474	484
PSM	LTDQVMQNPR	2745	sp|Q99733-2|NP1L4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8376.9	88.91123	2	1200.5898	1200.5921	K	V	27	37
PSM	ELQSQIQEAR	2746	sp|Q9P2X0-2|DPM3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8212.7	84.60632	2	1200.6094	1200.6098	R	A	103	113
PSM	EGALCEENMR	2747	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	5-UNIMOD:4	ms_run[1]:scan=1.1.8220.7	84.81353	2	1207.4974	1207.4961	K	G	689	699
PSM	HSLNSSSASTTEPDFQK	2748	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8401.10	89.57549	3	1834.8310	1834.8333	K	D	1021	1038
PSM	RQQDPSPGSNLGGGDDLK	2749	sp|Q13951-2|PEBB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8463.11	91.22225	3	1839.8689	1839.8711	R	L	168	186
PSM	SNVSDAVAQSTR	2750	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8144.8	82.85412	2	1233.5952	1233.5949	K	I	232	244
PSM	ENSGAAEKPVTIHATPEGTSEACR	2751	sp|Q9Y6M1-1|IF2B2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	23-UNIMOD:4	ms_run[1]:scan=1.1.8336.10	87.84897	4	2511.1625	2511.1660	K	M	233	257
PSM	AQDIQCGLQSR	2752	sp|Q8WVJ2|NUDC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	6-UNIMOD:4	ms_run[1]:scan=1.1.8209.10	84.53305	2	1274.6032	1274.6037	R	H	40	51
PSM	TIIQNPTDQQK	2753	sp|Q9UQ80|PA2G4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8300.10	86.88935	2	1284.6656	1284.6674	K	K	200	211
PSM	INISEGNCPER	2754	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	8-UNIMOD:4	ms_run[1]:scan=1.1.8338.11	87.90285	2	1287.5854	1287.5877	R	I	47	58
PSM	EATTVDCNDLR	2755	sp|Q6UXK5|LRRN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	7-UNIMOD:4	ms_run[1]:scan=1.1.8269.10	86.06215	2	1292.5670	1292.5667	R	L	52	63
PSM	NNNQQLAQLQK	2756	sp|Q9Y2A7-2|NCKP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8169.11	83.50191	2	1297.6766	1297.6738	R	E	77	88
PSM	NCNDFQYESK	2757	sp|Q04917|1433F_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	2-UNIMOD:4	ms_run[1]:scan=1.1.8328.10	87.63577	2	1303.5118	1303.5139	K	V	111	121
PSM	GYDDRDYYSR	2758	sp|P62995-3|TRA2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8421.7	90.08807	3	1308.5368	1308.5371	R	S	129	139
PSM	NIQVSHQEFSK	2759	sp|Q8WUM4-2|PDC6I_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8183.11	83.87009	2	1315.6476	1315.6521	K	M	633	644
PSM	QTEDYCLASNK	2760	sp|O43278-2|SPIT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	6-UNIMOD:4	ms_run[1]:scan=1.1.8165.10	83.39743	2	1327.5720	1327.5714	K	V	245	256
PSM	TENCLSSCVDR	2761	sp|Q9Y5J9|TIM8B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	4-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.8198.8	84.2528	2	1339.5498	1339.5497	R	F	52	63
PSM	EAPPMEKPEVVK	2762	sp|P62841|RS15_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8325.11	87.55762	2	1352.6982	1352.7010	K	T	66	78
PSM	IRVDVADQAQDK	2763	sp|P23588-2|IF4B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8331.11	87.71706	2	1356.7026	1356.6997	R	D	127	139
PSM	ALQQEQEIEQR	2764	sp|Q86YP4-2|P66A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8270.10	86.08881	2	1370.6742	1370.6790	K	L	465	476
PSM	EMEAELEDERK	2765	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8384.10	89.1269	2	1377.6040	1377.6082	R	Q	1593	1604
PSM	TGQAPGYSYTAANK	2766	sp|P99999|CYC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8113.9	82.06897	2	1427.6698	1427.6681	K	N	41	55
PSM	DGNPDNETYLHR	2767	sp|Q9UMR2-4|DD19B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8260.11	85.83027	2	1429.6244	1429.6222	K	I	389	401
PSM	YICENQDSISSK	2768	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	3-UNIMOD:4	ms_run[1]:scan=1.1.8100.4	81.72505	3	1442.6374	1442.6347	K	L	287	299
PSM	EWGDDEEEQPSK	2769	sp|Q15020-4|SART3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8282.11	86.41078	2	1447.5726	1447.5739	K	R	596	608
PSM	EVDEQMLNVQNK	2770	sp|Q9BVA1|TBB2B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	6-UNIMOD:35	ms_run[1]:scan=1.1.8429.10	90.30711	2	1461.6738	1461.6769	K	N	325	337
PSM	LSSEMNTSTVNSAR	2771	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8310.11	87.15857	2	1495.6910	1495.6936	R	E	277	291
PSM	NIVQHTTDSSLEEK	2772	sp|Q9H501|ESF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8176.9	83.6827	3	1599.7714	1599.7740	K	Q	171	185
PSM	VAVVQYSGTGQQRPER	2773	sp|P12109|CO6A1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8310.9	87.15524	3	1773.9085	1773.9122	R	A	873	889
PSM	LLETTDRPDGHQNNLR	2774	sp|Q14974|IMB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8195.11	84.17648	2	1877.9360	1877.9344	K	S	510	526
PSM	TPLRPLDPTR	2775	sp|Q04637-3|IF4G1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8746.4	98.74593	3	1164.6631	1164.6615	K	L	607	617
PSM	LGHELQQAGLK	2776	sp|Q14980-2|NUMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8548.2	93.46055	3	1192.6603	1192.6564	R	T	1641	1652
PSM	QVSSHIQVLAR	2777	sp|P28347-2|TEAD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8808.4	100.4169	3	1236.6952	1236.6939	K	R	74	85
PSM	LEALSVKEETK	2778	sp|P43487|RANG_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8505.5	92.32367	3	1245.6829	1245.6816	K	E	184	195
PSM	AGKGEVTFEDVK	2779	sp|Q9UJS0-2|CMC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8821.4	100.7678	3	1278.6460	1278.6456	K	Q	102	114
PSM	HRPELIEYDK	2780	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8535.9	93.12275	3	1298.6641	1298.6619	R	L	205	215
PSM	EAGDVCYADVQK	2781	sp|Q13242|SRSF9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	6-UNIMOD:4	ms_run[1]:scan=1.1.8685.5	97.10512	3	1353.5875	1353.5871	R	D	133	145
PSM	RTEEGPTLSYGR	2782	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8525.7	92.85367	3	1364.6692	1364.6684	R	D	149	161
PSM	FGGALDAAAK	2783	sp|P53396|ACLY_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8729.6	98.29048	2	919.4750	919.4763	R	M	935	945
PSM	ETYGEMADCCAK	2784	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	9-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.8829.6	100.9849	3	1433.5258	1433.5261	R	Q	106	118
PSM	GGGQIIPTAR	2785	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8547.9	93.44508	2	968.5392	968.5403	R	R	717	727
PSM	GSAFSTSISK	2786	sp|Q9Y285|SYFA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8620.7	95.3615	2	983.4920	983.4924	K	Q	178	188
PSM	SAINEVVTR	2787	sp|P62899|RL31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8701.7	97.54044	2	987.5348	987.5349	R	E	15	24
PSM	HVLVTLGEK	2788	sp|P60660-2|MYL6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8763.7	99.21035	2	994.5792	994.5811	R	M	111	120
PSM	HVLVTLGEK	2789	sp|P60660-2|MYL6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8777.9	99.59097	2	994.5792	994.5811	R	M	111	120
PSM	KPALVSTVEGGQDPK	2790	sp|Q14690|RRP5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8672.8	96.7593	3	1524.8143	1524.8148	R	N	707	722
PSM	SAAQLSLSSR	2791	sp|Q9H7Z7|PGES2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8678.7	96.91956	2	1018.5394	1018.5407	R	L	90	100
PSM	TAVCDIPPR	2792	sp|Q9BVA1|TBB2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	4-UNIMOD:4	ms_run[1]:scan=1.1.8485.8	91.8048	2	1027.5110	1027.5121	K	G	351	360
PSM	TAVCDIPPR	2793	sp|Q9BVA1|TBB2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	4-UNIMOD:4	ms_run[1]:scan=1.1.8678.8	96.92123	2	1027.5126	1027.5121	K	G	351	360
PSM	TAVCDIPPR	2794	sp|Q9BVA1|TBB2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	4-UNIMOD:4	ms_run[1]:scan=1.1.8794.8	100.0465	2	1027.5116	1027.5121	K	G	351	360
PSM	TAVCDIPPR	2795	sp|Q9BVA1|TBB2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	4-UNIMOD:4	ms_run[1]:scan=1.1.8562.6	93.84437	2	1027.5100	1027.5121	K	G	351	360
PSM	TAVCDIPPR	2796	sp|Q9BVA1|TBB2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	4-UNIMOD:4	ms_run[1]:scan=1.1.8543.6	93.33253	2	1027.5120	1027.5121	K	G	351	360
PSM	TAVCDIPPR	2797	sp|Q9BVA1|TBB2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	4-UNIMOD:4	ms_run[1]:scan=1.1.8602.6	94.87885	2	1027.5128	1027.5121	K	G	351	360
PSM	TAVCDIPPR	2798	sp|Q9BVA1|TBB2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	4-UNIMOD:4	ms_run[1]:scan=1.1.8754.8	98.96854	2	1027.5132	1027.5121	K	G	351	360
PSM	ILGPQGNTIK	2799	sp|Q07666|KHDR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8531.9	93.0161	2	1039.6036	1039.6026	K	R	176	186
PSM	ILGPQGNTIK	2800	sp|Q07666|KHDR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8534.9	93.096	2	1039.6036	1039.6026	K	R	176	186
PSM	DCGSVDGVIK	2801	sp|P61916|NPC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	2-UNIMOD:4	ms_run[1]:scan=1.1.8732.10	98.37797	2	1048.4832	1048.4859	K	E	26	36
PSM	ITIGQAPTEK	2802	sp|P11586|C1TC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8592.8	94.62438	2	1056.5796	1056.5815	K	G	544	554
PSM	DGGFCEVCK	2803	sp|P07602-2|SAP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	5-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.8484.8	91.77893	2	1070.4156	1070.4161	K	K	407	416
PSM	SVEAAAELSAK	2804	sp|P20962|PTMS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8590.8	94.57332	2	1074.5542	1074.5557	K	D	5	16
PSM	TTDDTTTDNYIAQGK	2805	sp|Q7Z2T5|TRM1L_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8570.7	94.05928	3	1642.7275	1642.7322	K	R	595	610
PSM	LKGDDLQAIK	2806	sp|P07910-2|HNRPC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8511.2	92.47773	3	1099.6279	1099.6237	K	Q	175	185
PSM	CDEPILSNR	2807	sp|P30086|PEBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	1-UNIMOD:4	ms_run[1]:scan=1.1.8640.8	95.90057	2	1102.5062	1102.5077	K	S	133	142
PSM	CDEPILSNR	2808	sp|P30086|PEBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	1-UNIMOD:4	ms_run[1]:scan=1.1.8621.9	95.3917	2	1102.5062	1102.5077	K	S	133	142
PSM	SLESTTLTEK	2809	sp|Q16527|CSRP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8686.8	97.13713	2	1107.5664	1107.5659	K	E	152	162
PSM	VLSQQAASVVK	2810	sp|P30566|PUR8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8521.11	92.75522	2	1128.6488	1128.6503	R	Q	405	416
PSM	GGGGPGGGGPGGGSAGGPSQPPGGGGPGIR	2811	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8699.9	97.48945	4	2269.0597	2269.0585	R	K	41	71
PSM	ILAHNNFVGR	2812	sp|Q9NZI8|IF2B1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8588.2	94.51203	3	1139.6245	1139.6200	K	L	281	291
PSM	QLIVANAGDSR	2813	sp|O15355|PPM1G_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8493.10	92.0168	2	1142.6020	1142.6044	K	C	340	351
PSM	NSDEADLVPAK	2814	sp|P83916|CBX1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8506.9	92.35686	2	1157.5556	1157.5564	K	E	140	151
PSM	NLDDGIDDER	2815	sp|P11940-2|PABP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8819.9	100.7222	2	1160.4934	1160.4946	K	L	300	310
PSM	ITELTDENVK	2816	sp|P19387|RPB3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8746.10	98.75594	2	1160.5908	1160.5925	R	F	11	21
PSM	CYEMASHLR	2817	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	1-UNIMOD:4	ms_run[1]:scan=1.1.8598.10	94.78145	2	1165.5050	1165.5008	K	R	128	137
PSM	MSVIEEGDCK	2818	sp|P11216|PYGB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	9-UNIMOD:4	ms_run[1]:scan=1.1.8489.10	91.91235	2	1166.4944	1166.4948	R	R	429	439
PSM	STGCDFAVSPK	2819	sp|P55809|SCOT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	4-UNIMOD:4	ms_run[1]:scan=1.1.8758.11	99.08183	2	1167.5222	1167.5230	K	L	501	512
PSM	EAIHSQLLEK	2820	sp|O60925|PFD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8674.10	96.81628	2	1166.6266	1166.6295	K	Q	74	84
PSM	EDTEEYNLR	2821	sp|P51991|ROA3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8620.8	95.36317	2	1167.5038	1167.5044	K	D	135	144
PSM	IQETQAELPR	2822	sp|Q14566|MCM6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8736.10	98.48573	2	1183.6174	1183.6197	R	G	208	218
PSM	IQETQAELPR	2823	sp|Q14566|MCM6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8717.10	97.97356	2	1183.6174	1183.6197	R	G	208	218
PSM	LAPEYEAAATR	2824	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8689.11	97.22317	2	1190.5916	1190.5931	R	L	63	74
PSM	VVAEVYDQER	2825	sp|Q9UHX1-2|PUF60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8608.8	95.04113	2	1206.5852	1206.5881	K	F	525	535
PSM	ESGSTLDLSGSR	2826	sp|Q9ULU4-19|PKCB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8677.10	96.89751	2	1207.5680	1207.5681	K	E	1143	1155
PSM	KLVIVGDGACGK	2827	sp|P08134|RHOC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	10-UNIMOD:4	ms_run[1]:scan=1.1.8502.10	92.25237	2	1215.6626	1215.6646	K	T	7	19
PSM	EIGQSVDEVEK	2828	sp|Q01082-2|SPTB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8501.10	92.22607	2	1231.5932	1231.5932	R	L	2044	2055
PSM	AADSLQQNLQR	2829	sp|Q1ED39|KNOP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8687.10	97.16748	2	1242.6294	1242.6316	K	D	408	419
PSM	TNQELQEINR	2830	sp|P07355-2|ANXA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8490.10	91.93845	2	1243.6134	1243.6156	R	V	154	164
PSM	VSDATGQMNLTK	2831	sp|P40121-2|CAPG_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8478.11	91.6253	2	1263.6114	1263.6129	K	V	239	251
PSM	TAYSGGAEDLER	2832	sp|Q9Y388|RBMX2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8641.11	95.93259	2	1267.5692	1267.5680	R	E	229	241
PSM	HPDADSLYVEK	2833	sp|P54577|SYYC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8806.10	100.3728	2	1272.5958	1272.5986	K	I	381	392
PSM	RMGESDDSILR	2834	sp|P63220|RS21_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8773.10	99.48479	2	1277.6004	1277.6034	R	L	61	72
PSM	LVESDAEAEAVR	2835	sp|Q9BZJ0-3|CRNL1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8823.7	100.8266	2	1287.6296	1287.6306	R	E	488	500
PSM	GNEGTLESINEK	2836	sp|O60870-2|KIN17_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8639.10	95.87693	2	1289.6086	1289.6099	R	T	352	364
PSM	DSYDSYATHNE	2837	sp|Q14011|CIRBP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8497.10	92.12119	2	1300.4824	1300.4844	R	-	162	173
PSM	AITPQAQEELQK	2838	sp|Q02952-2|AKA12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8690.6	97.2418	3	1354.7104	1354.7092	K	Q	1660	1672
PSM	YTCIAGNSCNIK	2839	sp|Q13308-6|PTK7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	3-UNIMOD:4,9-UNIMOD:4	ms_run[1]:scan=1.1.8547.11	93.44842	2	1399.6174	1399.6224	R	H	670	682
PSM	AVANYDSVEEGEK	2840	sp|P51659-2|DHB4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8585.9	94.44695	2	1409.6292	1409.6310	K	V	94	107
PSM	QQNQELQEQLR	2841	sp|Q14980-2|NUMA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8768.11	99.35167	2	1412.6998	1412.7008	K	S	1612	1623
PSM	FECGEGEEAAETE	2842	sp|P43897-2|EFTS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	3-UNIMOD:4	ms_run[1]:scan=1.1.8806.11	100.3745	2	1456.5262	1456.5300	R	-	334	347
PSM	NLETSSAFQSSSQK	2843	sp|Q9Y2X9-2|ZN281_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8823.10	100.8316	2	1512.7026	1512.7056	K	L	738	752
PSM	TAVCDIPPR	2844	sp|Q9BVA1|TBB2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	4-UNIMOD:4	ms_run[1]:scan=1.1.8911.8	103.1171	2	1027.5146	1027.5121	K	G	351	360
PSM	ALAAGGYDVEK	2845	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9018.3	105.9453	3	1092.5455	1092.5451	K	N	68	79
PSM	LIDREIISHDTR	2846	sp|P00387-3|NB5R3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9166.2	109.8446	4	1466.7861	1466.7841	R	R	80	92
PSM	QEYDESGPSIVHR	2847	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8897.3	102.7499	4	1515.6981	1515.6954	K	K	360	373
PSM	SAVRPASLNLNR	2848	sp|Q96N67-3|DOCK7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8859.3	101.7644	3	1296.7285	1296.7262	R	S	882	894
PSM	VKLDSPAGTALSPSGHTK	2849	sp|P32322-3|P5CR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9088.3	107.8075	4	1764.9281	1764.9370	K	L	317	335
PSM	ELEAENYHDIK	2850	sp|Q01082-2|SPTB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8927.7	103.5314	3	1359.6322	1359.6306	R	R	487	498
PSM	EFKEEGEEIPR	2851	sp|Q9UKV3-5|ACINU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9170.4	109.9557	3	1361.6470	1361.6463	K	V	303	314
PSM	VGAAEIISR	2852	sp|O75533|SF3B1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9077.6	107.5232	2	914.5184	914.5185	K	I	844	853
PSM	YRGQYNTYPIK	2853	sp|P61619|S61A1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8978.5	104.8895	3	1401.7027	1401.7041	R	L	272	283
PSM	GHQQLYWSHPR	2854	sp|P62273-2|RS29_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8851.7	101.559	3	1407.7015	1407.6796	M	K	2	13
PSM	THAVLVALK	2855	sp|P25786-2|PSA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8884.5	102.4198	2	950.5924	950.5913	K	R	48	57
PSM	YELISETGGSHDK	2856	sp|Q12906-7|ILF3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8947.7	104.0644	3	1434.6622	1434.6627	K	R	545	558
PSM	PAYHSSLMDPDTK	2857	sp|O15145|ARPC3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9031.8	106.3018	3	1460.6569	1460.6606	M	L	2	15
PSM	ATAVVDGAFK	2858	sp|P32119|PRDX2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9169.6	109.9322	2	977.5166	977.5182	K	E	17	27
PSM	VSGDDVIIGK	2859	sp|P30876|RPB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9083.9	107.6871	2	1001.5388	1001.5393	R	T	860	870
PSM	TAVCDIPPR	2860	sp|Q9BVA1|TBB2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	4-UNIMOD:4	ms_run[1]:scan=1.1.8950.8	104.1463	2	1027.5122	1027.5121	K	G	351	360
PSM	TAVCDIPPR	2861	sp|Q9BVA1|TBB2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	4-UNIMOD:4	ms_run[1]:scan=1.1.8891.7	102.6031	2	1027.5088	1027.5121	K	G	351	360
PSM	LGEVVNTHGPVEPDK	2862	sp|P30419|NMT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9060.8	107.0768	3	1589.8042	1589.8049	K	D	128	143
PSM	AEPVEVVAPR	2863	sp|P09874|PARP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9084.7	107.7101	2	1065.5812	1065.5818	K	G	487	497
PSM	SIPLDEGEDEAQRR	2864	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9188.9	110.4435	3	1613.7640	1613.7645	R	R	2384	2398
PSM	ELNNTCEPVVTQPK	2865	sp|Q92598-2|HS105_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	6-UNIMOD:4	ms_run[1]:scan=1.1.8941.7	103.9037	3	1627.7878	1627.7876	K	P	747	761
PSM	LLSESAQPLK	2866	sp|Q9H3N1|TMX1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9146.8	109.3168	2	1084.6108	1084.6128	K	K	224	234
PSM	AEEDEILNR	2867	sp|P27824-2|CALX_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9165.7	109.8259	2	1087.5134	1087.5145	K	S	609	618
PSM	DGGVQACFSR	2868	sp|P08754|GNAI3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	7-UNIMOD:4	ms_run[1]:scan=1.1.9043.10	106.6257	2	1095.4756	1095.4768	R	S	133	143
PSM	VEAIDVEEAK	2869	sp|P33991|MCM4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9147.8	109.3436	2	1101.5542	1101.5553	K	R	753	763
PSM	SPDSDVAATLK	2870	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9189.9	110.4699	2	1102.5476	1102.5506	K	K	767	778
PSM	GTEVQVDDIK	2871	sp|Q9Y230-2|RUVB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8852.8	101.5866	2	1102.5500	1102.5506	K	R	373	383
PSM	DAISGIGTDEK	2872	sp|P08133-2|ANXA6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8911.9	103.1188	2	1104.5304	1104.5299	K	C	71	82
PSM	ATAGDTHLGGEDFDNR	2873	sp|P0DMV8-2|HS71A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9157.11	109.6175	3	1674.7216	1674.7234	K	L	166	182
PSM	TYHALSNLPK	2874	sp|O00231-2|PSD11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8908.8	103.0417	2	1142.6056	1142.6084	K	A	176	186
PSM	VLTVINQTQK	2875	sp|P42766|RL35_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8836.9	101.1722	2	1142.6642	1142.6659	R	E	57	67
PSM	VLTVINQTQK	2876	sp|P42766|RL35_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8850.11	101.5397	2	1142.6642	1142.6659	R	E	57	67
PSM	DADIGVAEAER	2877	sp|Q14254|FLOT2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8954.9	104.2551	2	1144.5358	1144.5360	R	D	178	189
PSM	EVHLGACGALK	2878	sp|O60716-11|CTND1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	7-UNIMOD:4	ms_run[1]:scan=1.1.8897.4	102.7516	3	1153.5937	1153.5914	K	N	369	380
PSM	SGEIVQEYDR	2879	sp|O60508|PRP17_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8976.10	104.8455	2	1194.5542	1194.5517	R	H	407	417
PSM	ANSNLVLQADR	2880	sp|O75643|U520_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9160.8	109.6931	2	1199.6234	1199.6258	K	S	15	26
PSM	ANSNLVLQADR	2881	sp|O75643|U520_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9179.8	110.2044	2	1199.6234	1199.6258	K	S	15	26
PSM	NKLDHYAIIK	2882	sp|P62750|RL23A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9167.7	109.8799	2	1213.6794	1213.6819	R	F	69	79
PSM	YHDIEPGAVVK	2883	sp|Q14690|RRP5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8879.7	102.2977	2	1226.6268	1226.6295	R	G	447	458
PSM	AHVVPCFDASK	2884	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	6-UNIMOD:4	ms_run[1]:scan=1.1.9165.3	109.8192	3	1229.5870	1229.5863	K	V	1152	1163
PSM	LNQDQLDAVSK	2885	sp|Q14444-2|CAPR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9061.9	107.1051	2	1229.6200	1229.6252	R	Y	88	99
PSM	NVTDVVNTCHDAGISKK	2886	sp|Q9Y3I0|RTCB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	9-UNIMOD:4	ms_run[1]:scan=1.1.9010.10	105.7438	3	1856.9032	1856.9051	K	A	477	494
PSM	LLASAGQDNVVR	2887	sp|Q5JSH3-2|WDR44_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8859.9	101.7744	2	1241.6678	1241.6728	R	I	525	537
PSM	VDVTEQPGLSGR	2888	sp|Q9H3N1|TMX1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9088.9	107.8175	2	1256.6306	1256.6361	K	F	83	95
PSM	YLAEVACGDDR	2889	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	7-UNIMOD:4	ms_run[1]:scan=1.1.9110.10	108.3864	2	1267.5472	1267.5503	R	K	128	139
PSM	AVAGNISDPGLQK	2890	sp|P18206|VINC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8998.9	105.4229	2	1268.6700	1268.6725	K	S	803	816
PSM	SGSSFVHQASFK	2891	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8863.11	101.8847	2	1280.6212	1280.6150	K	F	1447	1459
PSM	IVEPPENIQEK	2892	sp|A5YKK6-2|CNOT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9163.10	109.777	2	1294.6728	1294.6768	R	I	1083	1094
PSM	SEVAAGGGSWDDR	2893	sp|Q66K74-2|MAP1S_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8834.10	101.1217	2	1305.5562	1305.5586	R	L	287	300
PSM	AAECNIVVTQPR	2894	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	4-UNIMOD:4	ms_run[1]:scan=1.1.9067.11	107.2682	2	1356.6794	1356.6820	R	R	435	447
PSM	DGKDPNQFTISR	2895	sp|Q15583|TGIF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9126.6	108.7945	3	1376.6671	1376.6684	K	R	230	242
PSM	SATSSSVSNVVITK	2896	sp|P42566|EPS15_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9060.10	107.0801	2	1378.7270	1378.7304	R	N	741	755
PSM	MGITEYNNQCR	2897	sp|P41252|SYIC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	10-UNIMOD:4	ms_run[1]:scan=1.1.9105.10	108.2572	2	1384.5824	1384.5863	K	A	111	122
PSM	TAEDDETPVDLNK	2898	sp|O00443|P3C2A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8961.11	104.446	2	1445.6488	1445.6522	R	H	520	533
PSM	TNYNDRYDEIR	2899	sp|P62424|RL7A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8860.7	101.7978	3	1457.6533	1457.6535	R	R	224	235
PSM	EIQEPDPTYEEK	2900	sp|O60264|SMCA5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9170.11	109.9674	2	1476.6584	1476.6620	K	M	72	84
PSM	YEQGTGCWQGPNR	2901	sp|P14314-2|GLU2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	7-UNIMOD:4	ms_run[1]:scan=1.1.9174.9	110.0719	3	1551.6490	1551.6525	K	S	462	475
PSM	SGNALFHASTLHR	2902	sp|Q14152|EIF3A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9220.2	111.2785	4	1409.7201	1409.7164	K	L	286	299
PSM	TALIHDGLAR	2903	sp|P25398|RS12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9267.3	112.5227	3	1065.5950	1065.5931	K	G	24	34
PSM	SCGSSSHENRPLDLLHK	2904	sp|Q7Z6Z7-2|HUWE1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	2-UNIMOD:4	ms_run[1]:scan=1.1.9494.3	118.5779	5	1935.9236	1935.9221	K	M	3242	3259
PSM	KLDPGSEETQTLVR	2905	sp|P26641-2|EF1G_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9511.3	119.034	4	1571.8169	1571.8155	R	E	451	465
PSM	KHEAFETDFTVHK	2906	sp|Q13813|SPTN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9515.5	119.145	4	1587.7697	1587.7682	K	D	1911	1924
PSM	KPLLESGTLGTK	2907	sp|P22314|UBA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9233.5	111.6329	3	1242.7201	1242.7183	R	G	593	605
PSM	VRIDEYDYSK	2908	sp|P31040-2|SDHA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9545.4	119.9387	3	1286.6140	1286.6143	K	P	551	561
PSM	DLLHPSPEEEK	2909	sp|P42677|RS27_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9443.3	117.2033	3	1292.6275	1292.6248	K	R	6	17
PSM	YAVTTGDHGIIR	2910	sp|P53621-2|COPA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9448.5	117.3418	3	1301.6740	1301.6728	K	T	560	572
PSM	VCDEPHPLLVK	2911	sp|P35250-2|RFC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	2-UNIMOD:4	ms_run[1]:scan=1.1.9308.6	113.6183	3	1305.6748	1305.6751	K	E	220	231
PSM	VCDEPHPLLVK	2912	sp|P35250-2|RFC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	2-UNIMOD:4	ms_run[1]:scan=1.1.9307.5	113.5896	3	1305.6748	1305.6751	K	E	220	231
PSM	IRYESLTDPSK	2913	sp|P07900-2|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9380.8	115.5267	3	1307.6773	1307.6721	K	L	181	192
PSM	TLIQNCGASTIR	2914	sp|P49368|TCPG_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	6-UNIMOD:4	ms_run[1]:scan=1.1.9416.5	116.4876	3	1332.6811	1332.6820	R	L	450	462
PSM	IFQGNVHNFEK	2915	sp|Q96DI7-2|SNR40_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9537.8	119.7387	3	1331.6617	1331.6622	K	N	276	287
PSM	NPLPPSVGVVDKK	2916	sp|Q8NC51-3|PAIRB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9357.4	114.9043	3	1348.7743	1348.7715	K	E	80	93
PSM	IQTQPGYANTLR	2917	sp|Q00325-2|MPCP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9343.6	114.5405	3	1360.7068	1360.7099	R	D	189	201
PSM	IVVVTAGVR	2918	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9334.8	114.308	2	912.5764	912.5757	K	Q	92	101
PSM	KEPLYVGVDDDK	2919	sp|Q9NVP1|DDX18_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9338.6	114.4105	3	1376.6830	1376.6824	K	A	381	393
PSM	IGGGDTTEHIQTHFESK	2920	sp|O14497|ARI1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9291.7	113.1623	4	1855.8689	1855.8701	R	T	1846	1863
PSM	SGFSLGSDGK	2921	sp|Q07954|LRP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9227.5	111.4716	2	953.4368	953.4454	R	S	508	518
PSM	SRVTQSNFAVGYK	2922	sp|P21796|VDAC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9317.8	113.8625	3	1455.7453	1455.7470	K	T	162	175
PSM	AVDSQILPK	2923	sp|Q02878|RL6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9396.8	115.9586	2	969.5496	969.5495	K	I	252	261
PSM	AVDSQILPK	2924	sp|Q02878|RL6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9377.6	115.4427	2	969.5496	969.5495	K	I	252	261
PSM	SGVSLAALKK	2925	sp|P16402|H13_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9202.5	110.8063	2	972.5970	972.5968	R	A	56	66
PSM	DREDYVPYTGEK	2926	sp|Q9NYL9|TMOD3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9501.7	118.7725	3	1470.6631	1470.6627	K	K	82	94
PSM	VTEFGGELHEDGGK	2927	sp|Q9UFW8|CGBP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9247.5	112.0053	3	1473.6724	1473.6736	R	L	27	41
PSM	VFEHDSVELNCK	2928	sp|P10768|ESTD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	11-UNIMOD:4	ms_run[1]:scan=1.1.9477.9	118.1308	3	1475.6698	1475.6715	K	M	18	30
PSM	LEVNELSGK	2929	sp|Q5T7N2|LITD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9335.7	114.3327	2	987.5238	987.5237	K	L	137	146
PSM	MLVSGAGDIK	2930	sp|P40227-2|TCPZ_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9495.6	118.6096	2	989.5198	989.5216	K	L	46	56
PSM	EHYPNGVCTVYGK	2931	sp|P47755|CAZA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	8-UNIMOD:4	ms_run[1]:scan=1.1.9208.6	110.9662	3	1522.6858	1522.6875	K	K	134	147
PSM	NVEDFTGPR	2932	sp|P61009|SPCS3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9297.8	113.3253	2	1033.4818	1033.4829	K	E	50	59
PSM	VFQGCGPPKPLPAGR	2933	sp|O75487|GPC4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	5-UNIMOD:4	ms_run[1]:scan=1.1.9370.7	115.2566	3	1579.8283	1579.8293	K	I	337	352
PSM	IAEVDASVVR	2934	sp|P31930|QCR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9407.9	116.2563	2	1057.5748	1057.5768	R	E	433	443
PSM	KHEAFETDFTVHK	2935	sp|Q13813|SPTN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9504.6	118.851	3	1587.7759	1587.7682	K	D	1911	1924
PSM	MREIVHIQAGQCGNQIGAK	2936	sp|Q9BVA1|TBB2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	1-UNIMOD:35,12-UNIMOD:4	ms_run[1]:scan=1.1.9305.9	113.5426	4	2125.0433	2125.0521	-	F	1	20
PSM	EAALGAGFSDK	2937	sp|P55084-2|ECHB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9460.6	117.6676	2	1064.5124	1064.5138	R	T	96	107
PSM	HLALNLQEK	2938	sp|Q14683|SMC1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9319.8	113.915	2	1064.5964	1064.5978	R	S	726	735
PSM	NPVMELNEK	2939	sp|Q12906-7|ILF3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9253.8	112.1672	2	1072.5216	1072.5223	K	R	531	540
PSM	LSVEESEAAGDGVDTK	2940	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9489.8	118.4517	3	1605.7342	1605.7370	K	V	427	443
PSM	QAITQVVVSR	2941	sp|Q9H9B4|SFXN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9406.7	116.2262	2	1099.6342	1099.6350	K	I	224	234
PSM	SADDSLSGVVR	2942	sp|Q15334|L2GL1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9524.8	119.3919	2	1104.5606	1104.5411	R	C	714	725
PSM	LSPQAVNSIAK	2943	sp|P30626-2|SORCN_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9286.10	113.0329	2	1126.6334	1126.6346	R	R	121	132
PSM	LLSADADGQIK	2944	sp|Q9Y2X0-2|MED16_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9213.10	111.1049	2	1129.5962	1129.5979	R	C	96	107
PSM	VQYTETEPYHNYR	2945	sp|Q86VM9|ZCH18_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9293.10	113.2209	3	1698.7591	1698.7638	R	E	390	403
PSM	VENNDLVIAR	2946	sp|Q9NZW5|MPP6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9391.6	115.8202	2	1141.6084	1141.6091	R	I	147	157
PSM	VLELNASDER	2947	sp|P35249-2|RFC4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9402.11	116.1254	2	1144.5746	1144.5724	R	G	105	115
PSM	NLQTVNVDEN	2948	sp|P62899|RL31_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9228.8	111.5035	2	1144.5336	1144.5360	K	-	116	126
PSM	VNVPVIGGHAGK	2949	sp|P40926|MDHM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9497.8	118.6668	2	1146.6472	1146.6510	R	T	192	204
PSM	CNELQDIEK	2950	sp|O60264|SMCA5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	1-UNIMOD:4	ms_run[1]:scan=1.1.9516.7	119.1752	2	1147.5158	1147.5179	R	I	891	900
PSM	LREEIEELK	2951	sp|O60763-2|USO1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9432.4	116.9084	3	1157.6299	1157.6291	R	R	746	755
PSM	LGNTTVICGVK	2952	sp|Q96B26|EXOS8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	8-UNIMOD:4	ms_run[1]:scan=1.1.9442.7	117.183	2	1160.6200	1160.6224	K	A	53	64
PSM	HFVLDECDK	2953	sp|O00148|DX39A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	7-UNIMOD:4	ms_run[1]:scan=1.1.9243.10	111.9074	2	1161.5108	1161.5125	K	M	191	200
PSM	LFNTAVCESK	2954	sp|Q9BXJ9|NAA15_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	7-UNIMOD:4	ms_run[1]:scan=1.1.9403.9	116.1488	2	1167.5574	1167.5594	R	D	715	725
PSM	ASSVVVSGTPIR	2955	sp|P16930-2|FAAA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9244.10	111.934	2	1171.6556	1171.6561	R	R	93	105
PSM	VANIICTQPR	2956	sp|Q6P158|DHX57_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	6-UNIMOD:4	ms_run[1]:scan=1.1.9205.11	110.8954	2	1170.6124	1170.6179	K	R	593	603
PSM	IINNTENLVR	2957	sp|Q9Y617|SERC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9382.11	115.5857	2	1184.6492	1184.6513	K	E	52	62
PSM	GAIDHYVTPVK	2958	sp|Q9NX20|RM16_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9387.4	115.7091	3	1198.6381	1198.6346	K	A	145	156
PSM	YSYQYTVANK	2959	sp|Q969X5-2|ERGI1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9405.11	116.206	2	1235.5804	1235.5822	R	E	113	123
PSM	AENYDIPSADR	2960	sp|P22314|UBA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9323.7	114.0178	2	1249.5560	1249.5575	R	H	870	881
PSM	SVHFPGQAVGTR	2961	sp|Q06210|GFPT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9219.5	111.2566	3	1254.6493	1254.6469	K	R	191	203
PSM	IAFGGETDEATR	2962	sp|P51648-2|AL3A2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9490.9	118.4802	2	1265.5868	1265.5888	K	Y	300	312
PSM	ESWEMNSEEK	2963	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9217.10	111.2112	2	1267.4988	1267.5026	K	L	257	267
PSM	IETALTSLHQR	2964	sp|Q15818|NPTX1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9447.6	117.3164	3	1267.6843	1267.6884	K	I	201	212
PSM	LHGVNINVEASK	2965	sp|Q9BWF3|RBM4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9419.3	116.5625	3	1279.6867	1279.6884	K	N	60	72
PSM	QDLPALEEKPR	2966	sp|P34932|HSP74_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9457.5	117.5851	3	1294.6885	1294.6881	K	N	186	197
PSM	NCIIVSPDAGGAK	2967	sp|P21108|PRPS3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	2-UNIMOD:4	ms_run[1]:scan=1.1.9371.8	115.285	2	1300.6408	1300.6445	K	R	164	177
PSM	NLCSDDTPMVR	2968	sp|P30153|2AAA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	3-UNIMOD:4	ms_run[1]:scan=1.1.9435.8	116.9959	2	1306.5610	1306.5646	R	R	172	183
PSM	EDQTEYLEER	2969	sp|P07900-2|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9395.10	115.9349	2	1310.5584	1310.5626	K	R	314	324
PSM	EDQTEYLEER	2970	sp|P07900-2|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9414.11	116.4453	2	1310.5584	1310.5626	K	R	314	324
PSM	NASDMPETITSR	2971	sp|Q8TCT9-2|HM13_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9279.11	112.8497	2	1320.5960	1320.5980	K	D	62	74
PSM	VLTDEQYQAVR	2972	sp|Q9ULZ3-3|ASC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9392.9	115.8522	2	1320.6616	1320.6674	K	A	80	91
PSM	IIYGGSVTGATCK	2973	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	12-UNIMOD:4	ms_run[1]:scan=1.1.9379.6	115.4965	3	1325.6665	1325.6649	R	E	244	257
PSM	VPLEVQEADEAK	2974	sp|P26640|SYVC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9474.10	118.0515	2	1326.6646	1326.6667	K	L	1231	1243
PSM	ETIGVGSYSECK	2975	sp|Q15418|KS6A1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	11-UNIMOD:4	ms_run[1]:scan=1.1.9528.10	119.503	2	1328.5870	1328.5918	K	R	422	434
PSM	NPLPPSVGVVDKK	2976	sp|Q8NC51-3|PAIRB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9377.5	115.441	3	1348.7743	1348.7715	K	E	80	93
PSM	TNETGYQEAIVK	2977	sp|Q8IYU8|MICU2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9229.11	111.5352	2	1351.6462	1351.6619	K	E	215	227
PSM	IQTQPGYANTLR	2978	sp|Q00325-2|MPCP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9304.11	113.5189	2	1360.7054	1360.7099	R	D	189	201
PSM	GVEAVGSYAENQR	2979	sp|Q12996|CSTF3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9202.11	110.8163	2	1378.6438	1378.6477	K	I	152	165
PSM	LNQPPEDGISSVK	2980	sp|O43684-2|BUB3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9212.11	111.0802	2	1382.6990	1382.7041	K	F	9	22
PSM	AFFESHPAPSAER	2981	sp|P55786|PSA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9412.11	116.3936	2	1444.6660	1444.6735	K	T	870	883
PSM	TEQGPQVDETQFK	2982	sp|P05091-2|ALDH2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9492.11	118.5372	2	1505.6986	1505.6998	K	K	309	322
PSM	EYAEDDNIYQQK	2983	sp|Q96FW1|OTUB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9230.11	111.5622	2	1514.6468	1514.6525	K	I	60	72
PSM	KLDPGSEETQTLVR	2984	sp|P26641-2|EF1G_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9523.8	119.365	3	1571.8123	1571.8155	R	E	451	465
PSM	EVEERPAPTPWGSK	2985	sp|O15143|ARC1B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9483.7	118.2887	3	1581.7753	1581.7787	K	M	175	189
PSM	LRTEGDGVYTLNNEK	2986	sp|P00738|HPT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9426.9	116.7565	3	1707.8389	1707.8428	K	Q	117	132
PSM	LRTEGDGVYTLNNEK	2987	sp|P00738|HPT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9406.9	116.2295	3	1707.8389	1707.8428	K	Q	117	132
PSM	HPSSPECLVSAQK	2988	sp|Q14980-2|NUMA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	7-UNIMOD:4	ms_run[1]:scan=1.1.8451.7	90.89288	3	1438.6885	1438.6875	K	V	74	87
PSM	RSQEDEISSPVNK	2989	sp|Q5UIP0|RIF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7692.9	71.07327	3	1487.7232	1487.7216	K	V	2188	2201
PSM	SEPIPESNDGPVK	2990	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8564.9	93.90324	3	1367.6590	1367.6569	K	V	367	380
PSM	LEHETAVTVSEEVSK	2991	sp|Q02952-2|AKA12_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9398.10	116.0158	3	1656.8164	1656.8206	K	Q	1260	1275
PSM	DPSASPGDAGEQAIR	2992	sp|P18206|VINC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8453.9	90.94988	3	1469.6752	1469.6746	R	Q	286	301
PSM	DTPGHGSGWAETPR	2993	sp|O75533|SF3B1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8527.6	92.90493	3	1466.6566	1466.6539	R	T	302	316
PSM	RFDDAVVQSDMK	2994	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	11-UNIMOD:35	ms_run[1]:scan=1.1.8357.8	88.40013	3	1425.6730	1425.6558	R	H	77	89
PSM	NPLPPSVGVVDKK	2995	sp|Q8NC51-3|PAIRB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9401.6	116.09	3	1348.7713	1348.7715	K	E	80	93
PSM	QKPVLEEQVIK	2996	sp|Q86UP2-4|KTN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9457.6	117.5867	3	1309.7599	1309.7605	K	E	121	132
PSM	KHEAFESDLAAHQDR	2997	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8067.5	80.8528	4	1752.8245	1752.8179	K	V	455	470
PSM	FAASNPCGNIQR	2998	sp|Q9NU22|MDN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	7-UNIMOD:4	ms_run[1]:scan=1.1.8668.9	96.65338	2	1333.6180	1333.6197	R	S	973	985
PSM	FVTSNTQELGK	2999	sp|Q9BXP5-2|SRRT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8617.9	95.28422	2	1222.6188	1222.6194	K	D	700	711
PSM	PFSAPKPQTSPSPK	3000	sp|Q01518-2|CAP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8057.6	80.58718	3	1467.7738	1467.7722	K	R	298	312
PSM	IYAPEAPYTSHDK	3001	sp|Q29RF7|PDS5A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9350.5	114.7216	3	1490.7247	1490.7041	R	L	100	113
PSM	KPALQSSVVATSK	3002	sp|Q9H307|PININ_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7569.7	67.77745	3	1314.7528	1314.7507	K	E	109	122
PSM	NNASTDYDLSDK	3003	sp|P39023|RL3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8320.6	87.41602	3	1341.5692	1341.5684	K	S	301	313
PSM	HTEMITTLK	3004	sp|O75475|PSIP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8513.8	92.54053	2	1072.5614	1072.5587	K	K	393	402
PSM	SAVGFEYQGK	3005	sp|Q14247|SRC8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9461.9	117.6995	2	1084.5176	1084.5189	K	T	135	145
PSM	GCPEDAAVCAVDK	3006	sp|P11717|MPRI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	2-UNIMOD:4,9-UNIMOD:4	ms_run[1]:scan=1.1.9361.11	115.0225	2	1390.5798	1390.5857	R	N	530	543
PSM	GCPEDAAVCAVDK	3007	sp|P11717|MPRI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	2-UNIMOD:4,9-UNIMOD:4	ms_run[1]:scan=1.1.9362.10	115.0474	2	1390.5798	1390.5857	R	N	530	543
PSM	LYAVHQEGNK	3008	sp|P50990-2|TCPQ_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7192.10	57.78067	2	1157.5846	1157.5829	K	N	448	458
PSM	GTEITHAVVIK	3009	sp|B5ME19|EIFCL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8839.8	101.2492	2	1166.6650	1166.6659	K	K	322	333
PSM	ATAGDTHLGGEDFDNR	3010	sp|P0DMV8-2|HS71A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9167.6	109.8782	3	1674.7216	1674.7234	K	L	166	182
PSM	ERSGVSLAALK	3011	sp|P16402|H13_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9526.9	119.4475	2	1129.6418	1129.6455	K	K	54	65
PSM	IIYGGSVTGATCK	3012	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	12-UNIMOD:4	ms_run[1]:scan=1.1.9404.8	116.1741	2	1325.6780	1325.6649	R	E	244	257
PSM	AGSVATCQAVMR	3013	sp|O94906|PRP6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	7-UNIMOD:4	ms_run[1]:scan=1.1.8135.11	82.62955	2	1249.5918	1249.5907	R	A	516	528
PSM	RQEILSNAGLR	3014	sp|O95671-2|ASML_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9197.5	110.6746	3	1255.6972	1255.6996	R	F	24	35
PSM	SEDDESGAGELTR	3015	sp|P33993|MCM7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7759.3	72.79528	3	1364.5756	1364.5692	K	E	309	322
PSM	TAVCDIPPR	3016	sp|Q9BVA1|TBB2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	4-UNIMOD:4	ms_run[1]:scan=1.1.9139.10	109.1356	2	1027.5082	1027.5121	K	G	351	360
PSM	PAVVETVTTAK	3017	sp|P56192|SYMC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8353.9	88.29504	2	1114.6218	1114.6234	K	P	828	839
PSM	TVAIHSDVDASSVHVK	3018	sp|P05165|PCCA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9144.10	109.2666	3	1663.8493	1663.8530	K	M	89	105
PSM	LTNVAATSGDGYR	3019	sp|Q32P28|P3H1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8457.11	91.06073	2	1323.6416	1323.6419	R	G	489	502
PSM	MADKDGDLIATK	3020	sp|O43852-2|CALU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8041.5	80.15452	3	1276.6369	1276.6333	K	E	162	174
PSM	AAAAAAALQAK	3021	sp|P36578|RL4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7515.3	66.31902	3	955.5484	955.5450	K	S	354	365
PSM	AAAAAAALQAK	3022	sp|P36578|RL4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7503.2	65.99953	3	955.5484	955.5450	K	S	354	365
PSM	PHSVSLNDTETR	3023	sp|Q9P0L0|VAPA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7582.5	68.12497	3	1354.6699	1354.6477	K	K	162	174
PSM	NPSDSAVHSPFTK	3024	sp|Q14157-5|UBP2L_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9200.6	110.7553	3	1385.6578	1385.6575	K	R	408	421
PSM	ELPGHTGYLSCCR	3025	sp|Q9HAV0|GBB4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	11-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.9516.6	119.1735	3	1548.6781	1548.6813	R	F	138	151
PSM	GTQNIPAGKPSLQTSSAR	3026	sp|Q86YP4-2|P66A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8339.11	87.92862	3	1811.9497	1811.9490	R	M	196	214
PSM	LRPGALGGAADVEDTK	3027	sp|Q01970-2|PLCB3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9407.8	116.2547	3	1568.8135	1568.8158	R	E	940	956
PSM	HVEAVAYYK	3028	sp|O43765|SGTA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8080.10	81.20641	2	1078.5460	1078.5447	K	K	175	184
PSM	NLDDGIDDER	3029	sp|P11940-2|PABP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8800.11	100.2125	2	1160.4934	1160.4946	K	L	300	310
PSM	SPHFQVVNEETPK	3030	sp|Q9Y3P9|RBGP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9470.7	117.9387	3	1510.7410	1510.7416	K	D	389	402
PSM	GVTECYECHPKPTQR	3031	sp|Q9UBT2|SAE2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	5-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.7503.8	66.00954	4	1860.8281	1860.8247	K	T	154	169
PSM	SLVTEAENSQHQQK	3032	sp|P11171-5|41_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8771.8	99.42767	3	1597.7683	1597.7696	K	E	6	20
PSM	EIQTTTGNQQVLVR	3033	sp|Q8TC12|RDH11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9461.11	117.7029	2	1585.8370	1585.8424	K	K	84	98
PSM	AGNASKDEIDSAVK	3034	sp|P23381|SYWC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7547.5	67.1816	3	1403.6923	1403.6892	K	M	28	42
PSM	TTQFSCTLGEK	3035	sp|Q01469|FABP5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	6-UNIMOD:4	ms_run[1]:scan=1.1.9452.4	117.4482	3	1270.5874	1270.5864	K	F	62	73
PSM	KEDALLYQSK	3036	sp|P50402|EMD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8280.4	86.34579	3	1193.6332	1193.6292	K	G	79	89
PSM	QVTQEEGQQLAR	3037	sp|P62070-4|RRAS2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7702.7	71.33768	3	1385.6899	1385.6899	R	Q	142	154
PSM	VVGCSCVVVK	3038	sp|P25398|RS12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	4-UNIMOD:4,6-UNIMOD:4	ms_run[1]:scan=1.1.8239.2	85.28432	3	1105.5610	1105.5624	K	D	103	113
PSM	SSDAFTTQHALR	3039	sp|O95239-2|KIF4A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8618.5	95.30437	3	1332.6265	1332.6422	R	Q	507	519
PSM	SAVTTVVNPK	3040	sp|P05556|ITB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7841.7	74.92198	2	1014.5578	1014.5710	K	Y	785	795
PSM	HLTPEPDIVASTK	3041	sp|Q5JSH3-2|WDR44_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9481.5	118.2316	3	1406.7433	1406.7405	R	K	217	230
PSM	HALHCTILASAGQQR	3042	sp|Q9BT78|CSN4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	5-UNIMOD:4	ms_run[1]:scan=1.1.8603.4	94.90163	4	1661.8429	1661.8420	K	S	228	243
PSM	CATCSQPILDR	3043	sp|Q15654|TRIP6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	1-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=1.1.8543.10	93.3392	2	1319.5930	1319.5962	K	I	339	350
PSM	SQAPGQPGASQWGSR	3044	sp|Q96EP5-2|DAZP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8584.7	94.41803	3	1512.7087	1512.7070	K	V	195	210
PSM	TGVHHYSGNNIELGTACGK	3045	sp|P62888|RL30_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	17-UNIMOD:4	ms_run[1]:scan=1.1.8672.7	96.75764	4	2013.9301	2013.9327	K	Y	69	88
PSM	EHYPNGVCTVYGK	3046	sp|P47755|CAZA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	8-UNIMOD:4	ms_run[1]:scan=1.1.9216.8	111.1813	3	1522.6858	1522.6875	K	K	134	147
PSM	SGQLNLSGR	3047	sp|Q9H9A6|LRC40_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8055.10	80.5401	2	930.4876	930.4883	K	N	38	47
PSM	AIAHYEQSADYYK	3048	sp|P54920|SNAA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9400.7	116.0648	3	1557.7069	1557.7099	K	G	141	154
PSM	RGLQATQLAR	3049	sp|Q8NFU3|TSTD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7760.3	72.82072	3	1112.6467	1112.6414	K	S	84	94
PSM	QGTLHVGDEIR	3050	sp|O14936-2|CSKP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8815.3	100.6043	3	1223.6272	1223.6259	R	E	527	538
PSM	MGPGAASGGERPNLK	3051	sp|Q9H0U4|RAB1B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7805.8	73.9909	3	1440.7132	1440.7143	R	I	173	188
PSM	QQLQALSEPQPR	3052	sp|Q8NBJ4|GOLM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9533.8	119.6339	3	1393.7248	1393.7314	R	L	198	210
PSM	TLGSGACGEVK	3053	sp|O96017-13|CHK2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	7-UNIMOD:4	ms_run[1]:scan=1.1.7377.9	62.61507	2	1077.5230	1077.5125	K	L	4	15
PSM	TGKPEEASLDSR	3054	sp|Q9BY42|RTF2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7178.6	57.39282	3	1288.6297	1288.6259	K	E	225	237
PSM	ATISDEEIER	3055	sp|Q9UQN3|CHM2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8786.10	99.83482	2	1161.5502	1161.5513	K	Q	196	206
PSM	RINNEDNSQFK	3056	sp|Q9UKI8-4|TLK1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7134.9	56.19777	3	1363.6528	1363.6480	K	D	341	352
PSM	HHAAYVNNLNVTEEK	3057	sp|P04179-2|SODM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8675.8	96.8401	4	1737.8153	1737.8434	K	Y	54	69
PSM	YHAASAEEQATIER	3058	sp|Q9Y2R9|RT07_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7933.7	77.32173	3	1574.7325	1574.7325	K	N	126	140
PSM	KDPGVPNSAPFK	3059	sp|Q9BVP2-2|GNL3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.8885.7	102.4488	3	1255.6594	1255.6561	R	E	34	46
PSM	RDGSLHVTCTDQETGK	3060	sp|Q0VDF9|HSP7E_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	9-UNIMOD:4	ms_run[1]:scan=1.1.7276.7	59.973	3	1802.8300	1802.8217	K	C	484	500
PSM	QQNQEITDQLEEEKK	3061	sp|Q08379|GOGA2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9411.8	116.3619	3	1858.8874	1858.8908	K	E	189	204
PSM	QCQISKEDEETLAR	3062	sp|Q69YN2|C19L1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	2-UNIMOD:4	ms_run[1]:scan=1.1.8558.8	93.74028	3	1705.7887	1705.7941	R	R	510	524
PSM	EVAEAATGEDASSPPPK	3063	sp|Q99536-3|VAT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.7427.11	63.9709	2	1654.7588	1654.7686	R	T	6	23
PSM	ERGLGGEVPGSHQGPDPYR	3064	sp|Q6UW68|TM205_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.9402.8	116.1204	4	2006.9581	2006.9559	K	Q	123	142
PSM	CPPGVVPACHNSK	3065	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:385,1-UNIMOD:4,9-UNIMOD:4	ms_run[1]:scan=1.1.9048.11	106.761	2	1405.6252	1404.6272	R	D	634	647
PSM	QGGGGGGGSVPGIER	3066	sp|P52272|HNRPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:28	ms_run[1]:scan=1.1.9442.9	117.1863	2	1266.6024	1266.5948	K	M	389	404
PSM	VVGQTTPESFEK	3067	sp|Q02952|AKA12_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.9126.10	108.8012	2	1321.651047	1320.656146	K	A	1111	1123
PSM	CRDDSFFGETSHNYHK	3068	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	1-UNIMOD:4	ms_run[1]:scan=1.1.9518.8	119.2307	4	1999.822894	1998.827873	R	F	230	246
PSM	RQAVTNPNNTFYATK	3069	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.9048.9	106.7576	3	1724.846771	1723.864182	K	R	107	122
PSM	IQFKPDDGTTPER	3070	sp|Q96AE4|FUBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.8891.6	102.6014	3	1501.720871	1502.736522	R	I	309	322
PSM	ESEPQAAAEPAEAK	3071	sp|P80723|BASP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.7341.11	61.65199	2	1427.665647	1426.657603	K	E	39	53
PSM	LTDCVVMRDPASK	3072	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	4-UNIMOD:4	ms_run[1]:scan=1.1.9408.3	116.2732	3	1491.718871	1490.722135	K	R	47	60
PSM	CYNCGGLDHHAK	3073	sp|Q9H9Z2|LN28A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:385,1-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=1.1.8469.7	91.37733	3	1413.5552	1413.5549	R	E	139	151
PSM	TVYHAEEVQCDGR	3074	sp|Q16527|CSRP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	10-UNIMOD:4	ms_run[1]:scan=1.1.7642.10	69.74827	3	1564.689671	1562.678356	R	S	16	29
PSM	TAVCDIPPR	3075	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	4-UNIMOD:4	ms_run[1]:scan=1.1.8852.6	101.5833	2	1028.508647	1027.512065	K	G	351	360
PSM	TAVCDIPPR	3076	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	4-UNIMOD:4	ms_run[1]:scan=1.1.8659.7	96.40939	2	1028.514847	1027.512065	K	G	351	360
PSM	TAVCDIPPR	3077	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	4-UNIMOD:4	ms_run[1]:scan=1.1.8505.8	92.32867	2	1028.508847	1027.512065	K	G	351	360
PSM	TAVCDIPPR	3078	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	4-UNIMOD:4	ms_run[1]:scan=1.1.8114.7	82.08778	2	1028.507047	1027.512065	K	G	351	360
PSM	TAVCDIPPR	3079	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	4-UNIMOD:4	ms_run[1]:scan=1.1.8134.6	82.59573	2	1028.514447	1027.512065	K	G	351	360
PSM	TAVCDIPPR	3080	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	4-UNIMOD:4	ms_run[1]:scan=1.1.8094.8	81.57693	2	1028.509647	1027.512065	K	G	351	360
PSM	TAVCDIPPR	3081	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	4-UNIMOD:4	ms_run[1]:scan=1.1.8524.6	92.82558	2	1028.513247	1027.512065	K	G	351	360
PSM	TAVCDIPPR	3082	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	4-UNIMOD:4	ms_run[1]:scan=1.1.8582.6	94.36514	2	1028.513247	1027.512065	K	G	351	360
PSM	TAVCDIPPR	3083	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	4-UNIMOD:4	ms_run[1]:scan=1.1.8254.5	85.66676	2	1028.519047	1027.512065	K	G	351	360
PSM	ATETVELHK	3084	sp|P82979|SARNP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:1	ms_run[1]:scan=1.1.8623.10	95.44707	2	1068.5423	1068.5446	M	L	2	11
PSM	QGRPVVICDK	3085	sp|Q06210|GFPT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:28,8-UNIMOD:4	ms_run[1]:scan=1.1.8465.9	91.27275	2	1153.5892	1153.5909	R	E	631	641
PSM	VDNDENEHQLSLR	3086	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.8940.11	103.8839	3	1568.704571	1567.722663	K	T	33	46
PSM	SETAPAETATPAPVEK	3087	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:1	ms_run[1]:scan=1.1.9215.11	111.1597	2	1639.7886	1639.7936	M	S	2	18
PSM	QRPQATAEQIR	3088	sp|Q14157|UBP2L_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:28	ms_run[1]:scan=1.1.7976.11	78.46542	2	1279.6618	1279.6628	K	L	27	38
PSM	KPEDWDERPK	3089	sp|P27824|CALX_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23		ms_run[1]:scan=1.1.7533.7	66.80867	3	1299.6242	1298.6252	R	I	283	293
PSM	ASSLNEDPEGSR	3090	sp|Q9Y530|OARD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:1	ms_run[1]:scan=1.1.9073.11	107.4261	2	1302.5628	1302.5683	M	I	2	14
PSM	SCGLHVTSIK	3091	sp|P17812|PYRG1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	2-UNIMOD:4	ms_run[1]:scan=1.1.8272.4	86.1321	3	1101.571271	1100.564829	K	I	29	39
PSM	LHIVQVVCK	3092	sp|O00299|CLIC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	8-UNIMOD:4	ms_run[1]:scan=1.1.9476.8	118.1022	2	1095.613847	1094.627036	K	K	184	193
PSM	DHASIQMNVAEVDK	3093	sp|P63220|RS21_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	7-UNIMOD:35	ms_run[1]:scan=1.1.8833.8	101.0922	3	1572.727571	1571.724971	K	V	28	42
PSM	QVQQHQGNLDASGPAR	3094	sp|Q96SQ9|CP2S1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:28	ms_run[1]:scan=1.1.8120.8	82.24412	3	1687.8004	1687.8021	R	D	251	267
PSM	SDTSESGAGLTR	3095	sp|Q9UNF1|MAGD2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:1	ms_run[1]:scan=1.1.7937.10	77.43052	2	1221.5473	1221.5468	M	F	2	14
PSM	KQPPVSPGTALVGSQK	3096	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.8777.4	99.58263	4	1593.892494	1592.888606	R	E	31	47
PSM	QAGEVTYADAHK	3097	sp|Q13247|SRSF6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:28	ms_run[1]:scan=1.1.8562.9	93.84937	2	1271.5757	1271.5777	R	E	132	144
PSM	HECQANGPEDLNR	3098	sp|P60981|DEST_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	3-UNIMOD:4	ms_run[1]:scan=1.1.7387.9	62.88502	3	1539.639971	1538.653203	K	A	133	146
PSM	EGNPEEDLTADK	3099	sp|P40121|CAPG_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.8797.11	100.1318	2	1317.571047	1316.573205	K	A	232	244
PSM	AAMAVGGAGGSR	3100	sp|O14744|ANM5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:1	ms_run[1]:scan=1.1.9063.9	107.1587	2	1045.5010	1045.4970	M	V	2	14
PSM	GVEVTVGHEQEEGGK	3101	sp|P0DPI2|GAL3A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.7711.11	71.58601	3	1554.728771	1553.732165	R	W	189	204
PSM	QVHPDTGISSK	3102	sp|Q96A08|H2B1A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:28	ms_run[1]:scan=1.1.7756.7	72.72878	2	1150.5637	1150.5613	K	A	49	60
PSM	AAASGSVLQR	3103	sp|Q5VWZ2|LYPL1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:1	ms_run[1]:scan=1.1.9276.5	112.7611	2	1001.5282	1000.5292	M	C	2	12
PSM	SDKPDMAEIEK	3104	sp|P62328|TYB4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:1,6-UNIMOD:35	ms_run[1]:scan=1.1.7528.11	66.68073	2	1319.5924	1319.5910	M	F	2	13
PSM	LCCPATAPQEAPAPEGR	3105	sp|Q96B54|ZN428_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	2-UNIMOD:4,3-UNIMOD:4	ms_run[1]:scan=1.1.9009.11	105.7188	2	1824.830447	1823.829454	R	A	113	130
PSM	GLGTGQGAVSGPPR	3106	sp|O00255|MEN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.8184.9	83.89235	2	1253.665047	1252.652398	K	K	508	522
PSM	EGDVLTPEQAR	3107	sp|Q9UKD2|MRT4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.8455.7	91.00027	2	1214.589047	1213.593881	K	V	178	189
PSM	EGDVLTPEQAR	3108	sp|Q9UKD2|MRT4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.8474.9	91.51552	2	1214.589047	1213.593881	K	V	178	189
PSM	PADEIAVDR	3109	sp|Q16658|FSCN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.8022.7	79.64775	2	984.488647	984.487624	R	D	159	168
PSM	PGFSIADKK	3110	sp|P62913|RL11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.8181.6	83.81018	2	960.517847	961.523282	R	R	137	146
PSM	AGGPTTPLSPTR	3111	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.8244.8	85.41772	2	1155.612247	1153.609137	R	L	15	27
PSM	QQALTVSTDPEHR	3112	sp|P35606|COPB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.8349.6	88.18365	3	1479.721271	1480.727020	K	F	632	645
PSM	NSNPALNDNLEK	3113	sp|O00299|CLIC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.8508.4	92.40168	3	1329.638771	1327.636808	K	G	120	132
PSM	QNHPEAGEVFVR	3114	sp|Q92793|CBP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.8864.8	101.9064	3	1380.673571	1381.673862	R	V	1349	1361
PSM	SRAEAESMYQIK	3115	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.8900.8	102.8351	3	1413.681971	1411.676564	R	Y	274	286
PSM	GAEAANVTGPGGVPVQGSK	3116	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.8952.6	104.1967	3	1696.862771	1694.858763	K	Y	119	138
PSM	ASGNYATVISHNPETK	3117	sp|P62917|RL8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.9187.11	110.4205	2	1686.809847	1687.816563	R	K	129	145
PSM	EATTDFTVDSR	3118	sp|O75369|FLNB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.9295.10	113.2749	2	1240.555847	1240.557161	R	P	1246	1257
PSM	YPLNCADPTSER	3119	sp|Q06124|PTN11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	5-UNIMOD:4	ms_run[1]:scan=1.1.9353.11	114.8106	2	1420.627247	1421.624529	K	W	100	112
PSM	TLIQNCGASTIR	3120	sp|P49368|TCPG_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	6-UNIMOD:4	ms_run[1]:scan=1.1.9413.6	116.4111	3	1331.688971	1332.681984	R	L	450	462
PSM	PLSHQPGPEAPALPK	3121	sp|P26640|SYVC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.9509.9	118.9903	3	1537.822271	1537.825277	R	T	215	230
PSM	GEIEHHCSGLHR	3122	sp|Q92896|GSLG1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	7-UNIMOD:4	ms_run[1]:scan=1.1.6894.2	49.76645	4	1430.6513	1430.6473	R	K	446	458
PSM	IGKPHTVPCK	3123	sp|P15880|RS2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	9-UNIMOD:4	ms_run[1]:scan=1.1.6808.6	47.46098	3	1135.6210	1135.6172	K	V	174	184
PSM	AAVAGEDGR	3124	sp|P07910-2|HNRPC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.6677.4	43.89755	2	844.4068	844.4039	R	M	65	74
PSM	IAGQVAAANK	3125	sp|P39019|RS19_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.6889.7	49.6579	2	941.5306	941.5294	R	K	134	144
PSM	RPLEDGDQPDAKK	3126	sp|Q96AE4-2|FUBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.6812.10	47.57687	3	1467.7357	1467.7317	K	V	65	78
PSM	RQSPLPPQK	3127	sp|Q01105|SET_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.6927.10	50.6644	2	1049.6002	1049.5982	K	K	5	14
PSM	VHGPGIQSGTTNKPNK	3128	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.6872.10	49.20532	3	1633.8547	1633.8536	R	F	1360	1376
PSM	TATPQQAQEVHEK	3129	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.6909.11	50.17148	2	1465.7184	1465.7161	K	L	213	226
PSM	APGTPHSHTKPYVR	3130	sp|Q07020-2|RL18_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.6898.9	49.87337	3	1546.8028	1546.8005	K	S	126	140
PSM	RHFNAPSHIR	3131	sp|P61254|RL26_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7255.2	59.42633	4	1233.6529	1233.6479	K	R	17	27
PSM	IPVHPNDHVNK	3132	sp|P07954-2|FUMH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7017.2	53.00733	4	1268.6693	1268.6626	K	S	130	141
PSM	LKDELASTK	3133	sp|P51572-2|BAP31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7190.5	57.7179	3	1003.5574	1003.5549	K	Q	258	267
PSM	SEHPPLCGR	3134	sp|Q15393|SF3B3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	7-UNIMOD:4	ms_run[1]:scan=1.1.7108.3	55.47575	3	1051.4908	1051.4869	R	D	1150	1159
PSM	AGALHAQVER	3135	sp|Q9BQG0-2|MBB1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7087.6	54.91918	3	1050.5614	1050.5570	R	L	897	907
PSM	APQHTAVGFK	3136	sp|O43242|PSMD3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7347.3	61.80105	3	1054.5589	1054.5560	K	Q	316	326
PSM	APQHTAVGFK	3137	sp|O43242|PSMD3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7345.3	61.74697	3	1054.5589	1054.5560	K	Q	316	326
PSM	KLLEGEESR	3138	sp|P05787-2|K2C8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7214.4	58.36327	3	1059.5563	1059.5560	R	I	421	430
PSM	KIEHDVVMK	3139	sp|Q9UNZ5|L10K_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7138.3	56.29592	3	1097.5906	1097.5903	K	A	60	69
PSM	LAQAEAAGLHK	3140	sp|Q02880-2|TOP2B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7341.3	61.63865	3	1107.6073	1107.6036	K	V	993	1004
PSM	PHSVSLNDTETRK	3141	sp|Q9P0L0|VAPA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7200.4	57.98943	4	1482.7469	1482.7427	K	L	162	175
PSM	THHNDTELIR	3142	sp|P49915|GUAA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7222.7	58.58358	3	1234.6072	1234.6054	K	K	390	400
PSM	RAPDQAAEIGSR	3143	sp|Q3ZCQ8|TIM50_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7266.4	59.71482	3	1269.6469	1269.6425	R	G	32	44
PSM	FIHDQTSPNPK	3144	sp|P53007|TXTP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7151.4	56.65328	3	1282.6327	1282.6306	K	Y	150	161
PSM	KPSHTSAVSIAGK	3145	sp|Q9HC35|EMAL4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.6967.5	51.73652	3	1281.7069	1281.7041	R	E	92	105
PSM	TGHIAAGTSTNGIK	3146	sp|P20933|ASPG_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7152.6	56.68397	3	1326.6919	1326.6892	K	F	215	229
PSM	RGETESEEFEK	3147	sp|Q05682-4|CALD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7338.7	61.56552	3	1339.5943	1339.5892	R	L	288	299
PSM	RGGSGSHNWGTVK	3148	sp|Q8NC51-3|PAIRB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7202.6	58.04735	3	1341.6565	1341.6538	K	D	216	229
PSM	VGEFSGANK	3149	sp|P10599-2|THIO_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7284.5	60.1766	2	907.4414	907.4399	K	E	66	75
PSM	ECHLNADTVSSK	3150	sp|P63010-2|AP2B1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	2-UNIMOD:4	ms_run[1]:scan=1.1.7327.5	61.28053	3	1359.6148	1359.6089	K	L	870	882
PSM	DQDELKPGPTNR	3151	sp|Q14151|SAFB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7259.7	59.53708	3	1368.6649	1368.6633	K	S	546	558
PSM	GRDVIAQSQSGTGK	3152	sp|P38919|IF4A3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.6987.5	52.2624	3	1402.7173	1402.7165	K	T	75	89
PSM	ESEPQAAAEPAEAK	3153	sp|P80723|BASP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7333.6	61.43643	3	1426.6588	1426.6575	K	E	39	53
PSM	NLRPGDSQTAAQAR	3154	sp|Q8WZA9|IRGQ_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7065.8	54.32908	3	1483.7482	1483.7491	R	D	115	129
PSM	LKDELASTK	3155	sp|P51572-2|BAP31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7188.9	57.67028	2	1003.5556	1003.5549	K	Q	258	267
PSM	LGEGEGSMTK	3156	sp|Q9UNH7|SNX6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7203.6	58.0746	2	1007.4470	1007.4594	K	E	110	120
PSM	EEIQETQTPTHSR	3157	sp|Q9BYG3|MK67I_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7105.10	55.40547	3	1554.7315	1554.7274	K	K	272	285
PSM	TVGVEPAADGK	3158	sp|P46779|RL28_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7223.10	58.61478	2	1042.5302	1042.5295	K	G	48	59
PSM	SEHPPLCGR	3159	sp|Q15393|SF3B3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	7-UNIMOD:4	ms_run[1]:scan=1.1.7110.3	55.53036	3	1051.4908	1051.4869	R	D	1150	1159
PSM	ASGSENEGDYNPGRK	3160	sp|Q02880-2|TOP2B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.6981.10	52.11648	3	1579.6936	1579.6862	K	T	1544	1559
PSM	LEHVVEEEK	3161	sp|P40937-2|RFC5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7159.3	56.87032	3	1110.5620	1110.5557	R	V	165	174
PSM	SEASSSPPVVTSSSHSR	3162	sp|P48431|SOX2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7155.11	56.77447	3	1700.7970	1700.7966	K	A	246	263
PSM	LASCSADGTVR	3163	sp|Q9NRL3-3|STRN4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	4-UNIMOD:4	ms_run[1]:scan=1.1.7111.9	55.56785	2	1135.5312	1135.5292	R	I	566	577
PSM	ANHEEVLAAGK	3164	sp|P00491|PNPH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7188.7	57.66695	3	1137.5821	1137.5778	K	Q	255	266
PSM	AEGYEVAHGGR	3165	sp|P53041|PPP5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7116.11	55.70778	2	1144.5308	1144.5261	K	C	431	442
PSM	RNEIDAEPPAK	3166	sp|Q8TDN6|BRX1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7272.9	59.87758	2	1238.6202	1238.6255	K	R	21	32
PSM	HEGVSCDACLK	3167	sp|Q9P0J7|KCMF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	6-UNIMOD:4,9-UNIMOD:4	ms_run[1]:scan=1.1.7343.11	61.70613	2	1274.5400	1274.5384	R	G	4	15
PSM	QRPQATAEQIR	3168	sp|Q14157-5|UBP2L_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7162.11	56.96512	2	1296.6886	1296.6898	K	L	27	38
PSM	EEDPATGTGDPPR	3169	sp|P45974-2|UBP5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7182.11	57.51053	2	1340.5720	1340.5844	K	K	81	94
PSM	VNGDASPAAAESGAK	3170	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7025.10	53.23722	2	1343.6318	1343.6317	K	E	41	56
PSM	GPAPQDQAGPGGAPR	3171	sp|O96005-4|CLPT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7172.11	57.2373	2	1374.6622	1374.6640	R	V	62	77
PSM	IHNQNNEQAWK	3172	sp|P53701|CCHL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7294.4	60.43398	3	1380.6541	1380.6534	R	E	153	164
PSM	SCCSCCPVGCAK	3173	sp|Q8N339|MT1M_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	2-UNIMOD:4,3-UNIMOD:4,5-UNIMOD:4,6-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.7098.6	55.20848	3	1444.5058	1444.5026	K	C	32	44
PSM	ETYGEMADCCAK	3174	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	6-UNIMOD:35,9-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.7331.8	61.39225	2	1449.5228	1449.5210	R	Q	106	118
PSM	PHSVSLNDTETRK	3175	sp|Q9P0L0|VAPA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7205.11	58.13652	2	1482.7408	1482.7427	K	L	162	175
PSM	LDRETEELHHDR	3176	sp|O60869-3|EDF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7046.9	53.8107	3	1548.7330	1548.7281	K	V	61	73
PSM	NQGGGLSSSGAGEGQGPK	3177	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7125.9	55.95078	3	1586.7313	1586.7285	K	K	992	1010
PSM	SGHFEQAIK	3178	sp|Q01082-2|SPTB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7435.2	64.17207	3	1015.5127	1015.5087	R	E	691	700
PSM	HFELGGDKK	3179	sp|P83881|RL36A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7376.3	62.5781	3	1029.5287	1029.5243	K	R	90	99
PSM	IANPVEGSSGR	3180	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7674.5	70.592	3	1085.5501	1085.5465	K	Q	315	326
PSM	IVDQIRPDR	3181	sp|Q92841-3|DDX17_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7699.5	71.25408	3	1110.6169	1110.6145	K	Q	263	272
PSM	NSLTSKDPDIK	3182	sp|Q14974|IMB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7545.4	67.1262	3	1216.6324	1216.6299	K	A	63	74
PSM	NSLTSKDPDIK	3183	sp|Q14974|IMB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7564.4	67.63772	3	1216.6324	1216.6299	K	A	63	74
PSM	DSDKTDTDWR	3184	sp|P23588-2|IF4B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7606.5	68.7717	3	1237.5235	1237.5211	R	A	152	162
PSM	FNISSHNQSPK	3185	sp|Q9H1A4|APC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7594.5	68.4496	3	1257.6130	1257.6102	R	R	369	380
PSM	TVLDQQQTPSR	3186	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7665.5	70.3578	3	1271.6482	1271.6470	K	L	1129	1140
PSM	ILTTASSHEFEHTKK	3187	sp|Q16851|UGPA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7670.6	70.48994	4	1727.8861	1727.8842	K	D	39	54
PSM	KDDESNLVEEK	3188	sp|Q07866-4|KLC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7459.5	64.82665	3	1304.6176	1304.6096	K	S	58	69
PSM	ECCEKPLLEK	3189	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	2-UNIMOD:4,3-UNIMOD:4	ms_run[1]:scan=1.1.7684.6	70.85381	3	1304.6134	1304.6104	K	S	301	311
PSM	GVTVGEGVR	3190	sp|Q96IJ6-2|GMPPA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7616.5	69.03899	2	872.4730	872.4716	K	L	363	372
PSM	SKAEAESLYQSK	3191	sp|P04264|K2C1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7625.9	69.28851	3	1339.6684	1339.6619	K	Y	365	377
PSM	GSAITGPVAK	3192	sp|P62829|RL23_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7439.4	64.28408	2	899.5096	899.5076	K	E	114	124
PSM	LKGELESSDQVR	3193	sp|Q9P2E9|RRBP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7623.7	69.23122	3	1359.7027	1359.6994	K	E	1184	1196
PSM	LNGHQLENHALK	3194	sp|Q9NZI8|IF2B1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7661.7	70.25557	3	1372.7236	1372.7211	K	V	139	151
PSM	AVELAANTK	3195	sp|P29401-2|TKT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7396.5	63.122	2	915.5048	915.5025	K	G	465	474
PSM	AVELAANTK	3196	sp|P29401-2|TKT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7395.7	63.09823	2	915.5048	915.5025	K	G	465	474
PSM	AVELAANTK	3197	sp|P29401-2|TKT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7388.7	62.90875	2	915.5048	915.5025	K	G	465	474
PSM	AVELAANTK	3198	sp|P29401-2|TKT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7385.9	62.83109	2	915.5048	915.5025	K	G	465	474
PSM	AVELAANTK	3199	sp|P29401-2|TKT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7391.8	62.99158	2	915.5048	915.5025	K	G	465	474
PSM	EHPDPGSKDPEEDYPK	3200	sp|Q9UBL3-3|ASH2L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7660.9	70.232	4	1838.7993	1838.7959	K	F	144	160
PSM	VTDALNATR	3201	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7543.8	67.07912	2	959.5040	959.5036	R	A	421	430
PSM	MGGEEAEIR	3202	sp|Q08211|DHX9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7685.10	70.88723	2	990.4454	990.4440	R	F	930	939
PSM	ATFNPAQDK	3203	sp|O00592-2|PODXL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7646.7	69.85087	2	990.4794	990.4771	K	C	354	363
PSM	HQNVQLPR	3204	sp|P26599-2|PTBP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7555.7	67.40027	2	990.5362	990.5359	K	E	430	438
PSM	NAGFTPQER	3205	sp|P27695|APEX1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7612.10	68.93951	2	1018.4846	1018.4832	K	Q	229	238
PSM	VSGAGFSPSSK	3206	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7578.8	68.02184	2	1022.5040	1022.5033	R	M	1132	1143
PSM	LVEPGSPAEK	3207	sp|O14745|NHRF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7483.9	65.48407	2	1025.5406	1025.5393	R	A	41	51
PSM	HFELGGDKK	3208	sp|P83881|RL36A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7395.3	63.09157	3	1029.5287	1029.5243	K	R	90	99
PSM	SSAEVIAQAR	3209	sp|Q16555-2|DPYL2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7689.4	70.98421	3	1030.5445	1030.5407	K	K	223	233
PSM	EVSSATNALR	3210	sp|P09012|SNRPA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7641.9	69.71975	2	1046.5378	1046.5356	K	S	61	71
PSM	NGAVQTIAQR	3211	sp|P82675|RT05_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7587.10	68.26839	2	1056.5634	1056.5676	K	S	151	161
PSM	QHCCPAGYTCNVK	3212	sp|P28799-3|GRN_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	3-UNIMOD:4,4-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.7416.11	63.67263	3	1593.6517	1593.6487	R	A	299	312
PSM	YISAAPGAEAK	3213	sp|Q14671-2|PUM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7563.8	67.61753	2	1076.5510	1076.5502	R	Y	758	769
PSM	RAYDIAGSTK	3214	sp|P11388-4|TOP2A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7401.8	63.26163	2	1080.5568	1080.5564	R	D	242	252
PSM	IADGYEQAAR	3215	sp|P48643|TCPE_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7687.8	70.93742	2	1092.5196	1092.5200	R	V	133	143
PSM	IADGYEQAAR	3216	sp|P48643|TCPE_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7686.10	70.91395	2	1092.5196	1092.5200	R	V	133	143
PSM	CGDSVYAAEK	3217	sp|Q16527|CSRP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	1-UNIMOD:4	ms_run[1]:scan=1.1.7382.11	62.7536	2	1098.4668	1098.4652	R	I	122	132
PSM	TQLAVCQQR	3218	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	6-UNIMOD:4	ms_run[1]:scan=1.1.7640.10	69.69448	2	1102.5556	1102.5553	K	I	391	400
PSM	VTTADPYASGK	3219	sp|P49406|RM19_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7513.11	66.27887	2	1108.5418	1108.5401	R	I	119	130
PSM	AHGLLAEENR	3220	sp|Q14980-2|NUMA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7667.4	70.40833	3	1108.5670	1108.5625	K	G	1443	1453
PSM	LQDASAEVER	3221	sp|Q10589-2|BST2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7491.10	65.69611	2	1116.5410	1116.5411	K	L	115	125
PSM	LSVADSQAEAK	3222	sp|Q92616|GCN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7573.9	67.88844	2	1117.5616	1117.5615	K	L	499	510
PSM	RLEEPEEPK	3223	sp|O75822-2|EIF3J_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7374.3	62.52425	3	1125.5710	1125.5666	K	V	98	107
PSM	QPVLSQTEAR	3224	sp|P28070|PSB4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7692.10	71.07494	2	1127.5960	1127.5935	K	D	202	212
PSM	KIEQELTAAK	3225	sp|Q9H444|CHM4B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7638.10	69.64063	2	1129.6356	1129.6342	K	K	46	56
PSM	ALHHGIDLEK	3226	sp|P14868|SYDC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7644.11	69.80385	2	1131.6088	1131.6036	R	I	442	452
PSM	EAAEVLQNNR	3227	sp|P61081|UBC12_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7581.9	68.10464	2	1142.5702	1142.5680	K	R	148	158
PSM	MREVCDEVK	3228	sp|P34897-2|GLYM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	5-UNIMOD:4	ms_run[1]:scan=1.1.7397.4	63.14713	3	1164.5287	1164.5267	R	A	227	236
PSM	LVSDGNINSDR	3229	sp|Q01082-2|SPTB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7702.10	71.34268	2	1188.5746	1188.5735	R	I	1235	1246
PSM	DGGFCEVCKK	3230	sp|P07602-2|SAP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	5-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.7626.11	69.31882	2	1198.5122	1198.5111	K	L	407	417
PSM	QVENAGAIGPSR	3231	sp|Q9UHD8|SEPT9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7590.10	68.34938	2	1197.6084	1197.6102	K	F	118	130
PSM	LTVAENEAETK	3232	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7652.11	70.01943	2	1203.5992	1203.5983	K	L	1390	1401
PSM	TECGCQFTSK	3233	sp|Q13618-2|CUL3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	3-UNIMOD:4,5-UNIMOD:4	ms_run[1]:scan=1.1.7379.10	62.67068	2	1216.4842	1216.4853	K	L	436	446
PSM	GHLENNPALEK	3234	sp|P05388-2|RLA0_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7379.6	62.66402	3	1220.6161	1220.6149	R	L	67	78
PSM	HLIPAANTGESK	3235	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7484.11	65.51434	2	1236.6470	1236.6462	K	V	107	119
PSM	YDSYESCDSR	3236	sp|Q9ULX6|AKP8L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	7-UNIMOD:4	ms_run[1]:scan=1.1.7374.10	62.53592	2	1280.4622	1280.4615	R	A	122	132
PSM	EAGVGNGTCAPVR	3237	sp|Q96C86|DCPS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	9-UNIMOD:4	ms_run[1]:scan=1.1.7452.11	64.6472	2	1286.6064	1286.6037	K	L	29	42
PSM	ECCEKPLLEK	3238	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	2-UNIMOD:4,3-UNIMOD:4	ms_run[1]:scan=1.1.7687.10	70.94075	2	1304.6088	1304.6104	K	S	301	311
PSM	NQDLCQQEAVK	3239	sp|Q14554|PDIA5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	5-UNIMOD:4	ms_run[1]:scan=1.1.7503.11	66.01453	2	1331.6102	1331.6140	K	G	461	472
PSM	DDVAPESGDTTVK	3240	sp|O76021|RL1D1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7437.10	64.23975	2	1332.6062	1332.6045	K	K	319	332
PSM	SGAQASSTPLSPTR	3241	sp|P02545-3|LMNA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7647.9	69.88112	2	1358.6804	1358.6790	R	I	12	26
PSM	KGDECELLGHSK	3242	sp|P49411|EFTU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	5-UNIMOD:4	ms_run[1]:scan=1.1.7630.3	69.4133	4	1371.6501	1371.6452	K	N	286	298
PSM	STVNCSTTPVAER	3243	sp|Q99567|NUP88_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	5-UNIMOD:4	ms_run[1]:scan=1.1.7445.11	64.45795	2	1420.6626	1420.6617	K	F	151	164
PSM	RLHGLDEEAEQK	3244	sp|P33991|MCM4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7447.11	64.51178	2	1423.7034	1423.7055	K	L	428	440
PSM	NTENNDVEISETK	3245	sp|Q5UIP0|RIF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7701.10	71.31599	2	1491.6698	1491.6689	K	K	1751	1764
PSM	AQAVSEEEEEEEGK	3246	sp|Q9GZR7|DDX24_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7368.11	62.37798	2	1562.6598	1562.6583	K	S	78	92
PSM	AGFAGDDAPR	3247	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7755.2	72.69167	3	975.4447	975.4410	K	A	19	29
PSM	AGFAGDDAPR	3248	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7733.3	72.15065	3	975.4453	975.4410	K	A	19	29
PSM	ATAFNEQVDK	3249	sp|P27694|RFA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8010.3	79.32626	3	1121.5378	1121.5353	R	F	235	245
PSM	STESLQANVQR	3250	sp|P26373|RL13_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7822.7	74.43722	3	1231.6186	1231.6157	K	L	106	117
PSM	QEYDESGPSIVHRK	3251	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8008.4	79.27552	4	1643.7905	1643.7903	K	C	360	374
PSM	QEPERNECFLQHK	3252	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	8-UNIMOD:4	ms_run[1]:scan=1.1.8085.4	81.33037	4	1713.7913	1713.7893	K	D	118	131
PSM	NCTIVSPDAGGAK	3253	sp|P60891|PRPS1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	2-UNIMOD:4	ms_run[1]:scan=1.1.7930.6	77.24208	3	1288.6102	1288.6082	R	R	164	177
PSM	MGYNACTLHGGK	3254	sp|Q9BUQ8|DDX23_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	6-UNIMOD:4	ms_run[1]:scan=1.1.8039.6	80.10223	3	1307.5798	1307.5751	K	G	687	699
PSM	ERSDALNSAIDK	3255	sp|P35221-2|CTNA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8029.9	79.83862	3	1317.6559	1317.6524	K	M	359	371
PSM	PHSYPALSAEQK	3256	sp|P09972|ALDOC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8048.5	80.34332	3	1326.6637	1326.6568	M	K	2	14
PSM	ADLAAVEAK	3257	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8011.9	79.36253	2	886.4764	886.4760	K	V	3463	3472
PSM	VLDSGAPIK	3258	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8049.8	80.37542	2	898.5142	898.5124	K	I	125	134
PSM	VLDSGAPIK	3259	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8068.6	80.88094	2	898.5140	898.5124	K	I	125	134
PSM	AIMGSGKEDYTGK	3260	sp|P52788|SPSY_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7828.7	74.59077	3	1355.6383	1355.6391	R	D	180	193
PSM	PSETPQAEVGPTGCPHR	3261	sp|P0DN79|CBSL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	14-UNIMOD:4	ms_run[1]:scan=1.1.7877.9	75.86855	4	1818.8341	1818.8319	M	S	2	19
PSM	AAFTECCQAADK	3262	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	6-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=1.1.7921.4	77.00172	3	1370.5603	1370.5595	K	A	187	199
PSM	DHEDYDPQTVR	3263	sp|Q93008-1|USP9X_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7803.6	73.93455	3	1373.5876	1373.5848	R	L	633	644
PSM	LGVTANDVK	3264	sp|P40925-3|MDHC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7945.5	77.63032	2	915.5020	915.5025	K	N	189	198
PSM	AVVGVVAGGGR	3265	sp|P62917|RL8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8005.8	79.2041	2	940.5450	940.5454	R	I	164	175
PSM	AVVGVVAGGGR	3266	sp|P62917|RL8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7985.5	78.6973	2	940.5450	940.5454	R	I	164	175
PSM	EGSLVINSK	3267	sp|Q9Y5B9|SP16H_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7980.10	78.56735	2	945.5140	945.5131	R	N	358	367
PSM	QEYVDYSESAKK	3268	sp|O60832|DKC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8023.9	79.67776	3	1445.6707	1445.6674	K	E	414	426
PSM	YICENQDSISSK	3269	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	3-UNIMOD:4	ms_run[1]:scan=1.1.7856.8	75.31525	3	1442.6386	1442.6347	K	L	287	299
PSM	AGFAGDDAPR	3270	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7857.8	75.33593	2	975.4490	975.4410	K	A	19	29
PSM	GSGTAEVELK	3271	sp|P14618-2|KPYM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7741.4	72.34435	2	989.5028	989.5029	K	K	126	136
PSM	NIGVDNPAAK	3272	sp|P78371|TCPB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7828.10	74.59576	2	997.5220	997.5192	K	V	73	83
PSM	NIGVDNPAAK	3273	sp|P78371|TCPB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7807.7	74.04252	2	997.5202	997.5192	K	V	73	83
PSM	MNEAFGDTK	3274	sp|Q13263-2|TIF1B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7919.7	76.95315	2	1011.4338	1011.4331	R	F	714	723
PSM	LEEGLVNNK	3275	sp|Q8NI36|WDR36_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8016.7	79.48843	2	1014.5336	1014.5345	K	Y	831	840
PSM	LLVSASQDGK	3276	sp|P62873-2|GBB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7891.10	76.2353	2	1016.5506	1016.5502	R	L	69	79
PSM	DCAVIVTQK	3277	sp|P60900|PSA6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	2-UNIMOD:4	ms_run[1]:scan=1.1.7885.9	76.07872	2	1032.5284	1032.5274	K	K	46	55
PSM	YESLTDPSK	3278	sp|P07900-2|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8062.9	80.7266	2	1038.4890	1038.4869	R	L	183	192
PSM	NGSLICTASK	3279	sp|Q9ULV4-3|COR1C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	6-UNIMOD:4	ms_run[1]:scan=1.1.7859.7	75.3858	2	1049.5180	1049.5175	R	D	238	248
PSM	EATNPPVIQEEKPK	3280	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7984.11	78.67177	3	1578.8260	1578.8253	R	K	483	497
PSM	EGELTVAQGR	3281	sp|Q03252|LMNB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7912.8	76.77063	2	1058.5364	1058.5356	R	V	139	149
PSM	NMMAACDPR	3282	sp|Q9BVA1|TBB2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	6-UNIMOD:4	ms_run[1]:scan=1.1.8006.10	79.23344	2	1064.4204	1064.4201	K	H	298	307
PSM	QIPQATASMK	3283	sp|O43175|SERA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7993.9	78.89815	2	1073.5540	1073.5539	R	D	120	130
PSM	QIPQATASMK	3284	sp|O43175|SERA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7973.8	78.38206	2	1073.5560	1073.5539	R	D	120	130
PSM	LTQIQESQVTSHNK	3285	sp|Q92541|RTF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7850.7	75.15297	3	1611.8251	1611.8216	K	E	252	266
PSM	SSGHSSSELSPDAVEK	3286	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7805.10	73.99423	3	1615.7323	1615.7325	R	A	1378	1394
PSM	RPANQFVPR	3287	sp|P67870|CSK2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7742.7	72.37493	2	1083.5954	1083.5938	K	L	178	187
PSM	ENAEQGEVDMESHR	3288	sp|P14209-3|CD99_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7916.10	76.8779	3	1629.6715	1629.6689	K	N	141	155
PSM	SGAVTFSSQGR	3289	sp|O75717|WDHD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7898.10	76.41485	2	1095.5316	1095.5309	K	V	900	911
PSM	LDSSETTMVK	3290	sp|Q9UBE0|SAE1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7992.11	78.87595	2	1109.5294	1109.5274	K	K	199	209
PSM	GAVAEDGDELR	3291	sp|P27695|APEX1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7913.7	76.79463	2	1130.5208	1130.5204	K	T	8	19
PSM	VGSVLQEGCGK	3292	sp|P31040-2|SDHA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	9-UNIMOD:4	ms_run[1]:scan=1.1.7892.7	76.2561	2	1132.5558	1132.5547	R	I	480	491
PSM	VTLTSEEEAR	3293	sp|P00338-3|LDHA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8060.10	80.67458	2	1133.5576	1133.5564	K	L	335	345
PSM	CCTESLVNR	3294	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	1-UNIMOD:4,2-UNIMOD:4	ms_run[1]:scan=1.1.7842.11	74.9541	2	1137.4924	1137.4907	K	R	500	509
PSM	YLSEVASGDNK	3295	sp|P31946-2|1433B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7859.9	75.38913	2	1181.5530	1181.5564	R	Q	128	139
PSM	GGAVVDEGPTGVK	3296	sp|O15427|MOT4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7934.10	77.35262	2	1184.6052	1184.6037	M	A	2	15
PSM	AAQEQVLNASR	3297	sp|Q99543|DNJC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7774.9	73.19254	2	1185.6112	1185.6102	K	A	608	619
PSM	HQVEQLSSSLK	3298	sp|Q14980-2|NUMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8079.6	81.17312	3	1254.6595	1254.6568	R	Q	551	562
PSM	SYSSGGEDGYVR	3299	sp|Q13347|EIF3I_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8061.10	80.7013	2	1275.5376	1275.5368	K	I	299	311
PSM	SYSSGGEDGYVR	3300	sp|Q13347|EIF3I_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8042.11	80.19141	2	1275.5376	1275.5368	K	I	299	311
PSM	MDSTEPPYSQK	3301	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7735.9	72.21195	2	1281.5566	1281.5547	K	R	155	166
PSM	RVLIAAHGNSLR	3302	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7884.5	76.04613	3	1305.7660	1305.7629	K	G	180	192
PSM	TLGTPTQPGSTPR	3303	sp|Q8NFH5-2|NUP35_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7846.10	75.05468	2	1311.6786	1311.6783	K	I	253	266
PSM	DEFTNTCPSDK	3304	sp|Q9Y696|CLIC4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	7-UNIMOD:4	ms_run[1]:scan=1.1.7906.10	76.62083	2	1312.5250	1312.5242	R	E	228	239
PSM	TNTLAVTGGEDDK	3305	sp|Q13685|AAMP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7897.10	76.38913	2	1319.6194	1319.6205	K	A	103	116
PSM	ANEGTVGVSAATER	3306	sp|P05186|PPBT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7899.11	76.44238	2	1360.6600	1360.6583	K	S	123	137
PSM	ISQTYQQQYGR	3307	sp|P09525-2|ANXA4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8077.11	81.12801	2	1370.6570	1370.6579	R	S	42	53
PSM	AAFTECCQAADK	3308	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	6-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=1.1.7933.11	77.3284	2	1370.5594	1370.5595	K	A	187	199
PSM	KGEDVLGSVR	3309	sp|P56192|SYMC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8462.2	91.18018	3	1058.5756	1058.5720	K	R	109	119
PSM	KWPQQVVQK	3310	sp|P52926|HMGA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8353.3	88.28505	3	1139.6485	1139.6451	R	K	82	91
PSM	KWPQQVVQK	3311	sp|P52926|HMGA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8373.2	88.81886	3	1139.6467	1139.6451	R	K	82	91
PSM	VEDVEALDRK	3312	sp|P11216|PYGB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8267.5	86.00101	3	1172.6059	1172.6037	R	G	716	726
PSM	KEDALLYQSK	3313	sp|P50402|EMD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8257.4	85.74184	3	1193.6332	1193.6292	K	G	79	89
PSM	DLEAHIDSANK	3314	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8283.3	86.42425	3	1211.5822	1211.5782	K	N	1621	1632
PSM	FACHSASLTVR	3315	sp|Q15233-2|NONO_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	3-UNIMOD:4	ms_run[1]:scan=1.1.8436.5	90.48683	3	1247.6110	1247.6081	R	N	54	65
PSM	ASGTNDKPGGPHYILR	3316	sp|P30038-2|AL4A1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8259.2	85.78963	4	1681.8545	1681.8536	R	W	465	481
PSM	TAIHEVMEQGR	3317	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8421.6	90.0864	3	1269.6172	1269.6136	R	V	420	431
PSM	RALASFNQEER	3318	sp|Q8N5F7|NKAP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8312.6	87.20302	3	1319.6602	1319.6582	K	R	380	391
PSM	ETAENYLGHTAK	3319	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8415.3	89.92465	3	1332.6346	1332.6310	K	N	176	188
PSM	TALGDIGNK	3320	sp|P14635-2|CCNB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8298.7	86.83078	2	887.4708	887.4712	R	V	43	52
PSM	QESGSEIHVEVK	3321	sp|P46013|KI67_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8174.3	83.61951	3	1340.6563	1340.6572	K	A	561	573
PSM	EAPPMEKPEVVK	3322	sp|P62841|RS15_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8366.4	88.63438	3	1352.7019	1352.7010	K	T	66	78
PSM	QLQLEAEEQRK	3323	sp|Q8N1G4|LRC47_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8304.6	86.99022	3	1370.7154	1370.7153	R	Q	415	426
PSM	AINAALAQR	3324	sp|P52657|T2AG_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8169.7	83.49525	2	926.5286	926.5297	K	V	43	52
PSM	CAADLGLNK	3325	sp|P49773|HINT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	1-UNIMOD:4	ms_run[1]:scan=1.1.8332.6	87.73552	2	960.4692	960.4698	K	G	84	93
PSM	NSVEVALNK	3326	sp|P54577|SYYC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8370.8	88.7484	2	972.5230	972.5240	K	L	311	320
PSM	FLSSAAAVSK	3327	sp|P27708|PYR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8472.7	91.45825	2	979.5342	979.5338	R	E	1110	1120
PSM	FANLPNNAK	3328	sp|Q9BZE9-2|ASPC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8453.10	90.95155	2	987.5144	987.5137	R	L	67	76
PSM	ALCGLDESK	3329	sp|P36776|LONM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	3-UNIMOD:4	ms_run[1]:scan=1.1.8201.5	84.31924	2	991.4710	991.4644	R	A	680	689
PSM	GEFKDEEETVTTK	3330	sp|Q14677-2|EPN4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8455.6	90.9986	3	1511.6986	1511.6991	K	H	230	243
PSM	MADLHAVPR	3331	sp|Q14195-2|DPYL3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8402.2	89.58802	3	1008.5194	1008.5175	K	G	602	611
PSM	GGEIQPVSVK	3332	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8223.6	84.88143	2	1012.5550	1012.5553	K	V	57	67
PSM	IVADQLCAK	3333	sp|P53990-2|IST1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	7-UNIMOD:4	ms_run[1]:scan=1.1.8475.7	91.53892	2	1016.5304	1016.5325	K	Y	119	128
PSM	IVADQLCAK	3334	sp|P53990-2|IST1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	7-UNIMOD:4	ms_run[1]:scan=1.1.8473.9	91.48853	2	1016.5304	1016.5325	K	Y	119	128
PSM	TAVCDIPPR	3335	sp|Q9BVA1|TBB2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	4-UNIMOD:4	ms_run[1]:scan=1.1.8274.8	86.19207	2	1027.5112	1027.5121	K	G	351	360
PSM	YRPGTVALR	3336	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8171.4	83.54234	3	1031.5912	1031.5876	R	E	42	51
PSM	YRPGTVALR	3337	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8111.2	82.00295	3	1031.5912	1031.5876	R	E	42	51
PSM	YRPGTVALR	3338	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8151.2	83.02341	3	1031.5912	1031.5876	R	E	42	51
PSM	YRPGTVALR	3339	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8131.3	82.51418	3	1031.5912	1031.5876	R	E	42	51
PSM	YRPGTVALR	3340	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8091.4	81.49115	3	1031.5924	1031.5876	R	E	42	51
PSM	AATAAADFTAK	3341	sp|Q9Y3F4-2|STRAP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8097.8	81.65968	2	1036.5190	1036.5189	K	V	87	98
PSM	TLGQAEALDK	3342	sp|P27144|KAD4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8359.8	88.45368	2	1044.5428	1044.5451	R	I	93	103
PSM	VIDDTNITR	3343	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8174.6	83.62452	2	1045.5406	1045.5404	K	L	188	197
PSM	SINQQSGAHVELQR	3344	sp|Q96I24|FUBP3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8114.8	82.09112	3	1565.7934	1565.7910	K	N	379	393
PSM	DLTTGYDDSQPDKK	3345	sp|Q96G03|PGM2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8273.8	86.1654	3	1581.7162	1581.7159	R	A	520	534
PSM	LVNTINPGAR	3346	sp|Q92900-2|RENT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8344.10	88.05765	2	1053.5942	1053.5931	K	F	919	929
PSM	TGYGGGFNER	3347	sp|O95218-2|ZRAB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8384.7	89.1219	2	1056.4634	1056.4625	R	E	100	110
PSM	TGYGGGFNER	3348	sp|O95218-2|ZRAB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8365.8	88.6142	2	1056.4634	1056.4625	R	E	100	110
PSM	YLAEVASGEK	3349	sp|Q04917|1433F_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8331.9	87.71373	2	1065.5342	1065.5342	R	K	133	143
PSM	LGEYEDVSR	3350	sp|Q99426-2|TBCB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8462.8	91.19019	2	1066.4940	1066.4931	R	V	44	53
PSM	QDEQVGLPGK	3351	sp|P11388-4|TOP2A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8281.10	86.38243	2	1069.5388	1069.5404	K	G	1268	1278
PSM	AESQLLECK	3352	sp|P12270|TPR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	8-UNIMOD:4	ms_run[1]:scan=1.1.8469.10	91.38233	2	1076.5178	1076.5172	K	A	1120	1129
PSM	AQYEDIANR	3353	sp|P05787-2|K2C8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8280.8	86.35245	2	1078.5038	1078.5043	K	S	293	302
PSM	VVGCSCVVVK	3354	sp|P25398|RS12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	4-UNIMOD:4,6-UNIMOD:4	ms_run[1]:scan=1.1.8216.7	84.70834	2	1105.5606	1105.5624	K	D	103	113
PSM	FGTDLNQGEK	3355	sp|Q9NRL3-3|STRN4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8278.8	86.29895	2	1107.5206	1107.5197	K	K	137	147
PSM	DNQLSEVANK	3356	sp|Q14978-2|NOLC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8119.3	82.21525	3	1116.5440	1116.5411	R	F	24	34
PSM	LASAAYPDPSK	3357	sp|P54577|SYYC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8237.7	85.24523	2	1118.5604	1118.5608	K	Q	336	347
PSM	GMGPGTPAGYGR	3358	sp|P23246|SFPQ_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8465.8	91.27108	2	1119.5108	1119.5131	R	G	682	694
PSM	EADYVAQATR	3359	sp|Q9NRV9|HEBP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8273.10	86.16873	2	1122.5340	1122.5305	K	L	141	151
PSM	AGGPATPLSPTR	3360	sp|Q03252|LMNB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8188.11	83.99796	2	1123.5976	1123.5986	R	L	29	41
PSM	AESAVIVANPR	3361	sp|Q9NQC3-4|RTN4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8363.9	88.56235	2	1125.6118	1125.6142	K	E	78	89
PSM	TPGSPGNLQVR	3362	sp|Q9NXS2-3|QPCTL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8290.9	86.62148	2	1124.5910	1124.5938	R	K	106	117
PSM	CGFCHVGEEENEAR	3363	sp|Q8IWS0-3|PHF6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	1-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=1.1.8359.9	88.45535	3	1692.6601	1692.6620	K	G	211	225
PSM	ELADESQTLK	3364	sp|Q9UNZ2-5|NSF1C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8186.9	83.94344	2	1132.5610	1132.5612	K	E	349	359
PSM	VLIAAHGNSLR	3365	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8378.8	88.96325	2	1149.6600	1149.6618	R	G	181	192
PSM	VYDEVVDTSK	3366	sp|Q86V21|AACS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8430.9	90.3322	2	1153.5514	1153.5503	R	G	76	86
PSM	HWDHLTQVK	3367	sp|P30084|ECHM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8281.3	86.37077	3	1162.5913	1162.5883	K	K	119	128
PSM	HWDHLTQVK	3368	sp|P30084|ECHM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8280.2	86.34245	3	1162.5913	1162.5883	K	K	119	128
PSM	VTTINQEIQK	3369	sp|Q9BZD4|NUF2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8419.11	90.04202	2	1172.6362	1172.6401	R	I	391	401
PSM	REDVNAWER	3370	sp|Q9UDR5|AASS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8428.11	90.282	2	1173.5504	1173.5527	R	R	30	39
PSM	EESESTAVGQAHSDISK	3371	sp|Q02952-2|AKA12_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8275.11	86.22375	3	1773.7999	1773.8017	K	D	1518	1535
PSM	RFPGYDSESK	3372	sp|P46777|RL5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8130.10	82.50034	2	1184.5462	1184.5462	K	E	179	189
PSM	TEYLSNADER	3373	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8147.11	82.93571	2	1196.5306	1196.5309	R	L	3550	3560
PSM	NDQCYDDIR	3374	sp|Q9ULV4-3|COR1C_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	4-UNIMOD:4	ms_run[1]:scan=1.1.8363.10	88.56402	2	1197.4702	1197.4720	K	V	73	82
PSM	SGTVDPQELQK	3375	sp|P30626-2|SORCN_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8151.9	83.03508	2	1200.5970	1200.5986	R	A	102	113
PSM	AYTGFSSNSER	3376	sp|O15355|PPM1G_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8159.10	83.24245	2	1217.5300	1217.5313	K	G	210	221
PSM	SSTTVSSFANSK	3377	sp|Q13620-1|CUL4B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8158.10	83.21685	2	1214.5774	1214.5779	K	P	161	173
PSM	VEIIANDQGNR	3378	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8203.9	84.38015	2	1227.6200	1227.6207	R	I	50	61
PSM	QHLEITGGQVR	3379	sp|P47897-2|SYQ_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8367.3	88.65965	3	1236.6607	1236.6575	K	T	244	255
PSM	QHLEITGGQVR	3380	sp|P47897-2|SYQ_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8368.5	88.68974	3	1236.6607	1236.6575	K	T	244	255
PSM	DHPLPEVAHVK	3381	sp|P13073|COX41_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8308.10	87.104	2	1240.6554	1240.6564	R	H	43	54
PSM	QEGGDNDLIER	3382	sp|P30566|PUR8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8347.9	88.1355	2	1244.5610	1244.5633	K	I	416	427
PSM	SLLEGEGSSGGGGR	3383	sp|P13645|K1C10_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8170.11	83.528	2	1261.5876	1261.5899	R	G	451	465
PSM	DRDSQITAIEK	3384	sp|Q8N7H5-2|PAF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8319.9	87.3943	2	1274.6426	1274.6466	K	T	161	172
PSM	TIIQNPTDQQK	3385	sp|Q9UQ80|PA2G4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8281.11	86.3841	2	1284.6656	1284.6674	K	K	200	211
PSM	INISEGNCPER	3386	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	8-UNIMOD:4	ms_run[1]:scan=1.1.8319.10	87.39597	2	1287.5854	1287.5877	R	I	47	58
PSM	GVDLQENNPASR	3387	sp|P51148-2|RAB5C_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8341.11	87.98043	2	1298.6182	1298.6215	R	S	232	244
PSM	VVETELQEGATK	3388	sp|Q8NFC6|BD1L1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8369.11	88.72645	2	1302.6512	1302.6667	K	Q	923	935
PSM	SQLLGSAHEVQR	3389	sp|Q13813|SPTN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8116.6	82.13713	3	1323.6907	1323.6895	R	F	1226	1238
PSM	EQSGPSPLEETR	3390	sp|Q9NY26-2|S39A1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8273.11	86.1704	2	1328.6210	1328.6208	K	A	33	45
PSM	NNASTDYDLSDK	3391	sp|P39023|RL3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8359.10	88.45702	2	1341.5662	1341.5684	K	S	301	313
PSM	IRVDVADQAQDK	3392	sp|P23588-2|IF4B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8353.10	88.2967	2	1356.7004	1356.6997	R	D	127	139
PSM	FNEADSEVAQAGK	3393	sp|Q9UPN9-2|TRI33_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8359.11	88.45869	2	1364.6178	1364.6208	R	A	1038	1051
PSM	SPVESTTEPPAVR	3394	sp|P53992|SC24C_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8319.11	87.39764	2	1368.6888	1368.6885	K	A	957	970
PSM	ADGGAEYATYQTK	3395	sp|P15529-5|MCP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8168.10	83.47438	2	1373.6112	1373.6099	K	S	364	377
PSM	NPATTNQTEFER	3396	sp|P50750-2|CDK9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8096.11	81.63395	2	1406.6440	1406.6426	R	V	476	488
PSM	EEPVSSGPEEAVGK	3397	sp|O00567|NOP56_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8151.10	83.03675	2	1413.6672	1413.6623	K	S	565	579
PSM	DPSASPGDAGEQAIR	3398	sp|P18206|VINC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8436.11	90.49683	2	1469.6716	1469.6746	R	Q	286	301
PSM	RDPHLACVAYER	3399	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	7-UNIMOD:4	ms_run[1]:scan=1.1.8621.3	95.3817	4	1485.7209	1485.7147	K	G	912	924
PSM	GHQFSCVCLHGDR	3400	sp|Q92499-3|DDX1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	6-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.8630.6	95.62846	4	1571.6773	1571.6722	K	K	409	422
PSM	AAHLCAEAALR	3401	sp|Q9UQ80|PA2G4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	5-UNIMOD:4	ms_run[1]:scan=1.1.8555.4	93.65255	3	1181.6017	1181.5975	K	L	145	156
PSM	TLEQHDNIVTHYK	3402	sp|O60763-2|USO1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8542.5	93.30372	4	1596.7941	1596.7896	K	N	655	668
PSM	VEPHATIAEIK	3403	sp|Q9NZ01|TECR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8793.5	100.0145	3	1206.6616	1206.6608	K	N	23	34
PSM	ASIHEAWTDGK	3404	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8748.2	98.79652	3	1213.5760	1213.5727	K	E	422	433
PSM	GKLDGNQDLIR	3405	sp|P48735|IDHP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8741.6	98.61404	3	1227.6598	1227.6571	R	F	383	394
PSM	NNTQVLINCR	3406	sp|P62316|SMD2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	9-UNIMOD:4	ms_run[1]:scan=1.1.8796.5	100.0949	3	1230.6163	1230.6139	K	N	38	48
PSM	DGNLASTLGQHK	3407	sp|Q9BZK7|TBL1R_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8802.4	100.2551	3	1239.6208	1239.6208	K	G	255	267
PSM	GTVIIIANHGDR	3408	sp|Q16851|UGPA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8827.6	100.9322	3	1264.6879	1264.6888	K	I	474	486
PSM	VCALLSCTSHK	3409	sp|P15121|ALDR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	2-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=1.1.8584.5	94.4147	3	1274.6134	1274.6111	R	D	298	309
PSM	VCALLSCTSHK	3410	sp|P15121|ALDR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	2-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=1.1.8604.7	94.93287	3	1274.6134	1274.6111	R	D	298	309
PSM	AGVAPLQVK	3411	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8695.4	97.37327	2	881.5328	881.5334	K	V	1478	1487
PSM	AGVAPLQVK	3412	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8724.5	98.154	2	881.5330	881.5334	K	V	1478	1487
PSM	QGNLSSQVPLKR	3413	sp|P78527|PRKDC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8541.5	93.27705	3	1325.7445	1325.7415	K	L	3148	3160
PSM	GSVHSVSFSPDGR	3414	sp|Q15269|PWP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8827.7	100.9339	3	1330.6306	1330.6266	K	K	97	110
PSM	EKYEAIVEENK	3415	sp|Q99417|MYCBP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8816.6	100.6365	3	1350.6694	1350.6667	K	K	74	85
PSM	ATISALEAK	3416	sp|P35580-3|MYH10_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8728.5	98.26192	2	902.5082	902.5073	K	I	1835	1844
PSM	SEPIPESNDGPVK	3417	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8590.5	94.56831	3	1367.6590	1367.6569	K	V	367	380
PSM	KGPSTVTDLEDTK	3418	sp|O94973-2|AP2A2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8569.6	94.03133	3	1389.6922	1389.6987	K	R	620	633
PSM	ISVYYNEASSHK	3419	sp|Q13509|TBB3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8748.7	98.80485	3	1396.6630	1396.6623	R	Y	47	59
PSM	CESAFLSK	3420	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	1-UNIMOD:4	ms_run[1]:scan=1.1.8581.5	94.34116	2	940.4322	940.4324	K	R	36	44
PSM	VPPPPPIAR	3421	sp|P07910-2|HNRPC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8567.2	93.97166	3	942.5707	942.5651	R	A	130	139
PSM	LLGGHNEDLPSNR	3422	sp|Q9BRD0|BUD13_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8623.6	95.4404	3	1420.7071	1420.7059	K	H	105	118
PSM	LLTEIHGGAGGPSGR	3423	sp|Q16763|UBE2S_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8662.9	96.49243	3	1420.7428	1420.7423	R	A	150	165
PSM	SGTSEFLNK	3424	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8574.10	94.1668	2	981.4760	981.4767	K	M	169	178
PSM	IEANEALVK	3425	sp|P30049|ATPD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8597.7	94.75075	2	985.5428	985.5444	R	A	157	166
PSM	SAINEVVTR	3426	sp|P62899|RL31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8682.7	97.02742	2	987.5348	987.5349	R	E	15	24
PSM	YGINTDPPK	3427	sp|Q9Y3B4|SF3B6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8482.8	91.7275	2	1003.5010	1003.4975	K	-	117	126
PSM	NCLALADDK	3428	sp|O75367-3|H2AY_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	2-UNIMOD:4	ms_run[1]:scan=1.1.8591.5	94.59386	2	1018.4750	1018.4753	K	K	295	304
PSM	IICQGFTGK	3429	sp|P53597|SUCA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	3-UNIMOD:4	ms_run[1]:scan=1.1.8713.8	97.86377	2	1022.5188	1022.5219	K	Q	58	67
PSM	TAVCDIPPR	3430	sp|Q9BVA1|TBB2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	4-UNIMOD:4	ms_run[1]:scan=1.1.8697.9	97.43562	2	1027.5120	1027.5121	K	G	351	360
PSM	TAVCDIPPR	3431	sp|Q9BVA1|TBB2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	4-UNIMOD:4	ms_run[1]:scan=1.1.8813.7	100.5568	2	1027.5240	1027.5121	K	G	351	360
PSM	AEELLAEEK	3432	sp|O00429-2|DNM1L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8745.5	98.72054	2	1030.5186	1030.5182	K	S	587	596
PSM	PGQEAPVLPK	3433	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8584.9	94.42136	2	1034.5768	1034.5760	K	D	367	377
PSM	PDYLGADQR	3434	sp|P35998|PRS7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8583.8	94.39412	2	1033.4836	1033.4829	M	K	2	11
PSM	AGIQQVYTR	3435	sp|Q13616|CUL1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8680.9	96.97677	2	1034.5504	1034.5509	R	Q	26	35
PSM	AELDDTPMR	3436	sp|P23246|SFPQ_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8681.10	97.00547	2	1046.4710	1046.4702	K	G	350	359
PSM	SEVATLTAAGK	3437	sp|P36542-2|ATPG_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8517.8	92.64555	2	1046.5602	1046.5608	K	E	116	127
PSM	DCGSVDGVIK	3438	sp|P61916|NPC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	2-UNIMOD:4	ms_run[1]:scan=1.1.8719.7	98.0223	2	1048.4832	1048.4859	K	E	26	36
PSM	LIENVDPEK	3439	sp|Q99747|SNAG_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8793.8	100.0195	2	1055.5494	1055.5499	K	A	124	133
PSM	IAQITGPPDR	3440	sp|Q96AE4-2|FUBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8581.6	94.3445	2	1066.5760	1066.5771	R	C	321	331
PSM	DGGFCEVCK	3441	sp|P07602-2|SAP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	5-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.8779.9	99.64485	2	1070.4126	1070.4161	K	K	407	416
PSM	SVEAAAELSAK	3442	sp|P20962|PTMS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8551.7	93.54967	2	1074.5548	1074.5557	K	D	5	16
PSM	HVVLGAIENK	3443	sp|P41227-2|NAA10_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8557.9	93.71495	2	1078.6118	1078.6135	R	V	155	165
PSM	RFCCQSCVSEYK	3444	sp|Q9UBW7|ZMYM2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	3-UNIMOD:4,4-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=1.1.8551.8	93.55133	3	1622.6662	1622.6640	K	Q	492	504
PSM	VCNLIDSGTK	3445	sp|Q02252-2|MMSA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	2-UNIMOD:4	ms_run[1]:scan=1.1.8687.9	97.16582	2	1105.5406	1105.5438	R	E	354	364
PSM	EGNGPVTQWK	3446	sp|Q9Y657|SPIN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8820.7	100.7458	2	1114.5402	1114.5407	K	G	64	74
PSM	VNEVNQFAAK	3447	sp|Q13813|SPTN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8546.9	93.41824	2	1118.5666	1118.5720	R	L	205	215
PSM	ESSSESFISR	3448	sp|Q9P2R3-4|ANFY1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8721.10	98.08138	2	1127.5078	1127.5095	K	L	86	96
PSM	QAPDNEITIK	3449	sp|Q9NX58|LYAR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8756.7	99.02122	2	1127.5770	1127.5822	K	K	321	331
PSM	IGAEVYHNLK	3450	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8757.3	99.0415	3	1142.6104	1142.6084	R	N	184	194
PSM	IGAEVYHNLK	3451	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8776.4	99.55575	3	1142.6104	1142.6084	R	N	184	194
PSM	QLIVANAGDSR	3452	sp|O15355|PPM1G_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8512.10	92.51746	2	1142.6020	1142.6044	K	C	340	351
PSM	GGNRPNTGPLYTEADR	3453	sp|Q9HAU0-6|PKHA5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8709.8	97.75757	3	1716.8149	1716.8179	R	V	394	410
PSM	TAIEEVQAER	3454	sp|Q32P28|P3H1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8649.8	96.14297	2	1144.5746	1144.5724	R	K	570	580
PSM	YIDQEELNK	3455	sp|P07900-2|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8511.10	92.49107	2	1150.5512	1150.5506	K	T	406	415
PSM	YIDQEELNK	3456	sp|P07900-2|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8531.10	93.01777	2	1150.5512	1150.5506	K	T	406	415
PSM	GVTIKPTVDDD	3457	sp|P41091|IF2G_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8767.8	99.31982	2	1158.5742	1158.5769	R	-	462	473
PSM	TTGEVVSGVVSK	3458	sp|Q14008-3|CKAP5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8479.9	91.64867	2	1161.6234	1161.6241	K	V	85	97
PSM	CNTNTAIELK	3459	sp|O14929|HAT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	1-UNIMOD:4	ms_run[1]:scan=1.1.8577.8	94.24548	2	1162.5638	1162.5652	K	L	27	37
PSM	CNTNTAIELK	3460	sp|O14929|HAT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	1-UNIMOD:4	ms_run[1]:scan=1.1.8558.9	93.74195	2	1162.5638	1162.5652	K	L	27	37
PSM	NANAVMEYEK	3461	sp|Q99615|DNJC7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8708.9	97.73241	2	1167.5188	1167.5230	K	I	138	148
PSM	LAETMNNIDR	3462	sp|Q5T0N5-2|FBP1L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8795.10	100.0764	2	1175.5594	1175.5604	K	L	446	456
PSM	SLKDEDVLQK	3463	sp|Q9NZ01|TECR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8499.7	92.16853	2	1173.6246	1173.6241	K	L	58	68
PSM	SEMTPEELQK	3464	sp|P62316|SMD2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8773.8	99.48145	2	1190.5508	1190.5489	K	R	9	19
PSM	LAPEYEAAATR	3465	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8708.10	97.73409	2	1190.5916	1190.5931	R	L	63	74
PSM	EATDAIGHLDR	3466	sp|Q12906-7|ILF3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8800.3	100.1992	3	1196.5798	1196.5786	K	Q	298	309
PSM	QEATLVVGGDGR	3467	sp|P36871|PGM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8710.10	97.78748	2	1200.6026	1200.6099	R	F	53	65
PSM	NDQCYEDIR	3468	sp|Q9BR76|COR1B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	4-UNIMOD:4	ms_run[1]:scan=1.1.8640.9	95.90224	2	1211.4864	1211.4877	K	V	22	31
PSM	VNWATTPSSQK	3469	sp|Q01085-2|TIAR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8741.11	98.62237	2	1217.6014	1217.6040	K	K	97	108
PSM	ALGICCAGTGNK	3470	sp|Q99460|PSMD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1000663, ProteinPilot, ]	22	5-UNIMOD:4,6-UNIMOD:4	ms_run[1]:scan=1.1.8565.10	93.93166	2	1220.5604470956603	1220.56417786206	M	E	655	667
PSM	LTTTGQVTSPVK	3471	sp|P49916-3|DNLI3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8520.10	92.72757	2	1230.6798	1230.6820	K	G	115	127
PSM	VYVGNLGNNGNK	3472	sp|P84103|SRSF3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8504.9	92.30372	2	1247.6242	1247.6258	K	T	12	24
PSM	IDEPLEGSEDR	3473	sp|P61978-2|HNRPK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8831.9	101.0419	2	1258.5660	1258.5677	K	I	423	434
PSM	LDQPVSAPPSPR	3474	sp|Q16204|CCDC6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8671.11	96.73782	2	1262.6590	1262.6619	K	D	235	247
PSM	LVNSQCEFER	3475	sp|Q9NPI1-2|BRD7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	6-UNIMOD:4	ms_run[1]:scan=1.1.8765.11	99.27103	2	1280.5812	1280.5819	R	R	333	343
PSM	AISGLEQDQPAR	3476	sp|O75312|ZPR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8619.11	95.34123	2	1283.6452	1283.6470	R	R	153	165
PSM	MDSTANEVEAVK	3477	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8530.11	92.99287	2	1292.5898	1292.5918	K	V	425	437
PSM	LREYEAALNSK	3478	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8637.3	95.8115	3	1292.6731	1292.6724	K	D	135	146
PSM	LREYEAALNSK	3479	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8647.11	96.09428	2	1292.6700	1292.6724	K	D	135	146
PSM	LREYEAALNSK	3480	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8628.11	95.58308	2	1292.6700	1292.6724	K	D	135	146
PSM	QCQCTSVGAQNTVICSK	3481	sp|P16422|EPCAM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	2-UNIMOD:4,4-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=1.1.8749.11	98.83849	3	1939.8517	1939.8550	R	L	45	62
PSM	DSYDSYATHNE	3482	sp|Q14011|CIRBP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8477.10	91.59697	2	1300.4824	1300.4844	R	-	162	173
PSM	SAVENCQDSWR	3483	sp|P52209-2|6PGD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	6-UNIMOD:4	ms_run[1]:scan=1.1.8599.10	94.8074	2	1350.5602	1350.5623	K	R	384	395
PSM	VQEQLGNDVVEK	3484	sp|O15305|PMM2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8780.11	99.67506	2	1356.6842	1356.6885	K	Y	52	64
PSM	LDGQTPHDERQDSINAYNEPNSTK	3485	sp|O60264|SMCA5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8828.10	100.9657	4	2728.2357	2728.2325	R	F	529	553
PSM	YTAESSDTLCPR	3486	sp|Q9NSE4|SYIM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	10-UNIMOD:4	ms_run[1]:scan=1.1.8533.11	93.07263	2	1398.6058	1398.6085	K	C	993	1005
PSM	LHVGNISPTCTNK	3487	sp|Q9BWF3|RBM4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	10-UNIMOD:4	ms_run[1]:scan=1.1.8664.11	96.54947	2	1439.7170	1439.7191	K	E	80	93
PSM	TQTVTISDNANAVK	3488	sp|P11171-5|41_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8790.10	99.94228	2	1460.7424	1460.7471	K	S	645	659
PSM	QCVENADLPEGEK	3489	sp|Q99460-2|PSMD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	2-UNIMOD:4	ms_run[1]:scan=1.1.8532.11	93.0461	2	1487.6538	1487.6562	K	K	111	124
PSM	DGTQCLSGSSDGTIR	3490	sp|Q8TAF3|WDR48_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	5-UNIMOD:4	ms_run[1]:scan=1.1.8582.10	94.3718	2	1552.6740	1552.6788	R	L	221	236
PSM	QEAVVEEDYNENAK	3491	sp|P82970|HMGN5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8770.11	99.40577	2	1636.7170	1636.7216	K	N	68	82
PSM	LPLVTPHTQCR	3492	sp|P62191|PRS4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	10-UNIMOD:4	ms_run[1]:scan=1.1.8876.9	102.2241	2	1320.6998	1320.6972	K	L	49	60
PSM	VHIDIGADGR	3493	sp|P31942-2|HNRH3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9046.3	106.6943	3	1051.5442	1051.5411	R	A	208	218
PSM	LENGELEHIRPK	3494	sp|Q15102|PA1B3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8897.2	102.7483	4	1433.7669	1433.7626	R	I	84	96
PSM	LEGFHTQISK	3495	sp|Q06323-2|PSME1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9076.5	107.495	3	1158.6046	1158.6033	K	Y	167	177
PSM	EQIVPKPEEEVAQK	3496	sp|P18621-3|RL17_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8997.4	105.388	4	1622.8525	1622.8515	K	K	154	168
PSM	TCHSFIINEK	3497	sp|B5ME19|EIFCL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	2-UNIMOD:4	ms_run[1]:scan=1.1.8962.3	104.4595	3	1247.5993	1247.5968	K	M	752	762
PSM	VGELKDDDFEK	3498	sp|Q02750|MP2K1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9008.7	105.6855	3	1293.6109	1293.6089	K	I	60	71
PSM	AIEAALAAR	3499	sp|P30038-2|AL4A1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8876.2	102.2091	2	884.5088	884.5079	K	K	45	54
PSM	AAECNIVVTQPR	3500	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	4-UNIMOD:4	ms_run[1]:scan=1.1.9062.6	107.127	3	1356.6832	1356.6820	R	R	435	447
PSM	QTVAVGVIK	3501	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8982.6	104.9959	2	913.5610	913.5597	R	A	431	440
PSM	QTVAVGVIK	3502	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9001.6	105.4975	2	913.5610	913.5597	R	A	431	440
PSM	TNHIYVSSDDIK	3503	sp|Q6P2Q9|PRP8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8937.6	103.7953	3	1390.6702	1390.6729	R	E	2087	2099
PSM	IYDLNKPEAEPK	3504	sp|Q9Y3F4-2|STRAP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8901.7	102.8591	3	1415.7286	1415.7296	R	E	139	151
PSM	TGTVSLEVR	3505	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9067.6	107.2599	2	960.5242	960.5240	K	L	928	937
PSM	MYAALGDPK	3506	sp|P78527|PRKDC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9176.7	110.1223	2	964.4688	964.4688	R	A	3613	3622
PSM	EAAYHPEVAPDVR	3507	sp|Q9Y490|TLN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8980.6	104.9435	3	1452.6970	1452.6997	K	L	2221	2234
PSM	PAYHSSLMDPDTK	3508	sp|O15145|ARPC3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9053.6	106.8861	3	1460.6569	1460.6606	M	L	2	15
PSM	DAEDAIYGR	3509	sp|Q13242|SRSF9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9116.6	108.5353	2	1008.4490	1008.4512	R	N	64	73
PSM	QEYDESGPSIVHR	3510	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8973.9	104.7646	3	1515.6940	1515.6954	K	K	360	373
PSM	YNTDCVQGLTHSK	3511	sp|P13637-2|AT1A3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	5-UNIMOD:4	ms_run[1]:scan=1.1.9177.9	110.1525	3	1521.6877	1521.6882	K	A	56	69
PSM	LGVQESDLR	3512	sp|Q9NX02|NALP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9171.8	109.9894	2	1015.5290	1015.5298	R	L	473	482
PSM	CLDAVVSTR	3513	sp|Q86VP6|CAND1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	1-UNIMOD:4	ms_run[1]:scan=1.1.8963.8	104.4949	2	1019.5056	1019.5070	K	H	356	365
PSM	TAVCDIPPR	3514	sp|Q9BVA1|TBB2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	4-UNIMOD:4	ms_run[1]:scan=1.1.9039.8	106.5155	2	1027.4974	1027.5121	K	G	351	360
PSM	TAVCDIPPR	3515	sp|Q9BVA1|TBB2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	4-UNIMOD:4	ms_run[1]:scan=1.1.8871.8	102.0895	2	1027.5088	1027.5121	K	G	351	360
PSM	SADGVIVSGVK	3516	sp|Q9UNH7|SNX6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8862.8	101.8529	2	1030.5642	1030.5659	K	D	194	205
PSM	ELTSTCSPIISKPK	3517	sp|P34932|HSP74_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	6-UNIMOD:4	ms_run[1]:scan=1.1.9162.7	109.745	3	1559.8219	1559.8229	K	P	774	788
PSM	KFYEQFSK	3518	sp|P07900-2|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9091.6	107.8901	2	1075.5322	1075.5338	K	N	558	566
PSM	TLSDYNIQK	3519	sp|P62979|RS27A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9120.7	108.6409	2	1080.5428	1080.5451	R	E	55	64
PSM	DGSDVIYPAR	3520	sp|P25685-2|DNJB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9121.6	108.6652	2	1091.5234	1091.5247	R	I	150	160
PSM	EAVAMESYAK	3521	sp|P78371|TCPB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8858.8	101.746	2	1097.5052	1097.5063	K	A	432	442
PSM	FAVLHGEAPR	3522	sp|P55884-2|EIF3B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8951.4	104.1665	3	1095.5830	1095.5825	K	I	577	587
PSM	EAVAMESYAK	3523	sp|P78371|TCPB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8878.9	102.2721	2	1097.5052	1097.5063	K	A	432	442
PSM	AALSEEELEK	3524	sp|Q04637-3|IF4G1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9138.9	109.1081	2	1117.5494	1117.5502	K	K	1195	1205
PSM	FVVQNVSAQK	3525	sp|Q92598-2|HS105_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8848.6	101.4796	2	1118.6076	1118.6084	R	D	462	472
PSM	KPGDLSDELR	3526	sp|Q13435|SF3B2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8977.9	104.87	2	1128.5740	1128.5775	K	I	605	615
PSM	LLLQVQHASK	3527	sp|P05141|ADT2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8843.7	101.3518	2	1135.6690	1135.6713	K	Q	34	44
PSM	EAESSPFVER	3528	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8901.10	102.8641	2	1149.5282	1149.5302	K	L	548	558
PSM	EAESSPFVER	3529	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8881.9	102.3492	2	1149.5282	1149.5302	K	L	548	558
PSM	MSISEGTVSDK	3530	sp|P46821|MAP1B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8849.9	101.5104	2	1152.5296	1152.5332	K	S	1519	1530
PSM	GDIIGVQGNPGK	3531	sp|Q15046-2|SYK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8924.9	103.4557	2	1153.6094	1153.6091	R	T	207	219
PSM	FNQVLGDDEK	3532	sp|Q29RF7|PDS5A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8858.9	101.7477	2	1163.5476	1163.5459	K	L	559	569
PSM	QFSSADEAALK	3533	sp|Q9HCC0-2|MCCB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9100.8	108.1253	2	1165.5580	1165.5615	K	E	458	469
PSM	NLDDTIDDEK	3534	sp|Q13310-2|PABP4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9031.10	106.3051	2	1176.5132	1176.5146	K	L	300	310
PSM	NNALNPEEMR	3535	sp|O60684|IMA7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9176.9	110.1257	2	1186.5376	1186.5400	K	R	19	29
PSM	AAVMVYDDANK	3536	sp|Q8N8S7|ENAH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8882.9	102.375	2	1195.5530	1195.5543	R	K	11	22
PSM	DVEEGDEKFE	3537	sp|Q9Y3A5|SBDS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8853.10	101.616	2	1195.4852	1195.4881	K	-	241	251
PSM	KLTELGTVDPK	3538	sp|P46940|IQGA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8855.4	101.659	3	1199.6728	1199.6761	K	N	1465	1476
PSM	NKLDHYAIIK	3539	sp|P62750|RL23A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.9148.8	109.3706	2	1213.679447	1213.681908	R	F	69	79
PSM	AYGENIGYSEK	3540	sp|P05026-2|AT1B1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8992.10	105.2656	2	1229.5564	1229.5564	K	D	278	289
PSM	QLAEQEELER	3541	sp|Q9UH65|SWP70_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8862.11	101.8579	2	1243.6040	1243.6044	K	Q	330	340
PSM	TCHSFIINEK	3542	sp|B5ME19|EIFCL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	2-UNIMOD:4	ms_run[1]:scan=1.1.8981.2	104.963	3	1247.5993	1247.5968	K	M	752	762
PSM	EQVANSAFVER	3543	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9051.9	106.8376	2	1248.6092	1248.6098	K	V	492	503
PSM	QLQAETEPIVK	3544	sp|P60228|EIF3E_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9179.9	110.206	2	1254.6792	1254.6819	K	M	83	94
PSM	VDVTEQPGLSGR	3545	sp|Q9H3N1|TMX1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9063.11	107.1621	2	1256.6306	1256.6361	K	F	83	95
PSM	VLGTEAVQDPTK	3546	sp|O43395|PRPF3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22		ms_run[1]:scan=1.1.8978.11	104.8995	2	1256.6555	1256.6607	R	V	484	496
PSM	VLGTEAVQDPTK	3547	sp|O43395|PRPF3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8976.11	104.8471	2	1256.6556	1256.6612	R	V	484	496
PSM	RNPDTQWITK	3548	sp|P61313|RL15_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9077.4	107.5199	3	1257.6457	1257.6466	R	P	144	154
PSM	GTVEGFEPADNK	3549	sp|P37108|SRP14_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8917.9	103.274	2	1262.5790	1262.5779	K	C	44	56
PSM	VLEACSIACNK	3550	sp|P34896-2|GLYC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	5-UNIMOD:4,9-UNIMOD:4	ms_run[1]:scan=1.1.9093.10	107.9483	2	1263.5948	1263.5951	K	N	337	348
PSM	KGSSLEIVSACR	3551	sp|Q5T7N2|LITD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	11-UNIMOD:4	ms_run[1]:scan=1.1.8948.9	104.0945	2	1305.6644	1305.6711	K	V	734	746
PSM	SSTETCYSAIPK	3552	sp|O75369-2|FLNB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	6-UNIMOD:4	ms_run[1]:scan=1.1.9094.7	107.9757	2	1342.6032	1342.6075	R	A	2472	2484
PSM	SQYEVMAEQNR	3553	sp|P08727|K1C19_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8891.10	102.6081	2	1353.5972	1353.5983	R	K	254	265
PSM	VIVLSSSHSYQR	3554	sp|Q969U7-2|PSMG2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8840.6	101.2721	3	1374.7276	1374.7256	R	N	87	99
PSM	RAVAGDASESALLK	3555	sp|P05023-4|AT1A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8971.10	104.713	2	1386.7422	1386.7467	K	C	445	459
PSM	SLAPSIHGHDYVK	3556	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8846.11	101.4365	2	1422.7194	1422.7256	K	K	302	315
PSM	TATTQETDGFQVK	3557	sp|Q96GM5-2|SMRD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9023.10	106.0909	2	1424.6754	1424.6784	R	R	261	274
PSM	AQQVAVQEQEIAR	3558	sp|O75955-2|FLOT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8927.11	103.5381	2	1468.7620	1468.7634	R	R	214	227
PSM	EIQEPDPTYEEK	3559	sp|O60264|SMCA5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9189.11	110.4732	2	1476.6570	1476.6620	K	M	72	84
PSM	EWNDSTSVQNPTR	3560	sp|Q9Y3Z3-4|SAMH1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9167.11	109.8865	2	1532.6822	1532.6855	K	L	562	575
PSM	LSVEESEAAGDGVDTK	3561	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9123.11	108.7253	2	1605.7594	1605.7370	K	V	427	443
PSM	ELNNTCEPVVTQPK	3562	sp|Q92598-2|HS105_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	6-UNIMOD:4	ms_run[1]:scan=1.1.8929.11	103.5911	2	1627.7868	1627.7876	K	P	747	761
PSM	MLQPCGPPADKPEEN	3563	sp|Q9BWJ5|SF3B5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	5-UNIMOD:4	ms_run[1]:scan=1.1.8937.10	103.8019	3	1681.7440	1681.7440	K	-	72	87
PSM	VNEAAPEKPQDDSGTAGGISSTSASVNR	3564	sp|Q5T4S7-2|UBR4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8911.10	103.1204	4	2744.2817	2744.2849	K	Y	3767	3795
PSM	SIRPLLEGR	3565	sp|Q9NVP1|DDX18_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9286.2	113.0196	3	1039.6153	1039.6138	K	D	209	218
PSM	TVEGVLIVHEHR	3566	sp|O43809|CPSF5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9462.3	117.7163	4	1387.7609	1387.7572	R	L	79	91
PSM	VHIEIGPDGR	3567	sp|P31943|HNRH1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9261.3	112.3667	3	1091.5735	1091.5724	R	V	317	327
PSM	AALCAVHVIR	3568	sp|O43747-2|AP1G1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	4-UNIMOD:4	ms_run[1]:scan=1.1.9481.2	118.2266	3	1108.6186	1108.6175	K	K	157	167
PSM	LFHTAPNVPHYAK	3569	sp|P53582|MAP11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9499.3	118.7121	4	1493.7805	1493.7779	K	N	299	312
PSM	KVHVIFNYK	3570	sp|P27797|CALR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9396.3	115.9502	3	1146.6595	1146.6550	K	G	143	152
PSM	IDRLDGAHAPELTK	3571	sp|O76003|GLRX3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9424.3	116.6937	4	1534.8121	1534.8103	K	K	97	111
PSM	VVPGYGHAVLR	3572	sp|O75390|CISY_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9215.4	111.148	3	1166.6545	1166.6560	R	K	341	352
PSM	RLNDFASTVR	3573	sp|P20674|COX5A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9246.3	111.9754	3	1177.6237	1177.6204	R	I	98	108
PSM	IINNTENLVR	3574	sp|Q9Y617|SERC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9384.4	115.628	3	1184.6548	1184.6513	K	E	52	62
PSM	EALQDVEDENQ	3575	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9500.6	118.7439	3	1288.5406	1288.5419	K	-	245	256
PSM	SRYEQVDLVGK	3576	sp|Q9BQ39|DDX50_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9255.4	112.2125	3	1292.6710	1292.6725	K	M	343	354
PSM	HGESAWNLENR	3577	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9532.7	119.6055	3	1311.5947	1311.5956	R	F	11	22
PSM	ALLVTASQCQQPAENK	3578	sp|Q01518-2|CAP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	9-UNIMOD:4	ms_run[1]:scan=1.1.9407.5	116.2497	4	1756.8765	1756.8778	R	L	84	100
PSM	LRQQDLDGELR	3579	sp|Q99459|CDC5L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.9430.6	116.8578	3	1341.703871	1341.700077	K	S	242	253
PSM	RALEQQVEEMK	3580	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9243.4	111.8974	3	1359.6814	1359.6816	K	T	1528	1539
PSM	LDECEEAFQGTK	3581	sp|P61289-2|PSME3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	4-UNIMOD:4	ms_run[1]:scan=1.1.9487.5	118.3929	3	1425.6127	1425.6082	R	V	89	101
PSM	AVDSQILPK	3582	sp|Q02878|RL6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9358.6	114.9342	2	969.5496	969.5495	K	I	252	261
PSM	QAVDVSPLR	3583	sp|P46782|RS5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9361.7	115.0158	2	983.5414	983.5400	R	R	137	146
PSM	HALLDVTPK	3584	sp|Q9UDY2|ZO2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9279.7	112.843	2	992.5628	992.5655	K	A	788	797
PSM	IDESSLTGESDHVK	3585	sp|P23634-8|AT2B4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9365.7	115.1227	3	1515.7054	1515.7053	K	K	234	248
PSM	HLVGVCYTEDEAK	3586	sp|P08574|CY1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	6-UNIMOD:4	ms_run[1]:scan=1.1.9250.11	112.0941	3	1519.6900	1519.6977	R	E	134	147
PSM	DVTNNVHYENYR	3587	sp|Q16181-2|SEPT7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9364.6	115.0943	3	1522.6807	1522.6801	K	S	298	310
PSM	TSLSFQDPK	3588	sp|P48681|NEST_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9530.11	119.5585	2	1021.5188	1021.5080	K	L	322	331
PSM	ELPGHTGYLSCCR	3589	sp|Q9HAV0|GBB4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	11-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.9502.5	118.7959	3	1548.6784	1548.6813	R	F	138	151
PSM	SIRPLLEGR	3590	sp|Q9NVP1|DDX18_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9266.3	112.4966	3	1039.6153	1039.6138	K	D	209	218
PSM	LTRDETNYGIPQR	3591	sp|P63244|RACK1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9228.6	111.5002	3	1561.7833	1561.7849	K	A	45	58
PSM	AGDLLEDSPK	3592	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9260.7	112.3474	2	1043.5124	1043.5135	R	R	158	168
PSM	IHCTQTLLEGDGPK	3593	sp|P29762|RABP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	3-UNIMOD:4	ms_run[1]:scan=1.1.9324.9	114.0473	3	1567.7647	1567.7664	K	T	94	108
PSM	SISESAFSAR	3594	sp|O75487|GPC4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9447.8	117.3197	2	1053.5090	1053.5091	R	F	355	365
PSM	AEIITVSDGR	3595	sp|Q9BRG1|VPS25_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9413.9	116.4161	2	1059.5592	1059.5560	K	G	162	172
PSM	HWGGNVLGPK	3596	sp|P62424|RL7A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9326.7	114.0962	2	1063.5554	1063.5563	R	S	236	246
PSM	CVNTTLQIK	3597	sp|Q01518-2|CAP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	1-UNIMOD:4	ms_run[1]:scan=1.1.9256.10	112.2485	2	1075.5672	1075.5696	K	G	355	364
PSM	ASAVYQALQK	3598	sp|Q5VWZ2-2|LYPL1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9306.5	113.5629	2	1077.5804	1077.5818	K	S	138	148
PSM	SESALSCLSK	3599	sp|Q9GZR7|DDX24_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	7-UNIMOD:4	ms_run[1]:scan=1.1.9289.7	113.1084	2	1080.5098	1080.5121	K	Q	826	836
PSM	IQEENVIPR	3600	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9483.8	118.2904	2	1096.5862	1096.5876	K	E	981	990
PSM	IDEMPEAAVK	3601	sp|P51858|HDGF_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9337.10	114.3907	2	1101.5378	1101.5376	R	S	30	40
PSM	LDSSAVLDTGK	3602	sp|P42704|LPPRC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9505.9	118.8828	2	1104.5606	1104.5663	R	Y	740	751
PSM	ALAAAGYDVEK	3603	sp|P16402|H13_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9312.10	113.7325	2	1106.5586	1106.5608	K	N	66	77
PSM	TGQEIPVNVR	3604	sp|Q96KP4|CNDP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9305.10	113.5443	2	1111.5950	1111.5986	K	F	150	160
PSM	AFAAQEDLEK	3605	sp|P35241-5|RADI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9365.11	115.1294	2	1120.5386	1120.5400	K	T	449	459
PSM	AFAAQEDLEK	3606	sp|P35241-5|RADI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9384.10	115.638	2	1120.5386	1120.5400	K	T	449	459
PSM	SMEVSTQLAR	3607	sp|Q9UQE7|SMC3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9403.8	116.1471	2	1120.5510	1120.5546	R	A	635	645
PSM	SSLYCSDIGK	3608	sp|Q96HY7|DHTK1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	5-UNIMOD:4	ms_run[1]:scan=1.1.9295.7	113.2699	2	1128.5124	1128.5121	R	L	379	389
PSM	PSDNLIVCGR	3609	sp|Q13610|PWP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	8-UNIMOD:4	ms_run[1]:scan=1.1.9425.8	116.7284	2	1129.5530	1129.5550	K	A	147	157
PSM	ERSGVSLAALK	3610	sp|P16402|H13_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9534.4	119.654	3	1129.6450	1129.6455	K	K	54	65
PSM	RAFLIEEQK	3611	sp|P49207|RL34_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9331.2	114.2189	3	1132.6261	1132.6240	K	I	93	102
PSM	VDATADYICK	3612	sp|P53396|ACLY_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	9-UNIMOD:4	ms_run[1]:scan=1.1.9267.7	112.5293	2	1154.5270	1154.5278	K	V	221	231
PSM	VVPGYGHAVLR	3613	sp|O75390|CISY_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9234.3	111.6561	3	1166.6545	1166.6560	R	K	341	352
PSM	QTESTSFLEK	3614	sp|P60900|PSA6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9284.8	112.9766	2	1168.5582	1168.5612	K	K	172	182
PSM	GDAMIMEETGK	3615	sp|Q9UQ80|PA2G4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9471.10	117.9706	2	1180.5128	1180.5104	K	I	52	63
PSM	SSIAGSSTWER	3616	sp|Q99808-2|S29A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9295.9	113.2732	2	1179.5484	1179.5520	K	Y	395	406
PSM	SSIAGSSTWER	3617	sp|Q99808-2|S29A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9276.9	112.7678	2	1179.5484	1179.5520	K	Y	395	406
PSM	IINNTENLVR	3618	sp|Q9Y617|SERC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9363.9	115.0725	2	1184.6492	1184.6513	K	E	52	62
PSM	VLENIELNKK	3619	sp|Q9Y262|EIF3L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9299.3	113.3707	3	1198.6960	1198.6921	K	S	293	303
PSM	AQEAAATQLGLK	3620	sp|P50336|PPOX_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9451.11	117.4328	2	1199.6488	1199.6510	R	E	393	405
PSM	ENLTELSGGQR	3621	sp|O95347|SMC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9301.10	113.4364	2	1202.5862	1202.5891	K	S	1080	1091
PSM	TEEGPTLSYGR	3622	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9311.10	113.7056	2	1208.5652	1208.5673	R	D	150	161
PSM	FASCVDASGGLK	3623	sp|Q8IXT5|RB12B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	4-UNIMOD:4	ms_run[1]:scan=1.1.9457.11	117.5951	2	1210.5670	1210.5652	K	C	201	213
PSM	SAQEFAVDPEK	3624	sp|Q2KHR3|QSER1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9489.11	118.4567	2	1219.5704	1219.5721	K	I	1655	1666
PSM	IHDPQLLTER	3625	sp|P14868|SYDC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9394.5	115.8994	3	1220.6512	1220.6513	R	A	432	442
PSM	FITDNTVEER	3626	sp|O60264|SMCA5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9425.11	116.7334	2	1222.5804	1222.5830	R	I	607	617
PSM	GIVEFSGKPAAR	3627	sp|Q15233-2|NONO_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9203.3	110.8294	3	1230.6724	1230.6721	K	K	102	114
PSM	NISSAQIVGPGPKPEASAK	3628	sp|P53990-2|IST1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9385.9	115.6635	3	1849.9861	1849.9897	K	L	262	281
PSM	DQVANSAFVER	3629	sp|P07900-2|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9305.11	113.5459	2	1234.5920	1234.5942	K	L	622	633
PSM	SQSIDTPGVISR	3630	sp|Q96ST3|SIN3A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9519.10	119.2608	2	1258.6472	1258.6517	K	V	156	168
PSM	TCIQEFTAHR	3631	sp|O43815-2|STRN_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	2-UNIMOD:4	ms_run[1]:scan=1.1.9484.4	118.3106	3	1261.5862	1261.5874	K	K	690	700
PSM	TSDVGGYYYEK	3632	sp|P46821|MAP1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9505.11	118.8861	2	1280.5532	1280.5561	R	I	1898	1909
PSM	VVTQNICQYR	3633	sp|Q8N163|CCAR2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	7-UNIMOD:4	ms_run[1]:scan=1.1.9232.10	111.6143	2	1279.6316	1279.6343	R	S	748	758
PSM	DISTNYYASQK	3634	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9374.10	115.3687	2	1288.5902	1288.5935	K	K	672	683
PSM	DIQEESTFSSR	3635	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9294.10	113.2479	2	1297.5760	1297.5786	K	K	67	78
PSM	VCDEPHPLLVK	3636	sp|P35250-2|RFC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	2-UNIMOD:4	ms_run[1]:scan=1.1.9304.7	113.5122	3	1305.6748	1305.6751	K	E	220	231
PSM	EDQTEYLEER	3637	sp|P07900-2|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9407.4	116.248	3	1310.5648	1310.5626	K	R	314	324
PSM	HGESAWNLENR	3638	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9511.4	119.0357	3	1311.5947	1311.5956	R	F	11	22
PSM	LSDYDSSEEAIR	3639	sp|Q6PGP7|TTC37_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9391.8	115.8235	2	1383.6134	1383.6154	K	T	363	375
PSM	QPPIQSTAGAVPVR	3640	sp|P55081|MFAP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9485.10	118.3475	2	1419.7770	1419.7834	K	N	10	24
PSM	TEGDGVYTLNNEK	3641	sp|P00738|HPT_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9199.9	110.734	2	1438.6506	1438.6576	R	Q	119	132
PSM	IKGEHPGLSIGDVAK	3642	sp|P09429|HMGB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9537.3	119.7304	4	1519.8377	1519.8358	K	K	113	128
PSM	YSPTSPTYSPTTPK	3643	sp|P24928|RPB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9199.10	110.7356	2	1525.7242	1525.7300	K	Y	1874	1888
PSM	YTPSQQGVAFNSGAK	3644	sp|Q13573|SNW1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9315.11	113.8147	2	1553.7424	1553.7474	R	Q	179	194
PSM	LLACIASRPGQCGR	3645	sp|P62241|RS8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	4-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.9381.10	115.557	2	1557.7814	1557.7868	K	A	171	185
PSM	DCVSPSEYTAACSR	3646	sp|Q9UK41-2|VPS28_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	2-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.9375.11	115.3971	2	1601.6408	1601.6450	K	L	59	73
PSM	ESEDKPEIEDVGSDEEEEK	3647	sp|P07900-2|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9432.11	116.9201	3	2191.9033	2191.9128	K	K	373	392
PSM	ELDDATEANEGLSR	3648	sp|P35580-3|MYH10_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9256.9	112.2468	3	1518.6772	1518.6798	R	E	1927	1941
PSM	ATQQQHDFTLTQTADGR	3649	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9463.8	117.7518	4	1916.8949	1916.8977	R	S	2637	2654
PSM	IHGTEEGQQILK	3650	sp|Q14980-2|NUMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8301.7	86.91123	3	1351.7107	1351.7096	R	Q	43	55
PSM	AALPLTTSDTK	3651	sp|Q7Z6Z7-2|HUWE1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9167.6	109.8782	2	1116.6006	1116.6026	K	T	1498	1509
PSM	LQHLAESWGGK	3652	sp|Q7Z6Z7-2|HUWE1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9527.4	119.466	3	1224.6235	1224.6251	R	E	163	174
PSM	TFQTLECQHK	3653	sp|Q5UIP0|RIF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	7-UNIMOD:4	ms_run[1]:scan=1.1.8055.8	80.53677	3	1290.6034	1290.6027	K	R	1712	1722
PSM	NSEPAGLETPEAK	3654	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8443.11	90.68478	2	1341.6336	1341.6412	R	V	890	903
PSM	AITPQAQEELQK	3655	sp|Q02952-2|AKA12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8685.5	97.10512	3	1354.7104	1354.7092	K	Q	1660	1672
PSM	HNTYLQECTGQR	3656	sp|Q5T4S7-2|UBR4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	8-UNIMOD:4	ms_run[1]:scan=1.1.7914.5	76.8172	3	1505.6737	1505.6681	R	E	4939	4951
PSM	TGTITTFEHAHNMR	3657	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9306.5	113.5629	3	1614.7567	1614.7573	K	V	482	496
PSM	EAMEDGEIDGNK	3658	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7884.5	76.04613	3	1306.5370	1306.5347	K	V	628	640
PSM	VVIQSNDDIASR	3659	sp|Q93008-1|USP9X_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8764.4	99.2324	3	1315.6717	1315.6732	R	A	777	789
PSM	VEIIANDQGNR	3660	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8271.3	86.10374	3	1227.6214	1227.6207	R	I	50	61
PSM	DYGHSSSRDDYPSR	3661	sp|P38159-2|RBMX_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7269.4	59.78962	4	1640.6853	1640.6815	R	G	232	246
PSM	QEYDESGPSIVHR	3662	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9129.6	108.8715	3	1515.7147	1515.6954	K	K	360	373
PSM	AVDSQILPK	3663	sp|Q02878|RL6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9367.9	115.1795	2	969.5496	969.5495	K	I	252	261
PSM	GGGFGGNDNFGR	3664	sp|P09651-2|ROA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9338.9	114.4155	2	1153.4884	1153.4901	R	G	207	219
PSM	ISSDLDGHPVPK	3665	sp|P29401-2|TKT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8374.2	88.8457	3	1263.6496	1263.6459	K	Q	103	115
PSM	FSGDLDDQTCR	3666	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	10-UNIMOD:4	ms_run[1]:scan=1.1.8662.6	96.48743	3	1312.5358	1312.5354	K	E	236	247
PSM	KIIEDQQESLNK	3667	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7719.10	71.79639	3	1443.7570	1443.7569	K	W	317	329
PSM	NIEMTQEDVR	3668	sp|O75643|U520_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8990.9	105.2109	2	1233.5626	1233.5659	R	L	638	648
PSM	EGNPAEINVERDEK	3669	sp|Q9BXP5-2|SRRT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8373.9	88.83054	3	1598.7505	1598.7536	K	L	591	605
PSM	HPDADSLYVEK	3670	sp|P54577|SYYC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8799.5	100.1757	3	1272.6010	1272.5986	K	I	381	392
PSM	AISSASSPQSPGDALR	3671	sp|Q96KR1|ZFR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9131.6	108.923	3	1542.7639	1542.7638	K	R	954	970
PSM	GEHSIVYLK	3672	sp|Q02790|FKBP4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8884.6	102.4214	2	1044.5654	1044.5604	K	P	214	223
PSM	IISSIEQKEENK	3673	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7698.8	71.23238	3	1416.7498	1416.7460	R	G	62	74
PSM	GCPEDAAVCAVDK	3674	sp|P11717|MPRI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	2-UNIMOD:4,9-UNIMOD:4	ms_run[1]:scan=1.1.9360.8	114.9908	2	1390.5798	1390.5857	R	N	530	543
PSM	PSDLRPGDVSSK	3675	sp|Q05682-4|CALD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7363.5	62.23497	3	1256.6389	1256.6361	K	R	509	521
PSM	DLEGSDIDTR	3676	sp|P55060-3|XPO2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8591.6	94.5972	2	1119.5038	1119.5044	R	R	373	383
PSM	RDLEGSDIDTR	3677	sp|P55060-3|XPO2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7713.7	71.63308	3	1275.6091	1275.6055	R	R	372	383
PSM	LVSSDPEINTK	3678	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8112.9	82.0435	2	1201.6206	1201.6190	R	K	257	268
PSM	AGVRPSSSGSAWEACSEAPSK	3679	sp|Q12789-3|TF3C1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	15-UNIMOD:4	ms_run[1]:scan=1.1.9178.10	110.1809	3	2119.9546	2119.9593	R	G	839	860
PSM	ILQDSLGGNCR	3680	sp|P33176|KINH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	10-UNIMOD:4	ms_run[1]:scan=1.1.8859.8	101.7728	2	1231.5974	1231.5979	R	T	285	296
PSM	RNPDTQWITK	3681	sp|P61313|RL15_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9097.3	108.0397	3	1257.6457	1257.6466	R	P	144	154
PSM	VCHAHPTLSEAFR	3682	sp|P09622|DLDH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	2-UNIMOD:4	ms_run[1]:scan=1.1.9328.2	114.1402	4	1523.7325	1523.7303	R	E	483	496
PSM	VCHAHPTLSEAFR	3683	sp|P09622|DLDH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	2-UNIMOD:4	ms_run[1]:scan=1.1.9308.4	113.615	4	1523.7341	1523.7303	R	E	483	496
PSM	VTLLEGDHVR	3684	sp|O75534-2|CSDE1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9352.3	114.7711	3	1137.6163	1137.6142	K	F	277	287
PSM	EWGSGSDTLR	3685	sp|P16615-4|AT2A2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9487.9	118.3996	2	1106.4972	1106.4993	R	C	523	533
PSM	HYGGLTGLNK	3686	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8273.9	86.16707	2	1058.5504	1058.5509	R	A	91	101
PSM	GTVVTGTLER	3687	sp|P49411|EFTU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8543.7	93.3342	2	1031.5596	1031.5611	R	G	272	282
PSM	KYEEIDNAPEER	3688	sp|P49411|EFTU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7955.4	77.89405	4	1491.6833	1491.6841	K	A	91	103
PSM	SEISGDLAR	3689	sp|P08133-2|ANXA6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8277.4	86.26562	2	946.4790	946.4720	K	L	387	396
PSM	RAGELTEDEVER	3690	sp|P62269|RS18_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7951.8	77.79324	3	1402.6762	1402.6688	K	V	55	67
PSM	SSVLIAQQTDTSDPEK	3691	sp|P46060|RAGP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9428.7	116.8062	3	1717.8343	1717.8370	K	V	453	469
PSM	GADQKPTSADCAVR	3692	sp|Q8IX01-3|SUGP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	11-UNIMOD:4	ms_run[1]:scan=1.1.6936.9	50.90955	3	1474.7071	1474.6834	R	A	646	660
PSM	VTADVINAAEK	3693	sp|O43175|SERA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9102.2	108.1667	3	1129.5982	1129.5979	K	L	59	70
PSM	AVGFSSGTENPHGVK	3694	sp|Q32P28|P3H1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8033.9	79.94598	3	1485.7273	1485.7212	R	A	648	663
PSM	SGQGAFGNMCR	3695	sp|P36578|RL4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	10-UNIMOD:4	ms_run[1]:scan=1.1.8755.7	98.9941	2	1183.4844	1183.4863	R	G	87	98
PSM	APVPGTPDSLSSGSSR	3696	sp|Q9UJZ1-2|STML2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9155.7	109.5571	3	1513.7374	1513.7373	K	D	277	293
PSM	LFQSNDQTLR	3697	sp|Q9UBF2|COPG2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9375.9	115.3938	2	1220.6250	1220.6149	R	R	76	86
PSM	QCVENADLPEGEK	3698	sp|Q99460-2|PSMD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	2-UNIMOD:4	ms_run[1]:scan=1.1.8514.9	92.5685	3	1487.6557	1487.6562	K	K	111	124
PSM	KFTNAVTLQQHVR	3699	sp|Q9Y467|SALL2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8852.6	101.5833	3	1540.8460	1540.8474	K	M	699	712
PSM	HIHITQATETTTTR	3700	sp|Q14677-2|EPN4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7470.7	65.12855	4	1608.8261	1608.8220	K	H	243	257
PSM	VQAMQISSEKEEDDNEK	3701	sp|Q9UKY7-2|CDV3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8088.11	81.42245	3	1978.8790	1978.8789	R	R	100	117
PSM	RHFNAPSHIR	3702	sp|P61254|RL26_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7302.2	60.63483	3	1233.6589	1233.6479	K	R	17	27
PSM	HSGPNSADSANDGFVR	3703	sp|P52597|HNRPF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7827.3	74.56197	4	1629.7185	1629.7132	K	L	99	115
PSM	KQPPVSPGTALVGSQK	3704	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8829.9	100.9899	3	1592.8885	1592.8886	R	E	31	47
PSM	TEAQAFTETK	3705	sp|Q9NX02|NALP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7799.10	73.8386	2	1124.5382	1124.5350	K	G	129	139
PSM	QVQHILASASPSGR	3706	sp|O94979-10|SC31A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8304.7	86.99188	3	1449.7678	1449.7688	R	A	179	193
PSM	RTAATLATHELR	3707	sp|Q8N1G4|LRC47_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7660.4	70.22366	4	1338.7413	1338.7368	K	A	370	382
PSM	IQTQPGYANTLR	3708	sp|Q00325-2|MPCP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9303.8	113.4869	3	1360.7068	1360.7099	R	D	189	201
PSM	IGNCPFSQR	3709	sp|O00299|CLIC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	4-UNIMOD:4	ms_run[1]:scan=1.1.8587.10	94.49973	2	1077.5018	1077.5026	K	L	21	30
PSM	NLNGHSIGQYR	3710	sp|P50579-2|MAP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8305.6	87.01718	3	1257.6202	1257.6214	R	I	304	315
PSM	GYDDRDYYSR	3711	sp|P62995-3|TRA2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8459.4	91.103	3	1308.5368	1308.5371	R	S	129	139
PSM	LEGEACGVYTPR	3712	sp|P18065|IBP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	6-UNIMOD:4	ms_run[1]:scan=1.1.9300.11	113.411	2	1350.6184	1350.6238	R	C	93	105
PSM	VTHELQAMK	3713	sp|P17980|PRS6A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7388.3	62.90208	3	1055.5426	1055.5433	R	D	62	71
PSM	ADLEGSLDSK	3714	sp|Q15031|SYLM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8702.8	97.569	2	1033.5106	1033.4928	K	I	364	374
PSM	YKVDCEAVR	3715	sp|Q96EB6|SIR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	5-UNIMOD:4	ms_run[1]:scan=1.1.7720.5	71.81492	3	1138.5547	1138.5441	K	G	376	385
PSM	RLSSSSATLLNSPDR	3716	sp|Q14244-7|MAP7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9340.6	114.4676	3	1602.8299	1602.8325	K	A	220	235
PSM	DRDLVTEDTGVR	3717	sp|Q13823|NOG2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8811.7	100.5028	3	1374.6931	1374.6739	K	N	179	191
PSM	TLEEDVDDRAPSK	3718	sp|Q13823|NOG2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8847.7	101.4555	3	1473.6883	1473.6947	K	K	642	655
PSM	ISNDNPEEHVLK	3719	sp|Q9H2P0|ADNP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8371.6	88.772	3	1393.6879	1393.6837	K	V	903	915
PSM	GGPSPGDVEAIK	3720	sp|P09661|RU2A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9286.9	113.0312	2	1125.5646	1125.5666	K	N	194	206
PSM	KGGPSPGDVEAIK	3721	sp|P09661|RU2A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8358.4	88.42023	3	1253.6605	1253.6616	K	N	193	206
PSM	KLQEYNVGGK	3722	sp|P46379-2|BAG6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7542.5	67.04732	3	1134.5956	1134.6033	K	V	71	81
PSM	SAEDYNSSNALNVK	3723	sp|Q13153-2|PAK1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9340.5	114.4642	3	1510.6903	1510.6899	K	A	149	163
PSM	KFVTETLEDGSR	3724	sp|Q9NXF1-2|TEX10_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9514.7	119.1214	3	1380.6865	1380.6885	R	L	465	477
PSM	LAQLITQAK	3725	sp|Q9NXE4-4|NSMA3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9251.7	112.1135	2	984.5948	984.5968	R	H	642	651
PSM	RQQPGPSEHIER	3726	sp|P50552|VASP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.6985.4	52.20927	4	1432.7193	1432.7171	K	R	143	155
PSM	DCHLAQVPSHTVVAR	3727	sp|P02787|TRFE_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	2-UNIMOD:4	ms_run[1]:scan=1.1.9110.3	108.3747	4	1688.8425	1688.8417	K	S	259	274
PSM	GQVKPSTSSQPILSAPGPTK	3728	sp|Q9ULT8|HECD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9279.11	112.8497	3	1979.0641	1979.0688	R	L	733	753
PSM	AVHEQLAALSQPQQNKPK	3729	sp|O60885|BRD4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8788.8	99.88528	4	1986.0625	1986.0646	K	K	520	538
PSM	INVYYNESSSQK	3730	sp|Q9BUF5|TBB6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9186.11	110.3944	2	1430.6616	1430.6677	R	Y	47	59
PSM	TGVHHYSGNNIELGTACGK	3731	sp|P62888|RL30_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	17-UNIMOD:4	ms_run[1]:scan=1.1.8691.6	97.26873	4	2013.9313	2013.9327	K	Y	69	88
PSM	TKVEAFQTTISK	3732	sp|Q9UL46|PSME2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9300.11	113.411	2	1351.7310	1351.7347	K	Y	155	167
PSM	LDDHALTGASDSR	3733	sp|Q12788|TBL3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8311.4	87.17323	3	1356.6265	1356.6270	R	V	616	629
PSM	FEHCNFNDVTTR	3734	sp|P13987|CD59_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	4-UNIMOD:4	ms_run[1]:scan=1.1.9509.9	118.9903	3	1538.6569	1538.6572	K	L	67	79
PSM	HRDGGEALVSPDGTVTEAPR	3735	sp|Q96HN2-2|SAHH3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9483.6	118.2871	4	2062.9989	2063.0032	R	T	98	118
PSM	AATSDLEHYDK	3736	sp|P80303-2|NUCB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8051.6	80.42577	3	1248.5665	1248.5622	K	T	161	172
PSM	QSDIQNLNEER	3737	sp|Q9NXC5|MIO_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8439.10	90.57568	2	1344.6058	1344.6269	K	I	480	491
PSM	KVVVYLQK	3738	sp|P53634|CATC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8190.5	84.04573	2	975.6110	975.6117	K	L	63	71
PSM	RIIDDSEITK	3739	sp|Q96A72|MGN2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8676.3	96.85873	3	1188.6367	1188.6350	K	E	64	74
PSM	RIIDDSEITK	3740	sp|Q96A72|MGN2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8677.4	96.88752	3	1188.6367	1188.6350	K	E	64	74
PSM	HHAAYVNNLNVTEEK	3741	sp|P04179-2|SODM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8691.9	97.27374	3	1737.8122	1737.8434	K	Y	54	69
PSM	LLHSENYVTK	3742	sp|Q9Y376|CAB39_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7961.7	78.06097	3	1202.6308	1202.6295	K	R	217	227
PSM	AQGGSSDSSLALHER	3743	sp|Q08378|GOGA3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7707.8	71.47353	3	1513.7104	1513.7121	R	I	1029	1044
PSM	SAKPGQEEDGPLK	3744	sp|P49848-2|TAF6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7174.9	57.28855	3	1354.6783	1354.6728	K	G	167	180
PSM	ITQCSVEIQR	3745	sp|O15400-2|STX7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	4-UNIMOD:4	ms_run[1]:scan=1.1.8570.10	94.06429	2	1232.6178	1232.6183	K	T	25	35
PSM	SEETLDEGPPK	3746	sp|Q00688|FKBP3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7830.5	74.6384	3	1200.5536	1200.5510	K	Y	100	111
PSM	VINQYQVVKPTAER	3747	sp|Q14694-2|UBP10_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9203.11	110.8427	3	1643.8966	1643.8995	K	T	820	834
PSM	RTQGVSTTDLVGR	3748	sp|Q99447-3|PCY2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8647.5	96.08428	3	1388.7367	1388.7372	K	M	140	153
PSM	VDCQAYAQTCQK	3749	sp|Q8IXB1-2|DJC10_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	3-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.7492.11	65.72398	2	1470.6246	1470.6232	K	A	680	692
PSM	LHPELSGPGVAAK	3750	sp|Q6DD87|ZN787_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8731.3	98.33936	3	1274.6923	1274.6983	R	V	199	212
PSM	IIHEAGYSEEECK	3751	sp|P63096-2|GNAI1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	12-UNIMOD:4	ms_run[1]:scan=1.1.7695.7	71.15025	3	1563.6883	1563.6875	K	Q	3	16
PSM	GHQQLYWSHPR	3752	sp|P62273-2|RS29_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8870.7	102.0619	3	1407.7015	1407.6796	M	K	2	13
PSM	AQQHWGSGVGVK	3753	sp|P49005|DPOD2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.8101.4	81.7507	3	1252.6348	1252.6313	R	K	69	81
PSM	KVESLSQEAER	3754	sp|Q8WUX9|CHMP7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7408.7	63.44962	3	1274.6476	1274.6466	R	C	254	265
PSM	AGLSNYGNPR	3755	sp|O43826-2|G6PT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7963.9	78.11816	2	1047.5194	1047.5097	K	H	291	301
PSM	IQEVADELQK	3756	sp|P18085|ARF4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9293.11	113.2226	2	1171.6052	1171.6084	R	M	100	110
PSM	LSANQQNILK	3757	sp|P57088|TMM33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9042.7	106.5938	2	1127.6284	1127.6298	K	F	149	159
PSM	IQEFCNLHQSK	3758	sp|P53384-2|NUBP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	5-UNIMOD:4	ms_run[1]:scan=1.1.8648.6	96.11272	3	1402.6687	1402.6663	R	E	292	303
PSM	LVVVGAGGVGK	3759	sp|P01112-2|RASH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9389.6	115.7664	2	954.5858	954.5862	K	S	6	17
PSM	VAHVEHEETLSSR	3760	sp|P51654-3|GPC3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.7161.8	56.93305	3	1492.7287	1492.7270	K	R	398	411
PSM	GKPCETVFQR	3761	sp|Q8IZ73-2|RUSD2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	4-UNIMOD:4	ms_run[1]:scan=1.1.8083.5	81.27869	3	1220.6029	1220.5972	R	L	280	290
PSM	HLDSSSNERPDISSIQR	3762	sp|P49902|5NTC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9188.6	110.4385	4	1939.9385	1939.9348	K	R	405	422
PSM	IIHEDGFSGEDVK	3763	sp|P09471-2|GNAO_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9349.6	114.6969	3	1444.7008	1444.6834	K	Q	55	68
PSM	NRHPNFLVVEK	3764	sp|Q16864-2|VATF_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.9109.5	108.3522	3	1351.7344	1351.7361	K	D	31	42
PSM	AILHSIDCCSSDDTK	3765	sp|Q9H981|ARP8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	8-UNIMOD:4,9-UNIMOD:4	ms_run[1]:scan=1.1.8963.11	104.4999	3	1720.7377	1720.7396	K	K	514	529
PSM	NANCLATSHDGDVR	3766	sp|Q6PJI9|WDR59_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	4-UNIMOD:4	ms_run[1]:scan=1.1.7404.11	63.348	3	1528.6771	1528.6689	K	I	160	174
PSM	AQEPESGLSEETQVK	3767	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.9201.11	110.79	2	1631.787447	1630.768610	R	C	4091	4106
PSM	CCAAADPHECYAK	3768	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	1-UNIMOD:4,2-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.7455.7	64.7217	3	1552.577171	1551.590469	K	V	384	397
PSM	CCAAADPHECYAK	3769	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.8688.7	97.1894	3	1534.5608	1534.5634	K	V	384	397
PSM	VFPSHFTQQR	3770	sp|Q7Z6Z7|HUWE1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.8961.2	104.431	3	1246.631171	1245.625455	K	T	3346	3356
PSM	QEYDESGPSIVHR	3771	sp|Q9BYX7|ACTBM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.8869.2	102.0276	4	1516.702894	1515.695386	K	K	360	373
PSM	QQELTHQEHR	3772	sp|P18206|VINC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:28	ms_run[1]:scan=1.1.7189.11	57.70078	2	1287.5957	1287.5951	R	V	179	189
PSM	RPSTFGIPR	3773	sp|P78347|GTF2I_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22		ms_run[1]:scan=1.1.9241.2	111.8411	3	1030.5992	1029.5712	R	L	782	791
PSM	ASNGDAWVEAHGK	3774	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.8997.5	105.3897	3	1341.595871	1340.610928	R	L	147	160
PSM	ASNGDAWVEAHGK	3775	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.8977.6	104.865	3	1341.595871	1340.610928	R	L	147	160
PSM	MEVKPPPGRPQPDSGR	3776	sp|P51991|ROA3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1	ms_run[1]:scan=1.1.9047.6	106.7259	3	1788.8897	1788.8936	-	R	1	17
PSM	QEMQEVQSSR	3777	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:28	ms_run[1]:scan=1.1.8497.9	92.11951	2	1203.5191	1203.5185	R	S	191	201
PSM	QKLEEDAEMK	3778	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:28	ms_run[1]:scan=1.1.8894.11	102.6865	2	1202.5491	1202.5484	K	S	215	225
PSM	VDREQLVQK	3779	sp|P61981|1433G_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1	ms_run[1]:scan=1.1.8870.11	102.0685	2	1155.6232	1155.6243	M	A	2	11
PSM	CGSSEDLHDSVR	3780	sp|Q7Z4V5|HDGR2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.8545.11	93.39465	2	1343.5402	1343.5407	R	E	631	643
PSM	CGGAGHIASDCK	3781	sp|Q15637|SF01_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:385,1-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=1.1.7427.8	63.9659	2	1214.4823	1214.4803	K	F	282	294
PSM	CYNCGGLDHHAK	3782	sp|Q9H9Z2|LN28A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:385,1-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=1.1.8488.11	91.88782	2	1413.5543	1413.5549	R	E	139	151
PSM	QRQEVCQSYK	3783	sp|P08133|ANXA6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:28,6-UNIMOD:4	ms_run[1]:scan=1.1.7588.11	68.2971	2	1307.5945	1307.5923	R	S	54	64
PSM	EQYQQQQQWGSR	3784	sp|Q14103|HNRPD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.8585.3	94.43695	3	1567.720871	1564.701868	K	G	261	273
PSM	VIGSGCNLDSAR	3785	sp|Q6ZMR3|LDH6A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	6-UNIMOD:4	ms_run[1]:scan=1.1.8365.11	88.6192	2	1248.592047	1247.592835	R	F	158	170
PSM	ASGNYATVISHNPETKK	3786	sp|P62917|RL8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.8481.5	91.69566	4	1816.913694	1815.911526	R	T	129	146
PSM	SEHPPLCGR	3787	sp|Q15393|SF3B3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	7-UNIMOD:4	ms_run[1]:scan=1.1.7107.3	55.44855	3	1052.493371	1051.486913	R	D	1150	1159
PSM	SETRENGVTDDLDAPK	3788	sp|Q9BQ39|DDX50_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.8719.9	98.02563	3	1746.783971	1745.806787	K	A	45	61
PSM	QQSELQSQVR	3789	sp|Q14847|LASP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:28	ms_run[1]:scan=1.1.9142.10	109.2137	2	1184.5739	1184.5780	K	Y	76	86
PSM	VDNDENEHQLSLR	3790	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.8881.8	102.3476	3	1568.708171	1567.722663	K	T	33	46
PSM	VDNDENEHQLSLR	3791	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.8901.9	102.8624	3	1569.710171	1567.722663	K	T	33	46
PSM	VDNDENEHQLSLR	3792	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.8921.9	103.3776	3	1568.704571	1567.722663	K	T	33	46
PSM	TTEVGSVSEVKK	3793	sp|O43491-4|E41L2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1	ms_run[1]:scan=1.1.8720.10	98.05425	2	1304.6785	1304.6818	M	D	2	14
PSM	GGEIQPVSVK	3794	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.8208.8	84.50262	2	1013.556447	1012.555310	K	V	57	67
PSM	AELGAGGDGHR	3795	sp|Q14244|MAP7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1	ms_run[1]:scan=1.1.7582.9	68.13163	2	1080.5001	1080.4943	M	G	2	13
PSM	TPVEPEVAIHR	3796	sp|P60866|RS20_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.9076.10	107.5033	2	1247.662247	1246.666986	K	I	9	20
PSM	CTESEEEEVTK	3797	sp|P54578|UBP14_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.9221.11	111.3204	2	1322.5152	1322.5179	K	G	257	268
PSM	CHLLVEHETQK	3798	sp|Q9H2G2|SLK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.9318.4	113.8821	3	1375.6612	1375.6549	K	L	1153	1164
PSM	LSPQAVNSIAK	3799	sp|P30626|SORCN_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.9246.9	111.9854	2	1127.635647	1126.634623	R	R	136	147
PSM	QHICHIQGCGK	3800	sp|P08047|SP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:28,4-UNIMOD:4,9-UNIMOD:4	ms_run[1]:scan=1.1.7425.6	63.90845	3	1320.5932	1319.5862	K	V	625	636
PSM	CGHTNNLRPK	3801	sp|P62987|RL40_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.7050.4	53.91147	3	1179.5662	1178.5612	K	K	115	125
PSM	SETVICSSR	3802	sp|P50552|VASP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1,6-UNIMOD:4	ms_run[1]:scan=1.1.8984.7	105.0502	2	1079.4903	1079.4912	M	A	2	11
PSM	KNEFQGELEK	3803	sp|Q8NBJ4|GOLM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.8364.7	88.5858	3	1221.607571	1220.603717	K	Q	67	77
PSM	ALVDGPCTQVR	3804	sp|P50914|RL14_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	7-UNIMOD:4	ms_run[1]:scan=1.1.9181.3	110.2491	3	1215.609071	1214.607757	R	R	36	47
PSM	QVHPDTGISSK	3805	sp|Q96A08|H2B1A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:28	ms_run[1]:scan=1.1.7796.10	73.76002	2	1150.5637	1150.5613	K	A	49	60
PSM	QVHPDTGISSK	3806	sp|Q96A08|H2B1A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:28	ms_run[1]:scan=1.1.7816.11	74.28587	2	1150.5637	1150.5613	K	A	49	60
PSM	MLQPCGPPADKPEEN	3807	sp|Q9BWJ5|SF3B5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	5-UNIMOD:4	ms_run[1]:scan=1.1.8944.11	103.9908	2	1682.740247	1681.743992	K	-	72	87
PSM	IACAAVDCVK	3808	sp|Q14554|PDIA5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	3-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.8306.11	87.05231	2	1106.527647	1105.526001	K	D	449	459
PSM	SDKPDMAEIEK	3809	sp|P62328|TYB4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1,6-UNIMOD:35	ms_run[1]:scan=1.1.7533.8	66.81033	3	1320.6052	1319.5912	M	F	2	13
PSM	QTPAGPETEEEPYR	3810	sp|Q13505|MTX1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.8729.11	98.29881	2	1603.716847	1602.716181	R	R	403	417
PSM	PAQPQEHPFASSR	3811	sp|Q15437|SC23B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.7559.7	67.50808	3	1450.694771	1450.695326	R	F	218	231
PSM	ANGTTVHVGIHPSK	3812	sp|Q9UNX3|RL26L_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.7774.3	73.18253	4	1418.735694	1416.747361	K	V	90	104
PSM	LKPGGVGAPSSSSPSPSPSAR	3813	sp|Q92797|SYMPK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.7911.9	76.74675	3	1920.972071	1921.985754	K	P	1159	1180
PSM	SDAGLESDTAMK	3814	sp|Q9NR30|DDX21_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.8225.5	84.94062	2	1222.527247	1223.533982	R	K	7	19
PSM	TDRPLPENPYHSR	3815	sp|P51970|NDUA8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.8319.7	87.39097	4	1580.773694	1580.769554	K	P	133	146
PSM	TLTQGGVTYR	3816	sp|Q13643|FHL3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.8351.10	88.24332	2	1095.554847	1094.572023	K	D	168	178
PSM	TAVCDIPPR	3817	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	4-UNIMOD:4	ms_run[1]:scan=1.1.8400.10	89.54961	2	1028.512447	1027.512065	K	G	351	360
PSM	SISADDDLQESSR	3818	sp|P18615|NELFE_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.8499.10	92.17353	2	1420.614647	1421.627031	R	R	113	126
PSM	TRTEELIVQTK	3819	sp|Q9BYT8|NEUL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.8531.6	93.0111	3	1318.739771	1316.729980	K	Q	59	70
PSM	ERHPGSFDVVHVK	3820	sp|P62701|RS4X_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.8664.9	96.54613	3	1506.775571	1505.773911	R	D	199	212
PSM	GDATVSYEDPPTAK	3821	sp|Q01844|EWS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.8680.11	96.9801	2	1451.667447	1449.662354	K	A	411	425
PSM	IGAEVYHNLK	3822	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.8757.4	99.04317	3	1145.613671	1142.608408	R	N	184	194
PSM	NNASTDYDLSDK	3823	sp|P39023|RL3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.8823.8	100.8283	2	1342.548047	1341.568454	K	S	301	313
PSM	IQFKPDDGTTPER	3824	sp|Q96AE4|FUBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.8899.9	102.8144	2	1501.717447	1502.736522	R	I	309	322
PSM	PVSSAASVYAGAGGSGSR	3825	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.9010.11	105.7455	2	1579.741847	1579.759048	R	I	28	46
PSM	AGDLLEDSPK	3826	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.9240.7	111.8228	2	1042.515647	1043.513505	R	R	158	168
PSM	DLLHPSPEEEK	3827	sp|P42677|RS27_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.9404.7	116.1724	2	1291.622847	1292.624846	K	R	6	17
PSM	GDTPGHATPGHGGATSSAR	3828	sp|O75533|SF3B1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.6546.3	41.43553	4	1732.7913	1732.7877	R	K	271	290
PSM	NRPAPYSRPK	3829	sp|Q86V81|THOC4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.6817.3	47.70177	3	1184.6455	1184.6414	R	Q	72	82
PSM	YGDGPRPPK	3830	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.6991.3	52.36232	3	985.5019	985.4981	R	M	1155	1164
PSM	KGEITGEVR	3831	sp|P21333|FLNA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.7066.4	54.34986	3	987.538571	987.534909	K	M	1801	1810
PSM	GPPCGPVNCNEK	3832	sp|Q06323-2|PSME1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	4-UNIMOD:4,9-UNIMOD:4	ms_run[1]:scan=1.1.7277.11	60.0054	2	1327.5638	1327.5649	K	I	98	110
PSM	AGVLAGHDNR	3833	sp|P62873-2|GBB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.6969.3	51.7866	3	1008.5131	1008.5101	R	V	305	315
PSM	QAHVELAER	3834	sp|P28340|DPOD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7355.3	62.01717	3	1051.5460	1051.5410	K	M	898	907
PSM	HPFIVNHPK	3835	sp|P55265-2|DSRAD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7350.2	61.88047	3	1087.5961	1087.5927	R	V	1071	1080
PSM	SFHPEQDAGK	3836	sp|Q9BV38|WDR18_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7069.4	54.43196	3	1114.5091	1114.5043	R	V	254	264
PSM	AEGYEVAHGGR	3837	sp|P53041|PPP5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7124.7	55.92003	3	1144.5394	1144.5261	K	C	431	442
PSM	QVHPDTGISSK	3838	sp|P33778|H2B1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7029.7	53.3412	3	1167.5938	1167.5884	K	A	48	59
PSM	QVHPDTGISSK	3839	sp|P33778|H2B1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7048.8	53.86397	3	1167.5911	1167.5884	K	A	48	59
PSM	SVSGTDVQEECREK	3840	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	11-UNIMOD:4	ms_run[1]:scan=1.1.7168.5	57.11852	4	1622.7233	1622.7206	K	G	244	258
PSM	RGFSDSGGGPPAK	3841	sp|Q9H307|PININ_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7114.8	55.64835	3	1231.5988	1231.5946	R	Q	63	76
PSM	ADKNEVAAEVAK	3842	sp|P56192|SYMC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7339.9	61.5952	3	1243.6447	1243.6408	K	L	864	876
PSM	GTGHVSSGYVER	3843	sp|Q6IN85-2|P4R3A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7144.6	56.46465	3	1247.5939	1247.5895	R	L	23	35
PSM	LNGTLREDDNR	3844	sp|Q15637-3|SF01_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7160.3	56.89753	3	1301.6353	1301.6324	R	I	250	261
PSM	IIECTHCGCR	3845	sp|P41223|BUD31_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	4-UNIMOD:4,7-UNIMOD:4,9-UNIMOD:4	ms_run[1]:scan=1.1.6988.4	52.28642	3	1304.5462	1304.5424	R	G	131	141
PSM	MIASDSHRPEVK	3846	sp|Q9NYF8-2|BCLF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7145.5	56.49042	3	1368.6835	1368.6820	K	L	535	547
PSM	NSRPEANEALER	3847	sp|Q9Y696|CLIC4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7331.5	61.38225	3	1384.6564	1384.6694	K	G	131	143
PSM	HVVQSISTQQEK	3848	sp|P24539|AT5F1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7110.7	55.53703	3	1382.7202	1382.7154	K	E	222	234
PSM	GTHQLYSTSHDR	3849	sp|O43818|U3IP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7029.8	53.34286	3	1400.6494	1400.6433	R	S	252	264
PSM	ESEPQAAAEPAEAK	3850	sp|P80723|BASP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7313.8	60.91745	3	1426.6588	1426.6575	K	E	39	53
PSM	CYNCGGLDHHAK	3851	sp|Q9H9Z2|LN28A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	1-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=1.1.7061.8	54.2191	3	1430.5855	1430.5820	R	E	139	151
PSM	HLVYESDK	3852	sp|Q15293|RCN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7238.5	59.0011	2	989.4824	989.4818	R	N	287	295
PSM	VKAEGPGLSR	3853	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7110.2	55.5287	3	1012.5709	1012.5665	K	T	875	885
PSM	HVTNPAFTK	3854	sp|Q92922|SMRC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7328.8	61.31098	2	1013.5296	1013.5294	K	L	95	104
PSM	HQQLLEEK	3855	sp|P35580-3|MYH10_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7306.6	60.73613	2	1023.5366	1023.5349	K	N	903	911
PSM	GFSDSGGGPPAK	3856	sp|Q9H307|PININ_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7305.5	60.71575	2	1075.4968	1075.4935	R	Q	64	76
PSM	GQGSSPVAMQK	3857	sp|P18206|VINC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7203.7	58.07627	2	1088.5306	1088.5284	R	A	342	353
PSM	GGREDMDISK	3858	sp|P49321|NASP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7198.3	57.93295	3	1106.5069	1106.5026	K	S	181	191
PSM	RHLTGEFEK	3859	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7278.6	60.02285	3	1115.5756	1115.5723	K	K	29	38
PSM	RHLTGEFEK	3860	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7258.4	59.50618	3	1115.5756	1115.5723	K	K	29	38
PSM	LQTASDESYK	3861	sp|Q13813|SPTN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7300.6	60.58925	2	1140.5372	1140.5299	K	D	1571	1581
PSM	TAVAHRPGAFK	3862	sp|Q969H8|MYDGF_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7046.3	53.8007	3	1153.6420	1153.6356	K	A	146	157
PSM	NTAELQPESGK	3863	sp|O15355|PPM1G_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7193.8	57.80463	2	1172.5688	1172.5673	R	R	509	520
PSM	HQGVMVGMGQK	3864	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	8-UNIMOD:35	ms_run[1]:scan=1.1.6981.11	52.11815	2	1186.5610	1186.5587	R	D	40	51
PSM	LQNSYQPTNK	3865	sp|Q7L014|DDX46_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7235.7	58.92442	2	1191.5864	1191.5884	R	G	1016	1026
PSM	ACFHCETCK	3866	sp|Q14847-2|LASP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	2-UNIMOD:4,5-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.6980.10	52.09063	2	1211.4534	1211.4522	K	M	28	37
PSM	QEMQEVQSSR	3867	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7122.9	55.86858	2	1220.5464	1220.5455	R	S	179	189
PSM	EGALCEENMR	3868	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	5-UNIMOD:4,9-UNIMOD:35	ms_run[1]:scan=1.1.7207.9	58.18572	2	1223.4922	1223.4910	K	G	689	699
PSM	KEVVEEAENGR	3869	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7103.11	55.35243	2	1258.6174	1258.6153	K	D	21	32
PSM	ESQSPDTTIQR	3870	sp|Q92973-2|TNPO1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7258.10	59.51618	2	1260.5930	1260.5946	K	T	21	32
PSM	AAGTDGSDFQHR	3871	sp|Q8N5M9|JAGN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7082.10	54.79538	2	1260.5518	1260.5483	R	E	9	21
PSM	LNHQEVVEEDK	3872	sp|O95926|SYF2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7134.8	56.1961	3	1338.6520	1338.6415	K	R	50	61
PSM	QLQSEQPQTAAAR	3873	sp|Q9UI12-2|VATH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7234.10	58.89738	2	1426.7148	1426.7164	K	S	452	465
PSM	AEDGATPSPSNETPK	3874	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7165.10	57.0452	2	1499.6754	1499.6740	K	K	138	153
PSM	CCAAADPHECYAK	3875	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	1-UNIMOD:4,2-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.7283.9	60.15765	3	1551.5926	1551.5905	K	V	384	397
PSM	QEEERQDGGQNESFK	3876	sp|Q7L014|DDX46_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7081.11	54.76982	3	1779.7687	1779.7660	K	R	916	931
PSM	EHGAFDAVK	3877	sp|P11586|C1TC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7623.3	69.22455	3	972.4699	972.4665	R	C	776	785
PSM	IDDIVSGHK	3878	sp|P49368|TCPG_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7549.3	67.23213	3	982.5112	982.5084	R	K	519	528
PSM	AKFENLCK	3879	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	7-UNIMOD:4	ms_run[1]:scan=1.1.7649.2	69.92342	3	1008.5113	1008.5062	K	F	558	566
PSM	IHNADVTLR	3880	sp|Q9Y295|DRG1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7623.4	69.22622	3	1037.5678	1037.5618	K	S	214	223
PSM	ANGTTVHVGIHPSK	3881	sp|Q9UNX3|RL26L_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7457.3	64.76915	4	1416.7513	1416.7474	K	V	90	104
PSM	KDGEDEFVK	3882	sp|Q5T7N2|LITD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7550.5	67.26237	3	1065.5017	1065.4978	R	E	201	210
PSM	RVAAMSVAQR	3883	sp|O43143|DHX15_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7404.3	63.33467	3	1087.5958	1087.5920	R	V	195	205
PSM	RVAAMSVAQR	3884	sp|O43143|DHX15_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7402.3	63.28032	3	1087.5958	1087.5920	R	V	195	205
PSM	RVAAMSVAQR	3885	sp|O43143|DHX15_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7400.3	63.22622	3	1087.5958	1087.5920	R	V	195	205
PSM	RVAAMSVAQR	3886	sp|O43143|DHX15_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7403.5	63.31072	3	1087.5958	1087.5920	R	V	195	205
PSM	IANPVEGSSGR	3887	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7693.3	71.09007	3	1085.5501	1085.5465	K	Q	315	326
PSM	SSHAVELACR	3888	sp|Q9UBB4|ATX10_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	9-UNIMOD:4	ms_run[1]:scan=1.1.7358.6	62.10278	3	1128.5422	1128.5346	K	D	57	67
PSM	IHCLENVDK	3889	sp|Q01082-2|SPTB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	3-UNIMOD:4	ms_run[1]:scan=1.1.7565.6	67.6679	3	1126.5451	1126.5441	R	A	110	119
PSM	FRPPETTER	3890	sp|Q96P70|IPO9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7604.4	68.71723	3	1131.5731	1131.5673	K	A	96	105
PSM	KLQEYNVGGK	3891	sp|P46379-2|BAG6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7540.7	66.99702	3	1134.5956	1134.6033	K	V	71	81
PSM	NGKPISSSYVK	3892	sp|P17858-2|PFKAL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7393.4	63.03918	3	1178.6329	1178.6295	R	D	317	328
PSM	TENNDHINLK	3893	sp|P61956-2|SUMO2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7387.4	62.87668	3	1196.5807	1196.5785	K	V	12	22
PSM	DSYVGDEAQSK	3894	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7356.2	62.04237	3	1197.5191	1197.5150	K	R	51	62
PSM	ALQASALK	3895	sp|P04075-2|ALDOA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7666.6	70.38558	2	800.4772	800.4756	R	A	359	367
PSM	NRQEYDALAK	3896	sp|Q6I9Y2|THOC7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7677.4	70.66817	3	1206.6052	1206.5993	K	V	115	125
PSM	EGVKTENNDHINLK	3897	sp|P61956-2|SUMO2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7618.6	69.09458	4	1609.8109	1609.8060	K	V	8	22
PSM	YCDPDSYHR	3898	sp|P26368-2|U2AF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	2-UNIMOD:4	ms_run[1]:scan=1.1.7478.4	65.3403	3	1211.4712	1211.4666	K	R	459	468
PSM	HHVLGTITTDK	3899	sp|Q5JPE7-2|NOMO2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7607.6	68.79978	3	1220.6491	1220.6514	R	M	666	677
PSM	GTPGPPPAHGAALQPHPR	3900	sp|Q15654|TRIP6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7676.6	70.64552	4	1756.9093	1756.9121	R	V	26	44
PSM	KPEVTCTLEDK	3901	sp|Q96EI5-2|TCAL4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	6-UNIMOD:4	ms_run[1]:scan=1.1.7696.9	71.18042	3	1318.6444	1318.6439	R	K	172	183
PSM	GDSSHVVSEGVPR	3902	sp|Q9NUP1|BL1S4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1000663, ProteinPilot, ]	21		ms_run[1]:scan=1.1.7653.7	70.0398	3	1324.64047064349	1324.63714191932	R	I	108	121
PSM	ELQHAALGGTATR	3903	sp|O14828-2|SCAM3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7572.7	67.85807	3	1323.6886	1323.6895	R	Q	93	106
PSM	AISSSAISR	3904	sp|Q16630-2|CPSF6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7452.8	64.6422	2	890.4802	890.4821	R	A	460	469
PSM	AGDEFVEK	3905	sp|Q16836-2|HCDH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7650.9	69.96205	2	893.4152	893.4131	K	T	147	155
PSM	VVPTTDHIDTEK	3906	sp|O75663|TIPRL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7644.8	69.79885	3	1353.6790	1353.6776	K	L	129	141
PSM	AVELAANTK	3907	sp|P29401-2|TKT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7397.10	63.15714	2	915.5048	915.5025	K	G	465	474
PSM	AVELAANTK	3908	sp|P29401-2|TKT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7393.7	63.04418	2	915.5048	915.5025	K	G	465	474
PSM	AVELAANTK	3909	sp|P29401-2|TKT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7390.7	62.9629	2	915.5048	915.5025	K	G	465	474
PSM	AVELAANTK	3910	sp|P29401-2|TKT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7387.7	62.88168	2	915.5048	915.5025	K	G	465	474
PSM	AVELAANTK	3911	sp|P29401-2|TKT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7386.7	62.85465	2	915.5048	915.5025	K	G	465	474
PSM	AVELAANTK	3912	sp|P29401-2|TKT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7383.6	62.7722	2	915.5048	915.5025	K	G	465	474
PSM	AVELAANTK	3913	sp|P29401-2|TKT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7392.10	63.02197	2	915.5048	915.5025	K	G	465	474
PSM	AVELAANTK	3914	sp|P29401-2|TKT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7389.6	62.93403	2	915.5048	915.5025	K	G	465	474
PSM	AVELAANTK	3915	sp|P29401-2|TKT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7394.6	63.06948	2	915.5048	915.5025	K	G	465	474
PSM	LAAVVSACK	3916	sp|P78527|PRKDC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	8-UNIMOD:4	ms_run[1]:scan=1.1.7704.7	71.39138	2	917.4996	917.5004	R	Q	1448	1457
PSM	TLNAGAYSK	3917	sp|P50897-2|PPT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7483.5	65.4774	2	923.4714	923.4712	K	V	63	72
PSM	NIEEHASSDVER	3918	sp|Q92930|RAB8B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7369.9	62.401	3	1384.6270	1384.6219	R	M	105	117
PSM	GGGGGFGYQK	3919	sp|Q9NVP1|DDX18_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7624.6	69.25652	2	926.4256	926.4247	R	T	636	646
PSM	THLSLSHNPEQK	3920	sp|P11586|C1TC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7413.5	63.5815	3	1389.7006	1389.7001	K	G	867	879
PSM	SGKPAELLK	3921	sp|P29401-2|TKT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7521.6	66.4848	2	941.5550	941.5545	R	M	603	612
PSM	SVLGEADQK	3922	sp|P49588|SYAC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7577.9	67.99658	2	945.4774	945.4767	R	G	617	626
PSM	HLTGEFEK	3923	sp|P62826|RAN_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7505.7	66.06042	2	959.4728	959.4712	R	K	30	38
PSM	KNCPHIVVGTPGR	3924	sp|Q13838-2|DX39B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	3-UNIMOD:4	ms_run[1]:scan=1.1.7670.7	70.4916	3	1433.7586	1433.7562	K	I	178	191
PSM	DAHSTLLSK	3925	sp|Q9BPW8|NIPS1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7506.2	66.07829	3	970.5118	970.5083	K	K	57	66
PSM	DAHSTLLSK	3926	sp|Q9BPW8|NIPS1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7505.2	66.05209	3	970.5118	970.5083	K	K	57	66
PSM	IGHPAPNFK	3927	sp|Q06830|PRDX1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7652.3	70.0061	3	979.5301	979.5239	K	A	8	17
PSM	EYTAAVEAK	3928	sp|Q99623|PHB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7430.10	64.0502	2	980.4848	980.4814	R	Q	192	201
PSM	EPSEVPTPK	3929	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7537.10	66.9214	2	982.4992	982.4971	K	R	47	56
PSM	LLADQAEAR	3930	sp|P84098|RL19_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7623.8	69.23288	2	985.5210	985.5192	K	R	154	163
PSM	SEAGLAGAPAR	3931	sp|Q92572|AP3S1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7437.6	64.23309	2	998.5166	998.5145	K	A	150	161
PSM	SGINCPIQK	3932	sp|P61916|NPC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	5-UNIMOD:4	ms_run[1]:scan=1.1.7636.8	69.58352	2	1015.5122	1015.5121	K	D	95	104
PSM	AQHEQYVAEAEEK	3933	sp|Q9UDT6|CLIP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7661.8	70.25723	3	1530.6970	1530.6950	K	L	401	414
PSM	LEQIAAEQK	3934	sp|Q9UKM9-2|RALY_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7531.9	66.7582	2	1028.5512	1028.5502	R	A	192	201
PSM	AMNGESLDGR	3935	sp|P98179|RBM3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7704.10	71.39639	2	1048.4638	1048.4607	R	Q	66	76
PSM	KSDPVVSYR	3936	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7439.7	64.28909	2	1049.5510	1049.5506	K	E	572	581
PSM	VYSTSVTGSR	3937	sp|Q9H299|SH3L3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7436.8	64.20918	2	1055.5262	1055.5248	R	E	6	16
PSM	AAIISAEGDSK	3938	sp|P35232|PHB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7686.9	70.91228	2	1060.5402	1060.5400	K	A	209	220
PSM	LAGENMTGAAK	3939	sp|O95831|AIFM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7491.9	65.69445	2	1061.5182	1061.5175	R	P	464	475
PSM	AHIAQLCEK	3940	sp|Q00610-2|CLH1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	7-UNIMOD:4	ms_run[1]:scan=1.1.7443.8	64.39899	2	1068.5394	1068.5386	R	A	611	620
PSM	ETCFAEEGK	3941	sp|P02768|ALBU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	3-UNIMOD:4	ms_run[1]:scan=1.1.7527.9	66.65048	2	1069.4414	1069.4386	K	K	589	598
PSM	TTTGSYIANR	3942	sp|P28072|PSB6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7610.11	68.8876	2	1082.5362	1082.5356	R	V	54	64
PSM	EATDEELER	3943	sp|Q13619|CUL4A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7454.10	64.69962	2	1090.4822	1090.4778	K	T	423	432
PSM	GAGTDDSTLVR	3944	sp|P20073-2|ANXA7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7608.9	68.83118	2	1090.5254	1090.5255	K	I	409	420
PSM	KIGDTSVSYK	3945	sp|P20700|LMNB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7643.9	69.77355	2	1096.5774	1096.5764	R	Y	474	484
PSM	KGTVACGQPPVVENAK	3946	sp|P13611|CSPG2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	6-UNIMOD:4	ms_run[1]:scan=1.1.7621.8	69.17883	3	1653.8518	1653.8508	K	T	3291	3307
PSM	TQLAVCQQR	3947	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	6-UNIMOD:4	ms_run[1]:scan=1.1.7628.9	69.36927	2	1102.5556	1102.5553	K	I	391	400
PSM	ADILEDKDGK	3948	sp|P52272-2|HNRPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7558.8	67.48268	2	1102.5520	1102.5506	R	S	194	204
PSM	SNQQNLGTIK	3949	sp|P23921|RIR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7534.11	66.84227	2	1101.5802	1101.5778	K	C	415	425
PSM	TVVPCCSGPK	3950	sp|P21399|ACOC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	5-UNIMOD:4,6-UNIMOD:4	ms_run[1]:scan=1.1.7492.10	65.72231	2	1103.5114	1103.5104	K	R	365	375
PSM	LYCNVDSNK	3951	sp|Q01780|EXOSX_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	3-UNIMOD:4	ms_run[1]:scan=1.1.7410.9	63.50706	2	1111.4970	1111.4968	K	Q	409	418
PSM	SYSEDDIHR	3952	sp|Q9Y5A9-2|YTHD2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7500.9	65.93173	2	1120.4796	1120.4785	K	S	367	376
PSM	ALAEGPGAEGPR	3953	sp|Q13263|TIF1B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1000663, ProteinPilot, ]	21		ms_run[1]:scan=1.1.7640.11	69.69615	2	1123.5638470956603	1123.56218607391	M	L	580	592
PSM	LIANNTTVER	3954	sp|O96019|ACL6A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7676.8	70.64885	2	1129.6090	1129.6091	K	R	380	390
PSM	ILQEHEQIK	3955	sp|Q14152|EIF3A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7411.10	63.53577	2	1136.6208	1136.6189	R	K	624	633
PSM	TCEESSFCK	3956	sp|Q14697|GANAB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	2-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.7403.10	63.31905	2	1146.4330	1146.4322	K	R	40	49
PSM	TPEEYPESAK	3957	sp|O94760|DDAH1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7374.8	62.53259	2	1149.5188	1149.5190	R	V	238	248
PSM	YTAQVDAEEK	3958	sp|O75947|ATP5H_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7402.11	63.29365	2	1152.5312	1152.5299	K	E	86	96
PSM	SSAVDPEPQVK	3959	sp|Q5SSJ5|HP1B3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7586.10	68.24139	2	1155.5778	1155.5772	R	L	248	259
PSM	AVQVHQDTLR	3960	sp|Q9UKV8|AGO2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7363.4	62.2333	3	1165.6240	1165.6204	K	T	845	855
PSM	FQDDNVEGDK	3961	sp|Q92621|NU205_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7428.11	63.9979	2	1165.4920	1165.4888	K	V	1733	1743
PSM	AIEENNNFSK	3962	sp|P16949-2|STMN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7630.10	69.42496	2	1164.5428	1164.5411	K	M	86	96
PSM	LVGEIKEEEK	3963	sp|Q9Y2Z0-2|SGT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7612.11	68.94118	2	1172.6318	1172.6288	K	N	258	268
PSM	LECVEPNCR	3964	sp|P83881|RL36A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	3-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.7691.11	71.04978	2	1175.5062	1175.5063	R	S	70	79
PSM	QQSELQSQVR	3965	sp|Q14847-2|LASP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7470.11	65.1352	2	1201.6072	1201.6051	K	Y	76	86
PSM	LSSDVCPTSDK	3966	sp|P11717|MPRI_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	6-UNIMOD:4	ms_run[1]:scan=1.1.7390.11	62.96957	2	1207.5428	1207.5391	K	S	1265	1276
PSM	SAEAGIAGEAQSK	3967	sp|Q7Z478|DHX29_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7467.11	65.0537	2	1217.5914	1217.5888	K	K	27	40
PSM	NGYEYEESTK	3968	sp|O75717|WDHD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7676.9	70.65052	2	1218.5066	1218.5040	K	N	745	755
PSM	YELGRPAANTK	3969	sp|P62241|RS8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7692.6	71.06827	3	1218.6391	1218.6357	K	I	27	38
PSM	GHLENNPALEK	3970	sp|P05388-2|RLA0_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7360.11	62.1645	2	1220.6154	1220.6149	R	L	67	78
PSM	YLQDNPASGEK	3971	sp|Q16850-2|CP51A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7541.11	67.03049	2	1220.5796	1220.5673	R	F	327	338
PSM	GNWEQPQNQNQTQHK	3972	sp|Q14157-5|UBP2L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7380.9	62.69603	3	1835.8321	1835.8299	R	Q	12	27
PSM	VLANPGNSQVAR	3973	sp|Q14974|IMB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7573.10	67.8901	2	1224.6590	1224.6575	R	V	43	55
PSM	MQTYQDAESR	3974	sp|Q9H857-2|NT5D2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7533.11	66.81533	2	1227.5200	1227.5190	R	Q	448	458
PSM	EQLEEEEEAK	3975	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7408.11	63.45628	2	1232.5406	1232.5408	R	H	1343	1353
PSM	RIVAVTGAEAQK	3976	sp|P49588|SYAC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7426.11	63.9439	2	1241.7112	1241.7092	R	A	751	763
PSM	YSNSEVVTGSGR	3977	sp|Q7L576|CYFP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7519.10	66.43788	2	1254.5864	1254.5840	R	Q	366	378
PSM	RQQEVETELK	3978	sp|P08621|RU17_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7402.5	63.28365	3	1258.6534	1258.6517	R	M	78	88
PSM	IFCSEDEQSR	3979	sp|Q14451-2|GRB7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	3-UNIMOD:4	ms_run[1]:scan=1.1.7707.9	71.4752	2	1269.5300	1269.5296	R	T	317	327
PSM	TVLDQQQTPSR	3980	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7654.9	70.07015	2	1271.6472	1271.6470	K	L	1129	1140
PSM	AVAHHTTAAFIR	3981	sp|P43686|PRS6B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7625.7	69.28519	3	1293.6973	1293.6942	K	V	218	230
PSM	GPPPPPTASEPTR	3982	sp|O14776-2|TCRG1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7563.9	67.6192	2	1302.6454	1302.6568	R	R	1061	1074
PSM	LNGHQLENHALK	3983	sp|Q9NZI8|IF2B1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7669.11	70.47218	2	1372.7240	1372.7211	K	V	139	151
PSM	EADLAAQEEAAKK	3984	sp|Q9Y3B7-2|RM11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7526.11	66.62701	2	1372.6860	1372.6834	K	-	154	167
PSM	QVQSQAHGLQMR	3985	sp|Q14683|SMC1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7606.9	68.77837	3	1381.6939	1381.6885	R	L	700	712
PSM	HQEAEMAQNAVR	3986	sp|P35222|CTNB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7356.11	62.05737	2	1382.6376	1382.6361	R	L	475	487
PSM	SSLSNNECGSLDK	3987	sp|Q5UIP0|RIF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	8-UNIMOD:4	ms_run[1]:scan=1.1.7654.10	70.07182	2	1409.6122	1409.6093	K	T	1148	1161
PSM	EELEEEQRTEE	3988	sp|P84157-2|MXRA7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7577.11	67.99992	2	1419.5994	1419.6001	K	-	160	171
PSM	RTVDLSSHLAK	3989	sp|P04843|RPN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8040.3	80.1242	4	1225.6841	1225.6779	K	V	38	49
PSM	RLQTQVFK	3990	sp|P46781|RS9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8061.3	80.68964	3	1018.5958	1018.5924	R	L	109	117
PSM	KNIILEEGK	3991	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8057.2	80.58051	3	1042.6063	1042.6022	K	E	45	54
PSM	IANPVEGSTDR	3992	sp|Q15366-2|PCBP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7986.2	78.70783	3	1157.5717	1157.5677	K	Q	324	335
PSM	GAGWTGHVAGTR	3993	sp|Q15274|NADC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8013.4	79.40542	3	1168.5760	1168.5738	R	K	127	139
PSM	LLEVQGSRPGK	3994	sp|P62136|PP1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7749.4	72.54217	3	1182.6745	1182.6721	R	N	16	27
PSM	RFPGYDSESK	3995	sp|P46777|RL5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8071.3	80.95533	3	1184.5495	1184.5462	K	E	179	189
PSM	IMGPNYTPGKK	3996	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7992.6	78.86761	3	1204.6297	1204.6274	R	E	429	440
PSM	QGQPVLVSGVHK	3997	sp|Q7LBC6|KDM3B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8072.5	80.98512	3	1247.7037	1247.6986	K	K	1411	1423
PSM	VGEVIVTK	3998	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7872.6	75.72929	2	843.5078	843.5066	K	D	345	353
PSM	VGQDPVLR	3999	sp|Q04837|SSBP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7817.7	74.306	2	882.4940	882.4923	R	Q	39	47
PSM	AGLQVYNK	4000	sp|P13987|CD59_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8042.5	80.18142	2	891.4824	891.4814	K	C	56	64
PSM	HFELGGDK	4001	sp|P83881|RL36A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7940.7	77.50359	2	901.4298	901.4294	K	K	90	98
PSM	TDEGIAYR	4002	sp|P32119|PRDX2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7861.7	75.43757	2	923.4350	923.4348	K	G	120	128
PSM	TDEGIAYR	4003	sp|P32119|PRDX2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7840.6	74.89484	2	923.4350	923.4348	K	G	120	128
PSM	AYDIAGSTK	4004	sp|P11388-4|TOP2A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7786.7	73.49903	2	924.4558	924.4552	R	D	243	252
PSM	DLEDGEVPQHAGK	4005	sp|Q15059|BRD3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8075.5	81.06477	3	1393.6498	1393.6474	K	K	292	305
PSM	NADHSMNYQYR	4006	sp|Q12906-7|ILF3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7928.7	77.19172	3	1397.5786	1397.5782	R	-	888	899
PSM	SVGIVTTTR	4007	sp|P05186|PPBT_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7997.5	78.99375	2	932.5298	932.5291	K	V	160	169
PSM	RAGELTEDEVER	4008	sp|P62269|RS18_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7906.6	76.61417	3	1402.6711	1402.6688	K	V	55	67
PSM	VGTIDDDPEYRK	4009	sp|Q9BZI7-2|REN3B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8019.6	79.56588	3	1406.6713	1406.6678	K	F	151	163
PSM	VAVQGDVVR	4010	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7800.6	73.85615	2	941.5300	941.5294	R	E	757	766
PSM	KGSQFGQSCCLR	4011	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	9-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.7888.9	76.15622	3	1426.6411	1426.6446	K	A	328	340
PSM	ALQSLACGKPTQR	4012	sp|Q13618-2|CUL3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	7-UNIMOD:4	ms_run[1]:scan=1.1.7945.7	77.63365	3	1428.7528	1428.7507	R	V	606	619
PSM	TAAYGHFGR	4013	sp|P31153|METK2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7865.9	75.5472	2	978.4674	978.4672	R	D	374	383
PSM	HEQNIDCGGGYVK	4014	sp|P27797|CALR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	7-UNIMOD:4	ms_run[1]:scan=1.1.7822.11	74.44389	3	1475.6488	1475.6463	K	L	99	112
PSM	DGEQHEDLNEVAK	4015	sp|O95831|AIFM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7755.9	72.70333	3	1482.6583	1482.6586	K	L	594	607
PSM	LQSIGTENTEENR	4016	sp|P04075-2|ALDOA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7925.8	77.1148	3	1489.7029	1489.7008	R	R	98	111
PSM	TGRFEEAAGAAPCR	4017	sp|Q9Y4P3|TBL2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	13-UNIMOD:4	ms_run[1]:scan=1.1.8081.9	81.2316	3	1491.6937	1491.6888	K	L	323	337
PSM	LQHAAELIK	4018	sp|Q8WUM4-2|PDC6I_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7958.2	77.97176	3	1021.5940	1021.5920	R	T	282	291
PSM	EHTAYYIK	4019	sp|P31930|QCR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7828.11	74.59743	2	1023.5012	1023.5025	R	A	127	135
PSM	TAVCDIPPR	4020	sp|Q9BVA1|TBB2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	4-UNIMOD:4	ms_run[1]:scan=1.1.8064.7	80.77682	2	1027.5126	1027.5121	K	G	351	360
PSM	KQQNQELQEQLR	4021	sp|Q14980-2|NUMA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7932.9	77.29913	3	1540.7956	1540.7957	K	S	1611	1623
PSM	TAVCDIPPR	4022	sp|Q9BVA1|TBB2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	4-UNIMOD:4	ms_run[1]:scan=1.1.8018.10	79.54612	2	1027.5166	1027.5121	K	G	351	360
PSM	KNIILEEGK	4023	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8052.5	80.45105	2	1042.6030	1042.6022	K	E	45	54
PSM	QLETLGQEK	4024	sp|P05787-2|K2C8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7981.10	78.59475	2	1044.5456	1044.5451	R	L	178	187
PSM	ELGSSTNALR	4025	sp|P08579|RU2B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7996.5	78.96817	2	1046.5342	1046.5356	K	Q	58	68
PSM	STCIYGGAPK	4026	sp|Q92841-3|DDX17_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	3-UNIMOD:4	ms_run[1]:scan=1.1.7964.9	78.1449	2	1052.4958	1052.4961	K	G	196	206
PSM	GSAYLEAGGTK	4027	sp|Q5RKV6|EXOS6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7788.10	73.55534	2	1052.5138	1052.5138	K	V	51	62
PSM	DYGNSPLHR	4028	sp|P26599-2|PTBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7761.3	72.84612	3	1057.4965	1057.4941	K	F	448	457
PSM	TADDSATSDYCPAPK	4029	sp|Q9UBC3-2|DNM3B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	11-UNIMOD:4	ms_run[1]:scan=1.1.7877.11	75.87188	3	1597.6603	1597.6566	R	R	363	378
PSM	STSEENIGIK	4030	sp|Q92990|GLMN_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8014.11	79.44293	2	1076.5342	1076.5349	K	-	585	595
PSM	EADQTHAQNFSSAVK	4031	sp|Q5SNT2|TM201_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7957.10	77.95803	3	1631.7475	1631.7540	R	S	195	210
PSM	TTEVTGTGLGR	4032	sp|Q8WYP5-2|ELYS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7853.10	75.23637	2	1090.5588	1090.5619	K	N	2273	2284
PSM	GPLPLSSQHR	4033	sp|P43243|MATR3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7879.3	75.91187	3	1090.5922	1090.5883	R	G	93	103
PSM	KADNVVNIAR	4034	sp|Q92621|NU205_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7772.8	73.13858	2	1098.6152	1098.6145	K	Y	892	902
PSM	LSQETEALGR	4035	sp|Q02818|NUCB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8047.9	80.32298	2	1102.5632	1102.5618	R	S	368	378
PSM	LIEVDDERK	4036	sp|P62753|RS6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7745.8	72.4484	2	1115.5840	1115.5822	K	L	15	24
PSM	EYAENIGDGR	4037	sp|Q8WYA6-4|CTBL1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8050.10	80.40563	2	1122.4972	1122.4941	K	S	508	518
PSM	NGYDYGQCR	4038	sp|Q13242|SRSF9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	8-UNIMOD:4	ms_run[1]:scan=1.1.7775.10	73.22037	2	1131.4396	1131.4404	R	L	73	82
PSM	NGELENIKPK	4039	sp|P68402|PA1B2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7937.9	77.42885	2	1140.6108	1140.6138	K	V	87	97
PSM	DSAVAISGADSR	4040	sp|Q7Z6Z7-2|HUWE1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7832.10	74.69945	2	1147.5626	1147.5469	R	G	2930	2942
PSM	VATSSLDQTVK	4041	sp|Q9BV38|WDR18_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8034.9	79.973	2	1147.6090	1147.6085	R	L	189	200
PSM	AEDGENYDIK	4042	sp|O75347|TBCA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7938.10	77.45658	2	1152.4918	1152.4935	R	K	42	52
PSM	EINTNQEALK	4043	sp|Q93050-1|VPP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7753.7	72.65573	2	1158.5880	1158.5880	K	R	110	120
PSM	IQSQFTDAQK	4044	sp|P15924|DESP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7854.10	75.2624	2	1164.5758	1164.5775	K	H	608	618
PSM	LQAVTDDHIR	4045	sp|P30043|BLVRB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8032.5	79.91251	3	1166.6089	1166.6044	R	M	125	135
PSM	GAGWTGHVAGTR	4046	sp|Q15274|NADC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8000.11	79.08047	2	1168.5724	1168.5738	R	K	127	139
PSM	QGDNCDSIIR	4047	sp|Q9P2J5-2|SYLC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	5-UNIMOD:4	ms_run[1]:scan=1.1.8026.11	79.7618	2	1176.5214	1176.5193	R	R	1035	1045
PSM	QGDNCDSIIR	4048	sp|Q9P2J5-2|SYLC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	5-UNIMOD:4	ms_run[1]:scan=1.1.8045.11	80.27237	2	1176.5214	1176.5193	R	R	1035	1045
PSM	GWENHVEGQK	4049	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7768.11	73.03907	2	1182.5390	1182.5418	K	L	672	682
PSM	VQLSGPQEAEK	4050	sp|Q9UNS2-2|CSN3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7835.8	74.77585	2	1184.6066	1184.6037	R	Y	306	317
PSM	DGGNQEVEIAR	4051	sp|P13861-2|KAP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8029.11	79.84195	2	1186.5604	1186.5578	K	C	297	308
PSM	GGGPTSSEQIMK	4052	sp|Q07812-2|BAX_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7904.10	76.56935	2	1190.5526	1190.5601	R	T	10	22
PSM	TPSNGAEGLTPR	4053	sp|Q99459|CDC5L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7781.11	73.37737	2	1198.5952	1198.5942	R	S	415	427
PSM	DLPVSEQQER	4054	sp|Q9UNM6-2|PSD13_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8070.9	80.93877	2	1199.5788	1199.5782	K	A	189	199
PSM	MEEANIQPNR	4055	sp|P42704|LPPRC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7745.9	72.45174	2	1200.5542	1200.5557	K	V	188	198
PSM	VAVEEVDEEGK	4056	sp|P02545-3|LMNA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8019.11	79.57422	2	1202.5684	1202.5666	R	F	440	451
PSM	VTNIGNQQIDK	4057	sp|Q6P3W7|SCYL2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7855.8	75.28463	2	1228.6374	1228.6412	K	V	637	648
PSM	IQVWHEEHR	4058	sp|P26038|MOES_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8085.11	81.34203	2	1232.6046	1232.6050	R	G	172	181
PSM	AAMDNSEIAGEK	4059	sp|Q16891-2|MIC60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7750.6	72.57265	2	1234.5478	1234.5499	K	K	247	259
PSM	DGEEAGAYDGPR	4060	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8060.11	80.67625	2	1235.5052	1235.5054	R	T	108	120
PSM	IINDNATYCR	4061	sp|O00567|NOP56_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	9-UNIMOD:4	ms_run[1]:scan=1.1.7960.11	78.0406	2	1238.5708	1238.5713	K	L	203	213
PSM	CGVCNEATPIK	4062	sp|Q86T03-2|PP4P1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	1-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=1.1.7943.9	77.585	2	1247.5648	1247.5638	K	N	111	122
PSM	NAPNDASYDAVR	4063	sp|Q92616|GCN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8037.10	80.05495	2	1291.5712	1291.5793	K	Q	1305	1317
PSM	EAMEDGEIDGNK	4064	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7855.9	75.2863	2	1306.5346	1306.5347	K	V	628	640
PSM	DEFTNTCPSDK	4065	sp|Q9Y696|CLIC4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	7-UNIMOD:4	ms_run[1]:scan=1.1.7919.10	76.95815	2	1312.5250	1312.5242	R	E	228	239
PSM	QLYETTDTTTR	4066	sp|Q9UIA9|XPO7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7997.10	79.00208	2	1327.6254	1327.6256	K	L	17	28
PSM	SRAEAALEEESR	4067	sp|Q969G3-2|SMCE1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7753.3	72.6424	3	1346.6464	1346.6426	K	Q	147	159
PSM	EQYEQLSQSEK	4068	sp|Q8TEW0-3|PARD3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8052.9	80.45772	2	1367.6224	1367.6205	K	N	320	331
PSM	GGPASVPSSSPGTSVK	4069	sp|O43237|DC1L2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7823.10	74.46799	2	1413.7068	1413.7100	R	K	398	414
PSM	TPCNAGTFSQPEK	4070	sp|O43684-2|BUB3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	3-UNIMOD:4	ms_run[1]:scan=1.1.7986.8	78.71783	3	1435.6282	1435.6402	R	V	127	140
PSM	LFQECCPHSTDR	4071	sp|P61978-2|HNRPK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	5-UNIMOD:4,6-UNIMOD:4	ms_run[1]:scan=1.1.8058.11	80.6223	3	1548.6481	1548.6450	K	V	180	192
PSM	SDSGKPYYYNSQTK	4072	sp|O75400-2|PR40A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7730.11	72.08697	2	1636.7360	1636.7369	K	E	165	179
PSM	CNTQQPGCENVCYDK	4073	sp|P17302|CXA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	1-UNIMOD:4,8-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.7972.11	78.36089	2	1871.7288	1871.7237	R	S	54	69
PSM	DREEALHQFR	4074	sp|O00571|DDX3X_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8323.4	87.49258	4	1299.6365	1299.6320	R	S	479	489
PSM	EATNPPVIQEEK	4075	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8201.11	84.32923	2	1353.6748	1353.6776	R	P	483	495
PSM	RTVALLTEK	4076	sp|Q9Y4W6|AFG32_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8405.4	89.66877	3	1029.6178	1029.6182	K	K	711	720
PSM	ALLQQQPEDDSK	4077	sp|Q9UHB9|SRP68_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8165.11	83.3991	2	1370.6712	1370.6678	R	R	405	417
PSM	VTGPGGSPCLGSER	4078	sp|Q6ZN17|LN28B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	9-UNIMOD:4	ms_run[1]:scan=1.1.8437.11	90.52355	2	1372.6354	1372.6405	R	R	99	113
PSM	RINVELSTK	4079	sp|Q96PK6|RBM14_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8443.2	90.66978	3	1058.6080	1058.6084	K	G	141	150
PSM	IFAPNHVVAK	4080	sp|Q02543|RL18A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8391.3	89.30219	3	1094.6248	1094.6237	R	S	32	42
PSM	ALANSLACQGK	4081	sp|P04075-2|ALDOA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	8-UNIMOD:4	ms_run[1]:scan=1.1.8136.2	82.64001	3	1131.5710	1131.5706	R	Y	386	397
PSM	VGESVFHTTR	4082	sp|Q9P0J0-2|NDUAD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8386.4	89.1704	3	1131.5722	1131.5673	K	W	106	116
PSM	YDERPGPSPLPHR	4083	sp|P08621|RU17_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8195.3	84.16315	4	1519.7533	1519.7532	R	D	219	232
PSM	KWPQQVVQK	4084	sp|P52926|HMGA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8392.3	89.32861	3	1139.6578	1139.6451	R	K	82	91
PSM	NSDEADLVPAK	4085	sp|P83916|CBX1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8472.2	91.44991	3	1157.5585	1157.5564	K	E	140	151
PSM	LKDDEVAQLK	4086	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8275.2	86.20875	3	1157.6314	1157.6292	K	K	309	319
PSM	SGTVDPQELQK	4087	sp|P30626-2|SORCN_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8161.2	83.28049	3	1200.5995	1200.5986	R	A	102	113
PSM	VAAGLQIK	4088	sp|Q14974|IMB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8463.5	91.21225	2	798.4984	798.4963	R	N	55	63
PSM	HFVALSTNTTK	4089	sp|P06744-2|G6PI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8209.2	84.51805	3	1217.6425	1217.6404	K	V	253	264
PSM	QAASSLQQASLK	4090	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8165.5	83.3891	3	1230.6592	1230.6568	R	L	635	647
PSM	HVGSNLCLDSR	4091	sp|Q10471|GALT2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	7-UNIMOD:4	ms_run[1]:scan=1.1.8403.6	89.6204	3	1256.5954	1256.5932	R	T	533	544
PSM	SPPPGMGLNQNR	4092	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8438.7	90.54393	3	1266.6193	1266.6139	R	G	33	45
PSM	TRPDGNCFYR	4093	sp|Q96FW1|OTUB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	7-UNIMOD:4	ms_run[1]:scan=1.1.8216.4	84.7	3	1284.5629	1284.5670	K	A	85	95
PSM	QEPERNECFLQHK	4094	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	8-UNIMOD:4	ms_run[1]:scan=1.1.8125.5	82.36467	4	1713.7913	1713.7893	K	D	118	131
PSM	ICAVGITK	4095	sp|P55060-3|XPO2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	2-UNIMOD:4	ms_run[1]:scan=1.1.8285.2	86.47598	2	860.4798	860.4790	K	L	841	849
PSM	EGVVHGVATVAEK	4096	sp|P37840-2|SYUA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8156.4	83.15569	3	1294.6813	1294.6881	K	T	46	59
PSM	SPAPKPSDLRPGDVSSK	4097	sp|Q05682-4|CALD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8308.5	87.09566	4	1736.9077	1736.9057	K	R	504	521
PSM	VLSGTIHAGQPVK	4098	sp|Q15029-2|U5S1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8114.5	82.08445	3	1305.7405	1305.7405	R	V	461	474
PSM	GAGGALLTPK	4099	sp|Q8N1G0|ZN687_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8384.6	89.12023	2	883.5136	883.5127	K	T	893	903
PSM	TVGATALPR	4100	sp|P50990-2|TCPQ_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8151.5	83.02842	2	884.5074	884.5080	K	L	308	317
PSM	VLDSGAPIK	4101	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8087.7	81.38876	2	898.5140	898.5124	K	I	125	134
PSM	DCLINAAK	4102	sp|P17987|TCPA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	2-UNIMOD:4	ms_run[1]:scan=1.1.8437.7	90.51688	2	903.4468	903.4484	R	T	146	154
PSM	TGFQAVTGK	4103	sp|P20042|IF2B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8175.9	83.65608	2	907.4758	907.4763	K	R	316	325
PSM	LDVGNAEVK	4104	sp|P51572-2|BAP31_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8454.8	90.97493	2	943.4990	943.4975	K	L	235	244
PSM	LRECELSPGVNR	4105	sp|Q9BXP5-2|SRRT_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	4-UNIMOD:4	ms_run[1]:scan=1.1.8415.5	89.92799	3	1428.7150	1428.7143	R	D	487	499
PSM	DGNPDNETYLHR	4106	sp|Q9UMR2-4|DD19B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8255.6	85.69402	3	1429.6234	1429.6222	K	I	389	401
PSM	QGVDIEAAR	4107	sp|O14974|MYPT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8291.7	86.64505	2	957.4884	957.4879	R	K	162	171
PSM	IDNLDVNR	4108	sp|O75475|PSIP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8272.8	86.13876	2	957.4884	957.4879	K	C	365	373
PSM	ALCGLDESK	4109	sp|P36776|LONM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	3-UNIMOD:4	ms_run[1]:scan=1.1.8178.9	83.7363	2	991.4642	991.4644	R	A	680	689
PSM	EAAMEAEIK	4110	sp|O14776-2|TCRG1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8315.9	87.2875	2	990.4702	990.4691	K	A	620	629
PSM	DSQICELK	4111	sp|P55145|MANF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	5-UNIMOD:4	ms_run[1]:scan=1.1.8387.8	89.20365	2	991.4634	991.4644	K	Y	113	121
PSM	QAGPASVPLR	4112	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8449.7	90.83923	2	994.5552	994.5560	K	T	131	141
PSM	QAYTQFGGK	4113	sp|P25789-2|PSA4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8287.7	86.53778	2	998.4828	998.4821	K	R	48	57
PSM	PSNILVNSR	4114	sp|P36507|MP2K2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8382.10	89.07357	2	998.5518	998.5509	K	G	197	206
PSM	ESGSEKPSEDVLVK	4115	sp|Q02040|AK17A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8164.6	83.36488	3	1502.7496	1502.7464	K	V	163	177
PSM	VLNTNIDGR	4116	sp|P62269|RS18_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8331.6	87.70873	2	1000.5306	1000.5302	R	R	15	24
PSM	YGINTDPPK	4117	sp|Q9Y3B4|SF3B6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8462.7	91.18851	2	1003.5010	1003.4975	K	-	117	126
PSM	ALDLDSSCK	4118	sp|P31948|STIP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	8-UNIMOD:4	ms_run[1]:scan=1.1.8330.9	87.68697	2	1007.4586	1007.4594	K	E	454	463
PSM	QGANINEIR	4119	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8140.6	82.74866	2	1013.5256	1013.5254	R	Q	298	307
PSM	IVADQLCAK	4120	sp|P53990-2|IST1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	7-UNIMOD:4	ms_run[1]:scan=1.1.8472.9	91.46159	2	1016.5304	1016.5325	K	Y	119	128
PSM	ALGLDSANEK	4121	sp|Q13451|FKBP5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8323.9	87.50092	2	1016.5156	1016.5138	K	G	343	353
PSM	TLLEAENSR	4122	sp|P48681|NEST_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8290.5	86.61481	2	1031.5246	1031.5247	R	L	304	313
PSM	YRPGTVALR	4123	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8302.2	86.92975	3	1031.5927	1031.5876	R	E	42	51
PSM	TLLEGEESR	4124	sp|P04264|K2C1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8309.9	87.12883	2	1032.5088	1032.5087	R	M	484	493
PSM	GPEADSEWR	4125	sp|Q14152|EIF3A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8398.8	89.49427	2	1045.4456	1045.4465	K	R	902	911
PSM	AASAYAVGDVK	4126	sp|P13861-2|KAP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8371.7	88.77367	2	1050.5326	1050.5346	R	C	326	337
PSM	AEAAVVAVAEK	4127	sp|Q8IZQ5|SELH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8446.7	90.75888	2	1056.5804	1056.5815	K	R	10	21
PSM	QPDSGISSIR	4128	sp|P04843|RPN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8429.8	90.30378	2	1058.5334	1058.5356	R	S	269	279
PSM	GEEILSGAQR	4129	sp|P14868|SYDC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8389.9	89.2588	2	1058.5340	1058.5356	R	I	422	432
PSM	GTCVEGTIPK	4130	sp|Q93009-3|UBP7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	3-UNIMOD:4	ms_run[1]:scan=1.1.8107.3	81.90591	2	1060.5340	1060.5223	K	L	297	307
PSM	NGEVQNLAVK	4131	sp|Q86VP6|CAND1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8222.10	84.8627	2	1070.5770	1070.5720	K	C	61	71
PSM	NGEVQNLAVK	4132	sp|Q86VP6|CAND1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8242.9	85.36857	2	1070.5770	1070.5720	K	C	61	71
PSM	IMATPEQVGK	4133	sp|P12956-2|XRCC6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8290.2	86.60982	3	1072.5595	1072.5587	K	M	411	421
PSM	LETELDEEK	4134	sp|Q9P2M7|CING_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8278.7	86.29729	2	1104.5206	1104.5186	R	N	968	977
PSM	DANNGNLQLR	4135	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8290.8	86.61982	2	1113.5510	1113.5527	K	N	288	298
PSM	EKPTTALLDK	4136	sp|Q12906-7|ILF3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8178.10	83.73797	2	1114.6230	1114.6234	K	V	118	128
PSM	DNQLSEVANK	4137	sp|Q14978-2|NOLC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8112.6	82.03516	2	1116.5416	1116.5411	R	F	24	34
PSM	SGTDVDAANLR	4138	sp|P42574|CASP3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8253.7	85.6447	2	1117.5370	1117.5364	R	E	65	76
PSM	YIGSVEEAEK	4139	sp|O60508|PRP17_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8325.9	87.55428	2	1123.5420	1123.5397	K	N	152	162
PSM	VCEVDNELR	4140	sp|Q9Y3Z3-4|SAMH1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	2-UNIMOD:4	ms_run[1]:scan=1.1.8428.10	90.28033	2	1132.5174	1132.5183	R	I	340	349
PSM	AAEFNSNLNR	4141	sp|Q8WUB8-3|PHF10_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8440.10	90.60262	2	1134.5356	1134.5417	K	E	160	170
PSM	GASFVTSTNPR	4142	sp|P49916-3|DNLI3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8293.10	86.70357	2	1135.5444	1135.5622	K	K	127	138
PSM	LDQEVAEVDK	4143	sp|Q99816-2|TS101_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8209.9	84.52972	2	1144.5560	1144.5612	R	N	172	182
PSM	VNTPTTTVYR	4144	sp|P26639-2|SYTC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8286.8	86.5127	2	1150.5978	1150.5983	K	C	277	287
PSM	AEPPKAPEQEQAAPGPAAGGEAPK	4145	sp|P80723|BASP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1000663, ProteinPilot, ]	21		ms_run[1]:scan=1.1.8213.7	84.63181	4	2297.1284941913204	2297.12878882192	K	A	98	122
PSM	AEPPKAPEQEQAAPGPAAGGEAPK	4146	sp|P80723|BASP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8149.10	82.98528	4	2297.1321	2297.1287	K	A	98	122
PSM	VLIAAHGNSLR	4147	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8397.2	89.45831	3	1149.6637	1149.6618	R	G	181	192
PSM	HWDHLTQVK	4148	sp|P30084|ECHM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8282.4	86.39912	3	1162.5913	1162.5883	K	K	119	128
PSM	IMQTDEEIGK	4149	sp|Q14919-2|NC2A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8278.9	86.30061	2	1162.5580	1162.5540	K	V	20	30
PSM	MDLDEDTAEK	4150	sp|P56937-2|DHB7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8391.10	89.31385	2	1165.4796	1165.4809	K	F	294	304
PSM	FFQEENTEK	4151	sp|O00232|PSD12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8255.11	85.70235	2	1170.5208	1170.5193	K	L	213	222
PSM	FFQEENTEK	4152	sp|O00232|PSD12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8235.8	85.19448	2	1170.5208	1170.5193	K	L	213	222
PSM	QLSSETDLER	4153	sp|O76024|WFS1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8321.11	87.45105	2	1176.5554	1176.5622	R	A	165	175
PSM	SEDGEIVSTPR	4154	sp|Q12769|NU160_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8181.10	83.81685	2	1188.5604	1188.5622	R	L	949	960
PSM	SNFSNSADDIK	4155	sp|P45973|CBX5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8270.8	86.08548	2	1196.5292	1196.5309	K	S	92	103
PSM	NDQCYDDIR	4156	sp|Q9ULV4-3|COR1C_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	4-UNIMOD:4	ms_run[1]:scan=1.1.8344.11	88.05932	2	1197.4702	1197.4720	K	V	73	82
PSM	EDTGDQQGLLK	4157	sp|Q13111-2|CAF1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8304.10	86.99688	2	1202.5770	1202.5779	R	A	152	163
PSM	SQIGNTESELK	4158	sp|Q8TB36-2|GDAP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8367.10	88.67132	2	1204.5900	1204.5935	R	K	94	105
PSM	LNEQQSVLQR	4159	sp|Q14683|SMC1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8474.9	91.51552	2	1213.6378	1213.6415	K	I	1010	1020
PSM	VEIIANDQGNR	4160	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8249.2	85.53795	3	1227.6214	1227.6207	R	I	50	61
PSM	QAANLQDCYR	4161	sp|P43246|MSH2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	8-UNIMOD:4	ms_run[1]:scan=1.1.8283.11	86.43758	2	1237.5498	1237.5509	R	L	397	407
PSM	QHLEITGGQVR	4162	sp|P47897-2|SYQ_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8366.3	88.63271	3	1236.6607	1236.6575	K	T	244	255
PSM	QHLEITGGQVR	4163	sp|P47897-2|SYQ_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8365.6	88.61087	3	1236.6607	1236.6575	K	T	244	255
PSM	QHLEITGGQVR	4164	sp|P47897-2|SYQ_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8362.6	88.53049	3	1236.6607	1236.6575	K	T	244	255
PSM	QAANLQDCYR	4165	sp|P43246|MSH2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	8-UNIMOD:4	ms_run[1]:scan=1.1.8267.10	86.00935	2	1237.5498	1237.5509	R	L	397	407
PSM	EEESQQQAVLEQERR	4166	sp|Q9UM54-2|MYO6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8455.8	91.00193	3	1857.8755	1857.8816	K	D	994	1009
PSM	TSLSANNATLEK	4167	sp|O75330-2|HMMR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8254.7	85.67343	2	1247.6324	1247.6357	K	Q	112	124
PSM	DTQSVSAIGEEK	4168	sp|Q9NW13|RBM28_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8106.9	81.887	2	1262.6014	1262.5990	K	S	197	209
PSM	ELFESSTNNNK	4169	sp|Q9UM54-2|MYO6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8305.10	87.02385	2	1281.5810	1281.5837	R	D	619	630
PSM	NVESGEEELASK	4170	sp|Q96HS1|PGAM5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8295.11	86.75843	2	1290.5916	1290.5939	R	L	77	89
PSM	NCNDFQYESK	4171	sp|Q04917|1433F_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	2-UNIMOD:4	ms_run[1]:scan=1.1.8309.11	87.13216	2	1303.5118	1303.5139	K	V	111	121
PSM	NSEPAGLETPEAK	4172	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8404.10	89.65285	2	1341.6392	1341.6412	R	V	890	903
PSM	YLAEVACGDDRK	4173	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	7-UNIMOD:4	ms_run[1]:scan=1.1.8157.9	83.18954	2	1395.6432	1395.6452	R	Q	128	140
PSM	YICENQDSISSK	4174	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	3-UNIMOD:4	ms_run[1]:scan=1.1.8122.5	82.29505	3	1442.6374	1442.6347	K	L	287	299
PSM	EWGDDEEEQPSK	4175	sp|Q15020-4|SART3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8301.11	86.9179	2	1447.5726	1447.5739	K	R	596	608
PSM	AVTEQGAELSNEER	4176	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8256.11	85.7279	2	1531.7094	1531.7114	K	N	28	42
PSM	DQGGFGDRNEYGSR	4177	sp|Q92945|FUBP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8124.7	82.34922	2	1556.6632	1556.6604	R	I	307	321
PSM	KLIELQAGK	4178	sp|P14314-2|GLU2B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8634.2	95.72932	3	998.6134	998.6124	K	K	158	167
PSM	GHQQLYWSHPR	4179	sp|P62273-2|RS29_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8809.5	100.4456	4	1407.6845	1407.6796	M	K	2	13
PSM	YKPLPQISK	4180	sp|Q9NTJ5|SAC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8705.3	97.6417	3	1072.6285	1072.6281	K	V	272	281
PSM	YKDDPVDLR	4181	sp|Q9Y2W1|TR150_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8729.4	98.28715	3	1119.5593	1119.5560	K	L	710	719
PSM	TLIGHVPDQR	4182	sp|Q16822-2|PCKGM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8718.3	97.98862	3	1134.6133	1134.6146	K	E	235	245
PSM	IGAEVYHNLK	4183	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8795.5	100.0681	3	1142.6104	1142.6084	R	N	184	194
PSM	IRELTAVVQK	4184	sp|P23396-2|RS3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8795.6	100.0697	3	1155.6988	1155.6975	R	R	66	76
PSM	FRPAGAAPRPPPKPM	4185	sp|Q5JNZ5|RS26L_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8633.2	95.70238	4	1588.8689	1588.8660	R	-	101	116
PSM	ARPEDVISEGR	4186	sp|P25325-2|THTM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8532.4	93.03443	3	1227.6187	1227.6207	R	G	303	314
PSM	TVCAHEELLR	4187	sp|P55001-2|MFAP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	3-UNIMOD:4	ms_run[1]:scan=1.1.8552.5	93.57333	3	1226.6095	1226.6077	R	A	139	149
PSM	HIDLVEGDEGR	4188	sp|P19367-3|HXK1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8759.6	99.10046	3	1238.5909	1238.5891	R	M	248	259
PSM	HCNMVLENVK	4189	sp|P62316|SMD2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	2-UNIMOD:4	ms_run[1]:scan=1.1.8766.4	99.28619	3	1242.5842	1242.5849	R	E	62	72
PSM	TNQELQEINR	4190	sp|P07355-2|ANXA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8492.4	91.98061	3	1243.6186	1243.6156	R	V	154	164
PSM	SESHTDLTFSR	4191	sp|O15226-2|NKRF_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8675.5	96.8351	3	1278.5863	1278.5840	R	E	631	642
PSM	CLADAVVK	4192	sp|Q5TGZ0-2|MIC10_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	1-UNIMOD:4	ms_run[1]:scan=1.1.8799.6	100.1774	2	874.4556	874.4582	R	I	13	21
PSM	GAVAEDGDELRTEPEAK	4193	sp|P27695|APEX1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8598.4	94.77145	4	1785.8369	1785.8381	K	K	8	25
PSM	LSPDAIPGK	4194	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8528.5	92.92962	2	896.4970	896.4967	K	W	1583	1592
PSM	SAVENCQDSWR	4195	sp|P52209-2|6PGD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	6-UNIMOD:4	ms_run[1]:scan=1.1.8610.6	95.09132	3	1350.5617	1350.5623	K	R	384	395
PSM	EVEEEPGIHSLK	4196	sp|Q9Y4L1|HYOU1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8821.6	100.7711	3	1365.6787	1365.6776	R	H	452	464
PSM	ADEASELACPTPK	4197	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	9-UNIMOD:4	ms_run[1]:scan=1.1.8780.7	99.6684	3	1387.6270	1387.6289	K	E	2194	2207
PSM	INTCWQDHCR	4198	sp|Q13619|CUL4A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	4-UNIMOD:4,9-UNIMOD:4	ms_run[1]:scan=1.1.8500.10	92.19973	3	1388.5774	1388.5714	K	Q	135	145
PSM	DGEDEFVK	4199	sp|Q5T7N2|LITD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8539.7	93.2266	2	937.4048	937.4029	K	E	202	210
PSM	LDDLVSTGK	4200	sp|Q92499-3|DDX1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8681.9	97.0038	2	946.4972	946.4971	R	L	222	231
PSM	DSDGVDGFEAEGKK	4201	sp|Q96KR1|ZFR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8763.6	99.20869	3	1452.6358	1452.6369	R	D	1053	1067
PSM	VAVVNQIAR	4202	sp|Q01082-2|SPTB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8725.7	98.18435	2	968.5758	968.5767	R	Q	905	914
PSM	TLQSLACGK	4203	sp|Q13620-1|CUL4B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	7-UNIMOD:4	ms_run[1]:scan=1.1.8661.7	96.46252	2	976.4980	976.5012	R	A	763	772
PSM	IAGPGLGSGVR	4204	sp|O75369-2|FLNB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8779.7	99.64152	2	982.5564	982.5560	K	A	1426	1437
PSM	RDPHLACVAYER	4205	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	7-UNIMOD:4	ms_run[1]:scan=1.1.8663.4	96.51099	3	1485.7156	1485.7147	K	G	912	924
PSM	ASSELFSQK	4206	sp|Q01581|HMCS1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8657.6	96.35419	2	995.4924	995.4924	K	T	322	331
PSM	TSLGPNGLDK	4207	sp|P48643|TCPE_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8621.7	95.38837	2	1000.5178	1000.5189	R	M	50	60
PSM	VVDTLYDGK	4208	sp|Q9UDY2|ZO2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8830.7	101.0126	2	1008.5128	1008.5128	R	L	633	642
PSM	FSEGEATLR	4209	sp|P47897-2|SYQ_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8770.7	99.3991	2	1008.4868	1008.4876	K	M	384	393
PSM	SALNDVTAAR	4210	sp|O95801|TTC4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8710.8	97.78415	2	1016.5252	1016.5251	R	K	135	145
PSM	AYDATHLVK	4211	sp|P10768|ESTD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8512.7	92.51247	2	1016.5398	1016.5291	K	S	201	210
PSM	NREEFEDQSLEK	4212	sp|Q12830-2|BPTF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8665.9	96.57305	3	1522.6933	1522.6899	K	D	593	605
PSM	IVADQLCAK	4213	sp|P53990-2|IST1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	7-UNIMOD:4	ms_run[1]:scan=1.1.8477.7	91.59196	2	1016.5304	1016.5325	K	Y	119	128
PSM	IVADQLCAK	4214	sp|P53990-2|IST1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	7-UNIMOD:4	ms_run[1]:scan=1.1.8481.7	91.699	2	1016.5304	1016.5325	K	Y	119	128
PSM	TCLDNLASK	4215	sp|P46940|IQGA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	2-UNIMOD:4	ms_run[1]:scan=1.1.8759.9	99.10547	2	1020.4890	1020.4910	K	G	1533	1542
PSM	TANLNLETR	4216	sp|Q9UKF6|CPSF3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8726.6	98.20965	2	1030.5382	1030.5407	K	T	643	652
PSM	EIYENMAPGENKR	4217	sp|Q13200|PSMD2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8778.7	99.61467	3	1549.7182	1549.7194	K	F	108	121
PSM	PGQEAPVLPK	4218	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8562.7	93.84603	2	1034.5704	1034.5760	K	D	367	377
PSM	ILGPQGNTIK	4219	sp|Q07666|KHDR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8550.10	93.52769	2	1039.6036	1039.6026	K	R	176	186
PSM	EGDLIAAQAR	4220	sp|P02545-3|LMNA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8514.10	92.57017	2	1042.5400	1042.5407	K	L	124	134
PSM	SEVATLTAAGK	4221	sp|P36542-2|ATPG_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8514.11	92.57183	2	1046.5602	1046.5608	K	E	116	127
PSM	ALQGSLGGVEK	4222	sp|O75150-4|BRE1B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8712.9	97.83895	2	1057.5764	1057.5768	R	E	737	748
PSM	FESPEVAER	4223	sp|P52272-2|HNRPM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8701.9	97.54377	2	1062.4966	1062.4982	K	A	660	669
PSM	GVNTFSPEGR	4224	sp|P28066|PSA5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8519.7	92.69637	2	1062.5088	1062.5094	R	L	11	21
PSM	GVNTFSPEGR	4225	sp|P28066|PSA5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8538.9	93.20309	2	1062.5088	1062.5094	R	L	11	21
PSM	SVEAAAELSAK	4226	sp|P20962|PTMS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8687.8	97.16415	2	1074.5620	1074.5557	K	D	5	16
PSM	LAQFEPSQR	4227	sp|Q08211|DHX9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8629.8	95.60482	2	1074.5454	1074.5458	K	Q	315	324
PSM	QLSSGVSEIR	4228	sp|P04792|HSPB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8706.10	97.6805	2	1074.5620	1074.5669	R	H	80	90
PSM	RSGVAYIAAPSGSAADK	4229	sp|P31939-2|PUR9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8786.9	99.83315	3	1619.8258	1619.8267	K	V	552	569
PSM	AIEEQMVAAK	4230	sp|Q9H0A0-2|NAT10_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8650.10	96.17325	2	1088.5532	1088.5536	K	D	841	851
PSM	CDEPILSNR	4231	sp|P30086|PEBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	1-UNIMOD:4	ms_run[1]:scan=1.1.8602.7	94.88052	2	1102.5062	1102.5077	K	S	133	142
PSM	MQEGEGHSQLCLDR	4232	sp|Q8WUA4|TF3C2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	11-UNIMOD:4	ms_run[1]:scan=1.1.8799.10	100.1841	3	1658.7103	1658.7141	R	L	818	832
PSM	LDDPSCPRPECYR	4233	sp|P41091|IF2G_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	6-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=1.1.8745.8	98.72553	3	1663.7065	1663.7083	K	S	91	104
PSM	SSFSHYSGLK	4234	sp|Q8NC51-3|PAIRB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8711.3	97.80238	3	1111.5313	1111.5298	R	H	202	212
PSM	TLLADKGEIR	4235	sp|Q13330-3|MTA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8711.4	97.80405	3	1114.6351	1114.6346	K	V	142	152
PSM	PLCELQPGAK	4236	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	3-UNIMOD:4	ms_run[1]:scan=1.1.8790.8	99.93895	2	1111.5676	1111.5696	K	C	1485	1495
PSM	PLCELQPGAK	4237	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	3-UNIMOD:4	ms_run[1]:scan=1.1.8798.9	100.1554	2	1111.5676	1111.5696	K	C	1485	1495
PSM	CSNPLDTSVK	4238	sp|P17812|PYRG1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	1-UNIMOD:4	ms_run[1]:scan=1.1.8652.8	96.22337	2	1119.5228	1119.5230	R	E	218	228
PSM	LLQQEEEIK	4239	sp|P54136|SYRC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8772.11	99.45956	2	1128.5998	1128.6026	R	S	12	21
PSM	GNLGVYQETR	4240	sp|O95400|CD2B2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8655.10	96.30715	2	1135.5608	1135.5622	R	E	213	223
PSM	FVGQDVEGER	4241	sp|P17812|PYRG1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8537.9	93.1763	2	1134.5300	1134.5306	K	M	499	509
PSM	NYCNIQVTK	4242	sp|P48444|COPD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	3-UNIMOD:4	ms_run[1]:scan=1.1.8667.10	96.62832	2	1138.5428	1138.5441	K	V	477	486
PSM	MGESDDSILR	4243	sp|P63220|RS21_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	1-UNIMOD:35	ms_run[1]:scan=1.1.8629.9	95.60648	2	1137.4990	1137.4972	R	L	62	72
PSM	NVPYGNIQSR	4244	sp|Q10471|GALT2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8783.10	99.75408	2	1146.5768	1146.5782	R	L	405	415
PSM	VDVCSTETLK	4245	sp|Q5VT52-3|RPRD2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	4-UNIMOD:4	ms_run[1]:scan=1.1.8657.9	96.35918	2	1150.5566	1150.5540	R	C	193	203
PSM	LLNTVEETTK	4246	sp|P52732|KIF11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8522.8	92.77638	2	1146.6134	1146.6132	K	D	499	509
PSM	NADLNAQTVVK	4247	sp|Q9Y520-4|PRC2C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8637.5	95.81483	2	1171.6192	1171.6197	K	V	1516	1527
PSM	VLEENQEHYHIVQK	4248	sp|P57740|NU107_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8504.8	92.30205	3	1764.8761	1764.8795	R	F	504	518
PSM	TIQGDEEDLR	4249	sp|P54920|SNAA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8621.10	95.39336	2	1174.5460	1174.5466	K	-	286	296
PSM	VDNDENEHQLSLR	4250	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8564.5	93.89657	4	1567.7257	1567.7226	K	T	33	46
PSM	DSGSISLQETR	4251	sp|Q9H2G2-2|SLK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8801.9	100.2362	2	1191.5702	1191.5731	K	R	776	787
PSM	ELGVSTNANYK	4252	sp|Q8WVY7|UBCP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8657.10	96.36085	2	1194.5868	1194.5880	K	I	196	207
PSM	YVECSALTQK	4253	sp|P60953|CDC42_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	4-UNIMOD:4	ms_run[1]:scan=1.1.8502.9	92.2507	2	1197.5690	1197.5700	K	G	154	164
PSM	VIDQQNGLYR	4254	sp|P27694|RFA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8737.10	98.5128	2	1204.6154	1204.6200	K	C	490	500
PSM	NNTQVLINCR	4255	sp|P62316|SMD2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	9-UNIMOD:4	ms_run[1]:scan=1.1.8803.9	100.2904	2	1230.6114	1230.6139	K	N	38	48
PSM	QCQPQVQAFK	4256	sp|Q9NYJ1-2|COA4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	2-UNIMOD:4	ms_run[1]:scan=1.1.8714.10	97.89378	2	1232.6030	1232.5972	R	D	62	72
PSM	RCQLPDGSFR	4257	sp|O75643|U520_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	2-UNIMOD:4	ms_run[1]:scan=1.1.8820.4	100.7408	3	1234.5883	1234.5877	K	R	427	437
PSM	LQQTYAALNSK	4258	sp|P46940|IQGA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8771.10	99.431	2	1235.6462	1235.6510	K	A	1506	1517
PSM	EALNVINTHTK	4259	sp|O76094|SRP72_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8630.11	95.6368	2	1238.6554	1238.6619	K	V	63	74
PSM	SLDGAAAVDSADR	4260	sp|P11171-5|41_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8599.9	94.80573	2	1246.5788	1246.5789	R	S	507	520
PSM	VELVTGEEDEK	4261	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8674.11	96.81795	2	1246.5928	1246.5929	K	V	2023	2034
PSM	LQGLEQEAENK	4262	sp|Q9P2M7|CING_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8579.6	94.29327	2	1257.6202	1257.6201	R	K	937	948
PSM	SNNIINETTTR	4263	sp|Q9NTJ3|SMC4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8700.11	97.51981	2	1261.6250	1261.6262	K	N	435	446
PSM	SGMVQTEAQYR	4264	sp|Q06124-2|PTN11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8477.9	91.5953	2	1268.5876	1268.5819	R	F	502	513
PSM	LDQPGNLPGSNR	4265	sp|P46013|KI67_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8619.10	95.33957	2	1266.6270	1266.6317	K	R	1806	1818
PSM	DNKPEEEEQVIHEDDERPSEK	4266	sp|Q6VMQ6-4|MCAF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8808.10	100.4269	4	2551.1273	2551.1310	K	N	536	557
PSM	QCDLAGVETCK	4267	sp|Q9UIC8-2|LCMT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	2-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.8626.9	95.52595	2	1279.5538	1279.5537	R	S	272	283
PSM	FGGLAAGEDNGQR	4268	sp|O00116|ADAS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8744.11	98.70348	2	1290.5930	1290.5953	K	G	491	504
PSM	GSQFGQSCCLR	4269	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	8-UNIMOD:4,9-UNIMOD:4	ms_run[1]:scan=1.1.8714.11	97.89545	2	1298.5466	1298.5496	K	A	329	340
PSM	YLESEEYQER	4270	sp|Q9Y676|RT18B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8818.11	100.6986	2	1344.5818	1344.5833	K	Y	58	68
PSM	SLEEQDQETLR	4271	sp|P48681|NEST_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8479.10	91.65033	2	1346.6292	1346.6314	R	T	746	757
PSM	SEPIPESNDGPVK	4272	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8552.11	93.58334	2	1367.6538	1367.6569	K	V	367	380
PSM	GLLQTEPQNNQAK	4273	sp|Q9Y3D6|FIS1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8549.11	93.50243	2	1439.7362	1439.7368	R	E	96	109
PSM	EQYQQQQQWGSR	4274	sp|Q14103-3|HNRPD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8584.11	94.4247	2	1564.6976	1564.7019	K	G	261	273
PSM	ASGNYATVISHNPETKK	4275	sp|P62917|RL8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8481.9	91.70233	3	1815.9109	1815.9115	R	T	129	146
PSM	VKPLLQVSR	4276	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8851.2	101.5507	3	1038.6574	1038.6550	K	Q	834	843
PSM	LAELSDYRR	4277	sp|Q96PK6|RBM14_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9031.3	106.2934	3	1121.5864	1121.5829	R	L	608	617
PSM	THIDVIHYR	4278	sp|P33991|MCM4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9018.5	105.9486	3	1152.6046	1152.6040	K	K	414	423
PSM	GEFVTTVQQR	4279	sp|P40925-3|MDHC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9001.3	105.4925	3	1163.5951	1163.5935	K	G	239	249
PSM	DKLDETGVALK	4280	sp|Q02880-2|TOP2B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9083.4	107.6787	3	1187.6425	1187.6398	K	V	293	304
PSM	FAAATGATPIAGR	4281	sp|P08865|RSSA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9190.5	110.4896	3	1202.6419	1202.6408	K	F	90	103
PSM	LTGVSISQVNHK	4282	sp|O75955-2|FLOT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8890.3	102.5708	3	1281.7027	1281.7041	R	P	363	375
PSM	VHQLYETIQR	4283	sp|Q13561-2|DCTN2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9192.3	110.539	3	1285.6777	1285.6779	K	W	314	324
PSM	ALLNNSHYYHMAHGK	4284	sp|P09622|DLDH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9012.6	105.7905	4	1754.8285	1754.8311	K	D	90	105
PSM	GLSEDTTEETLK	4285	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9172.7	110.0147	3	1321.6231	1321.6249	K	E	578	590
PSM	VLSHQDDTALLK	4286	sp|Q93034|CUL5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9168.6	109.9052	3	1338.7138	1338.7143	R	A	80	92
PSM	QSTWEKPDDLK	4287	sp|O75400-2|PR40A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9056.4	106.9631	3	1345.6522	1345.6514	K	T	138	149
PSM	ASITALEAK	4288	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8976.8	104.8421	2	902.5084	902.5073	K	I	1807	1816
PSM	SPSPFHAVAECR	4289	sp|Q9ULA0|DNPEP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	11-UNIMOD:4	ms_run[1]:scan=1.1.9167.4	109.8748	3	1356.6253	1356.6245	R	N	28	40
PSM	EVEEEPGIHSLK	4290	sp|Q9Y4L1|HYOU1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8840.5	101.2704	3	1365.6787	1365.6776	R	H	452	464
PSM	QTVAVGVIK	4291	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8986.2	105.0939	3	913.5619	913.5597	R	A	431	440
PSM	TTLTAAITK	4292	sp|P49411|EFTU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8962.6	104.4645	2	918.5390	918.5386	K	I	71	80
PSM	VRELISDNQYR	4293	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9095.6	107.9932	3	1391.7184	1391.7157	K	L	36	47
PSM	VQLVVGDGR	4294	sp|P22061-2|PIMT_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9139.8	109.1323	2	941.5294	941.5294	R	M	136	145
PSM	ALEQKPDDAQYYCQR	4295	sp|Q9Y2Z0-2|SGT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	13-UNIMOD:4	ms_run[1]:scan=1.1.8922.5	103.3968	4	1883.8461	1883.8472	K	A	37	52
PSM	CTGGEVGATSALAPK	4296	sp|P30050-2|RL12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	1-UNIMOD:4	ms_run[1]:scan=1.1.8982.7	104.9976	3	1417.6879	1417.6871	R	I	17	32
PSM	QDPSVLHTEEMR	4297	sp|P50502|F10A1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9159.6	109.6628	3	1440.6667	1440.6667	K	F	18	30
PSM	VVVLGSGGVGK	4298	sp|Q9Y3L5|RAP2C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9031.7	106.3001	2	970.5796	970.5812	K	S	6	17
PSM	EATADDLIK	4299	sp|Q16531|DDB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9102.6	108.1734	2	974.4926	974.4920	R	V	1123	1132
PSM	ATAVVDGAFK	4300	sp|P32119|PRDX2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9164.4	109.794	2	977.5166	977.5182	K	E	17	27
PSM	SDSPAIQLR	4301	sp|Q96ST3|SIN3A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9151.6	109.4479	2	985.5190	985.5192	K	L	938	947
PSM	DIDIHEVR	4302	sp|Q00839-2|HNRPU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9096.6	108.019	2	995.5026	995.5036	K	I	334	342
PSM	DQTPDENDQVIVK	4303	sp|Q9NZI8|IF2B1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8899.6	102.8061	3	1499.7091	1499.7104	R	I	526	539
PSM	YDDMAAAMK	4304	sp|P61981|1433G_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9052.5	106.8576	2	1014.4146	1014.4150	R	A	20	29
PSM	NCAIISDVK	4305	sp|Q7LBC6|KDM3B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	2-UNIMOD:4	ms_run[1]:scan=1.1.9077.7	107.5249	2	1018.5092	1018.5117	R	V	1450	1459
PSM	AAVLLEQER	4306	sp|Q13435|SF3B2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9119.8	108.6166	2	1027.5706	1027.5662	R	Q	184	193
PSM	LSQNISELK	4307	sp|O60566-3|BUB1B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9179.5	110.1994	2	1030.5632	1030.5658	K	D	994	1003
PSM	LEDAADVYR	4308	sp|Q9BXJ9|NAA15_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9123.6	108.7169	2	1050.4966	1050.4982	R	G	240	249
PSM	VKPLLQVTR	4309	sp|P35580-3|MYH10_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9103.10	108.2057	2	1052.6704	1052.6706	K	Q	862	871
PSM	GVYSEETLR	4310	sp|Q16891-2|MIC60_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8898.4	102.7838	2	1052.5120	1052.5138	R	A	613	622
PSM	FLEHLSGAGK	4311	sp|Q01813|PFKAP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8961.9	104.4427	2	1057.5600	1057.5556	K	A	16	26
PSM	THQALGILSK	4312	sp|P42166|LAP2A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8985.7	105.0761	2	1066.6094	1066.6135	R	T	611	621
PSM	KFYEQFSK	4313	sp|P07900-2|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9071.7	107.367	2	1075.5322	1075.5338	K	N	558	566
PSM	GASGSFVVVQK	4314	sp|Q5SSJ5|HP1B3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9153.10	109.5082	2	1077.5806	1077.5819	K	S	223	234
PSM	TLSDYNIQK	4315	sp|P62979|RS27A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9140.7	109.1566	2	1080.5428	1080.5451	R	E	55	64
PSM	QENGASVILR	4316	sp|P29692-2|EF1D_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9126.8	108.7979	2	1085.5800	1085.5829	R	D	405	415
PSM	AEASGGLGGLTR	4317	sp|Q9BW92|SYTM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9041.9	106.5706	2	1087.5590	1087.5622	R	L	439	451
PSM	VTELEDEVR	4318	sp|Q9BV38|WDR18_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9155.8	109.5588	2	1088.5250	1088.5350	R	N	402	411
PSM	SPDSDVAATLK	4319	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9170.8	109.9624	2	1102.5466	1102.5506	K	K	767	778
PSM	QTTCWDGVR	4320	sp|Q9P016-2|THYN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	4-UNIMOD:4	ms_run[1]:scan=1.1.9145.9	109.2916	2	1121.4906	1121.4924	K	N	86	95
PSM	DVNQQEFVR	4321	sp|P39019|RS19_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9169.9	109.9372	2	1133.5448	1133.5465	K	A	8	17
PSM	QYGITGENVR	4322	sp|Q96JB5-4|CK5P3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8969.11	104.661	2	1135.5604	1135.5622	K	G	192	202
PSM	LNQPELVAQK	4323	sp|Q06546|GABPA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8869.11	102.0426	2	1138.6350	1138.6346	K	W	350	360
PSM	STLENQNWR	4324	sp|Q15003|CND2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9040.8	106.5423	2	1146.5400	1146.5418	K	A	496	505
PSM	LDDCGLTEAR	4325	sp|P13489|RINI_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	4-UNIMOD:4	ms_run[1]:scan=1.1.9129.8	108.8749	2	1148.5168	1148.5132	R	C	35	45
PSM	EYVESQLQR	4326	sp|Q8NBS9|TXND5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8833.9	101.0938	2	1150.5594	1150.5618	R	T	288	297
PSM	KGEFETGFEK	4327	sp|Q8IYD1|ERF3B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9115.3	108.5043	3	1170.5569	1170.5557	R	G	316	326
PSM	ELQQQLVDAK	4328	sp|Q9NUQ3-2|TXLNG_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9180.9	110.2327	2	1170.6212	1170.6244	K	L	166	176
PSM	ISANENSLAVR	4329	sp|Q9UHB6-4|LIMA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8873.8	102.1416	2	1172.6106	1172.6149	K	S	325	336
PSM	DVQGWGENDR	4330	sp|P62136|PP1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9037.8	106.462	2	1174.4984	1174.5003	K	G	212	222
PSM	QCGNLTEDLK	4331	sp|P52732|KIF11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	2-UNIMOD:4	ms_run[1]:scan=1.1.9147.11	109.3486	2	1176.5416	1176.5445	K	T	703	713
PSM	QCGNLTEDLK	4332	sp|P52732|KIF11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	2-UNIMOD:4	ms_run[1]:scan=1.1.9127.10	108.8269	2	1176.5416	1176.5445	K	T	703	713
PSM	DNSTMGYMAAK	4333	sp|P07900-2|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9059.11	107.0551	2	1187.4932	1187.4951	R	K	743	754
PSM	DNSTMGYMAAK	4334	sp|P07900-2|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9078.11	107.5579	2	1187.4932	1187.4951	R	K	743	754
PSM	QETSSLACGLR	4335	sp|Q9Y6D6|BIG1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	8-UNIMOD:4	ms_run[1]:scan=1.1.9156.7	109.584	2	1220.5786	1220.5819	K	I	1722	1733
PSM	LIEDNEYTAR	4336	sp|P12931-2|SRC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8847.11	101.4622	2	1222.5814	1222.5829	R	Q	419	429
PSM	HIYYITGETK	4337	sp|P07900-2|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9187.3	110.4072	3	1223.6194	1223.6186	K	D	612	622
PSM	NFGEDMDDER	4338	sp|P11940-2|PABP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9167.8	109.8815	2	1226.4472	1226.4510	K	L	197	207
PSM	EYINECDSDYHEER	4339	sp|Q93008-1|USP9X_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	6-UNIMOD:4	ms_run[1]:scan=1.1.8866.11	101.964	3	1857.7072	1857.7111	R	T	859	873
PSM	IEQIQCYSAK	4340	sp|P52948-2|NUP98_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	6-UNIMOD:4	ms_run[1]:scan=1.1.8948.8	104.0928	2	1238.5952	1238.5965	R	D	1639	1649
PSM	LTEVLTDSHVK	4341	sp|Q92616|GCN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8959.10	104.3907	2	1240.6628	1240.6663	K	V	1543	1554
PSM	VDENNPEYLR	4342	sp|P35611-2|ADDA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8877.8	102.2447	2	1247.5742	1247.5782	R	E	28	38
PSM	EQVANSAFVER	4343	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9070.11	107.3474	2	1248.6092	1248.6098	K	V	492	503
PSM	GISVHISNAEPK	4344	sp|Q13148|TADBP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9102.9	108.1784	2	1250.6580	1250.6619	K	H	252	264
PSM	EQVANSAFVER	4345	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9032.11	106.3335	2	1248.6092	1248.6098	K	V	492	503
PSM	INENDPEYIR	4346	sp|Q9UEY8|ADDG_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9151.9	109.4529	2	1261.5924	1261.5938	R	E	28	38
PSM	YLQSNSNNWR	4347	sp|Q7Z6Z7-2|HUWE1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8962.10	104.4712	2	1280.5874	1280.5898	K	W	1609	1619
PSM	EDTQTLQSLQK	4348	sp|P48681|NEST_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8939.11	103.857	2	1289.6438	1289.6463	K	E	620	631
PSM	RFASGGCDNLIK	4349	sp|P55735-2|SEC13_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	7-UNIMOD:4	ms_run[1]:scan=1.1.8913.8	103.1692	2	1336.6520	1336.6558	K	L	167	179
PSM	FEEQGDFESEK	4350	sp|Q9BZF1-2|OSBL8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9155.10	109.5621	2	1343.5494	1343.5517	K	L	660	671
PSM	ETVEEQVSTTER	4351	sp|Q13619|CUL4A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8842.11	101.3324	2	1406.6516	1406.6525	K	V	676	688
PSM	TGTLTTNQMSVCR	4352	sp|P16615-4|AT2A2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	12-UNIMOD:4	ms_run[1]:scan=1.1.9184.11	110.3418	2	1467.6766	1467.6810	K	M	326	339
PSM	MQHNLEQQIQAR	4353	sp|Q13813|SPTN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8879.5	102.2911	3	1494.7339	1494.7361	R	N	2304	2316
PSM	FEGGDRDLEHLSK	4354	sp|P13667|PDIA4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9185.7	110.3613	3	1501.7158	1501.7161	K	F	617	630
PSM	IQFKPDDGTTPER	4355	sp|Q96AE4-2|FUBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8919.11	103.329	2	1502.7342	1502.7365	R	I	308	321
PSM	YSPTSPTYSPTSPK	4356	sp|P24928|RPB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8952.11	104.205	2	1511.7098	1511.7144	K	Y	1909	1923
PSM	SADGSAPAGEGEGVTLQR	4357	sp|Q01650|LAT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9031.11	106.3067	2	1700.7932	1700.7966	K	N	31	49
PSM	IQPEEKPVEVSPAVTK	4358	sp|Q8N0X7|SPART_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9021.10	106.0374	3	1749.9475	1749.9512	R	G	460	476
PSM	EEETSIDVAGKPNEVTK	4359	sp|P53985|MOT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8953.10	104.2299	3	1844.8975	1844.9003	K	A	463	480
PSM	AASAGQEPLHNEELAGAGR	4360	sp|Q96HY6|DDRGK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9024.11	106.1195	2	1876.8962	1876.9027	R	V	28	47
PSM	LPEYTVTQESGPAHR	4361	sp|Q15633-2|TRBP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9540.8	119.8165	3	1683.7975	1683.8216	R	K	154	169
PSM	FIQVHPITK	4362	sp|Q9NTZ6|RBM12_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9528.2	119.4896	3	1081.6285	1081.6284	R	K	499	508
PSM	VCHAHPTLSEAFR	4363	sp|P09622|DLDH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	2-UNIMOD:4	ms_run[1]:scan=1.1.9289.4	113.1034	4	1523.7333	1523.7303	R	E	483	496
PSM	TGTITTFEHAHNMR	4364	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9285.3	112.9946	4	1614.7605	1614.7573	K	V	482	496
PSM	AENYDIPSADR	4365	sp|P22314|UBA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9344.4	114.5634	3	1249.5595	1249.5575	R	H	870	881
PSM	QNVAVNELCGR	4366	sp|Q15942|ZYX_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	9-UNIMOD:4	ms_run[1]:scan=1.1.9456.6	117.5597	3	1258.6129	1258.6088	R	C	376	387
PSM	KTGCNVLLIQK	4367	sp|P50991|TCPD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	4-UNIMOD:4	ms_run[1]:scan=1.1.9214.4	111.1215	3	1272.7252	1272.7224	K	S	292	303
PSM	DGYIHYGQTVK	4368	sp|Q06330-7|SUH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9310.7	113.6738	3	1279.6243	1279.6197	R	L	226	237
PSM	RLGLPGDEVDNK	4369	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9443.4	117.205	3	1311.6787	1311.6783	K	V	2704	2716
PSM	IGRNECVVVIR	4370	sp|P05198|IF2A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	6-UNIMOD:4	ms_run[1]:scan=1.1.9280.4	112.8643	3	1313.7238	1313.7238	R	V	65	76
PSM	EQAEAEVASLNR	4371	sp|P06753-2|TPM3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9465.4	117.799	3	1315.6396	1315.6368	R	R	43	55
PSM	KATVFLNPAACK	4372	sp|Q53H12|AGK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	11-UNIMOD:4	ms_run[1]:scan=1.1.9498.5	118.6886	3	1318.7140	1318.7067	K	G	62	74
PSM	KFTQVLEDDEK	4373	sp|Q9NTI5-2|PDS5B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9201.5	110.78	3	1350.6691	1350.6667	K	I	548	559
PSM	VNHAVLAVGYGEK	4374	sp|P09668|CATH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9368.6	115.2012	3	1355.7202	1355.7197	K	N	279	292
PSM	GCAVVEFK	4375	sp|P52272-2|HNRPM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	2-UNIMOD:4	ms_run[1]:scan=1.1.9270.7	112.6079	2	908.4424	908.4426	R	M	113	121
PSM	IVVVTAGVR	4376	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9354.6	114.8285	2	912.5764	912.5757	K	Q	92	101
PSM	DGMVSFHDNPEK	4377	sp|Q9UNS2-2|CSN3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9435.5	116.991	3	1374.5845	1374.5874	K	Y	335	347
PSM	TLATTLAPR	4378	sp|Q9H583|HEAT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9379.8	115.4999	2	942.5494	942.5498	K	V	1812	1821
PSM	NETYNSHPLLVK	4379	sp|Q8NI27|THOC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9196.7	110.6515	3	1413.7219	1413.7252	K	V	529	541
PSM	NAGYAVSLR	4380	sp|P57105|SYJ2B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9416.7	116.491	2	949.4962	949.4981	R	V	87	96
PSM	LLEDSALSK	4381	sp|Q96GM5-2|SMRD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9211.7	111.0471	2	974.5270	974.5284	R	Y	215	224
PSM	ETGYPLAVK	4382	sp|P45974-2|UBP5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9508.5	118.9569	2	976.5210	976.5229	R	L	239	248
PSM	SDQDYILK	4383	sp|Q9UQ80|PA2G4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9521.5	119.3063	2	980.4796	980.4815	K	E	94	102
PSM	LEVNELSGK	4384	sp|Q5T7N2|LITD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9315.6	113.8064	2	987.5238	987.5237	K	L	137	146
PSM	PLIQQAMAK	4385	sp|Q6P2Q9|PRP8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9348.8	114.6741	2	998.5576	998.5583	K	I	1724	1733
PSM	IVAERPGTNSTGPAPMAPPR	4386	sp|Q13263-2|TIF1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9352.5	114.7744	4	2018.0357	2018.0367	K	A	326	346
PSM	IVAERPGTNSTGPAPMAPPR	4387	sp|Q13263-2|TIF1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9332.8	114.2553	4	2018.0357	2018.0367	K	A	326	346
PSM	DGPGFYTTR	4388	sp|P40939|ECHA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9353.6	114.8023	2	1012.4626	1012.4614	K	C	541	550
PSM	LVLVGDGGTGK	4389	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9421.9	116.6249	2	1014.5696	1014.5710	K	T	13	24
PSM	AFELMHSGK	4390	sp|P11766|ADHX_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9446.9	117.2944	2	1018.4900	1018.4906	K	S	358	367
PSM	AVCCLSVVK	4391	sp|Q9NXG2|THUM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	3-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=1.1.9355.7	114.8564	2	1034.5292	1034.5253	K	D	246	255
PSM	VDALLSAQPK	4392	sp|Q9NYU2-2|UGGG1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9433.8	116.9421	2	1040.5848	1040.5866	K	G	926	936
PSM	ADTLTLEER	4393	sp|Q9UHD8|SEPT9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9353.7	114.8039	2	1046.5240	1046.5244	K	V	446	455
PSM	NFGDQPDIR	4394	sp|Q15393|SF3B3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9285.7	113.0013	2	1060.4922	1060.4938	K	C	260	269
PSM	HWGGNVLGPK	4395	sp|P62424|RL7A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9365.9	115.1261	2	1063.5548	1063.5563	R	S	236	246
PSM	QAGLLTTDPR	4396	sp|P82933|RT09_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9208.8	110.9696	2	1070.5698	1070.5720	R	V	366	376
PSM	RVATPVDWK	4397	sp|P30041|PRDX6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9246.2	111.9738	3	1070.5897	1070.5873	K	D	174	183
PSM	CVNTTLQIK	4398	sp|Q01518-2|CAP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	1-UNIMOD:4	ms_run[1]:scan=1.1.9237.8	111.7446	2	1075.5672	1075.5696	K	G	355	364
PSM	IQEENVIPR	4399	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9464.7	117.777	2	1096.5862	1096.5876	K	E	981	990
PSM	LQEQVTDLR	4400	sp|P12270|TPR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9279.10	112.8481	2	1100.5804	1100.5826	K	S	700	709
PSM	IQQQFSDLK	4401	sp|O94906|PRP6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9370.9	115.2599	2	1105.5748	1105.5768	K	R	138	147
PSM	EWGSGSDTLR	4402	sp|P16615-4|AT2A2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9468.9	117.8881	2	1106.4972	1106.4993	R	C	523	533
PSM	DQEFTVDTR	4403	sp|O75369-2|FLNB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9349.8	114.7002	2	1109.4982	1109.4989	K	G	961	970
PSM	LTAQVEELSK	4404	sp|Q14980-2|NUMA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9492.7	118.5305	2	1116.5996	1116.6026	K	K	1533	1543
PSM	TSSQPGFLER	4405	sp|Q9BTV4|TMM43_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9474.8	118.0482	2	1120.5500	1120.5513	K	L	19	29
PSM	LEQEIATYR	4406	sp|P08727|K1C19_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9320.7	113.9395	2	1121.5696	1121.5717	R	S	373	382
PSM	EAIEGTYIDK	4407	sp|P62280|RS11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9513.9	119.0978	2	1137.5512	1137.5553	K	K	49	59
PSM	LALLHEGTGPR	4408	sp|Q9UQE7|SMC3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9421.4	116.6165	3	1162.6489	1162.6458	R	V	62	73
PSM	EIQAPASADIR	4409	sp|O43818|U3IP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9302.10	113.4634	2	1169.6020	1169.6040	K	V	130	141
PSM	QTESTSFLEK	4410	sp|P60900|PSA6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9264.8	112.4528	2	1168.5582	1168.5612	K	K	172	182
PSM	NDVNVEFSEK	4411	sp|Q9Y2Z0-2|SGT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9452.10	117.4582	2	1179.5378	1179.5408	K	E	163	173
PSM	AGTYFSNQAVR	4412	sp|Q14690|RRP5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9408.8	116.2815	2	1212.5848	1212.5887	K	A	318	329
PSM	FTQVLEDDEK	4413	sp|Q9NTI5-2|PDS5B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9401.9	116.095	2	1222.5668	1222.5717	K	I	549	559
PSM	FITDNTVEER	4414	sp|O60264|SMCA5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9444.9	117.2404	2	1222.5804	1222.5830	R	I	607	617
PSM	FSTLTDDPSPR	4415	sp|Q14C86-2|GAPD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9397.9	115.9871	2	1234.5826	1234.5830	R	L	1011	1022
PSM	SNNESSFYAVK	4416	sp|Q86UA1|PRP39_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9369.9	115.2331	2	1244.5682	1244.5673	K	L	487	498
PSM	IETIEVMEDR	4417	sp|P51991|ROA3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	7-UNIMOD:35	ms_run[1]:scan=1.1.9445.10	117.269	2	1249.5834	1249.5860	K	Q	152	162
PSM	NDNDSWDYTK	4418	sp|Q8WVV9-5|HNRLL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9283.11	112.9553	2	1256.4922	1256.4946	R	P	218	228
PSM	NDNDSWDYTK	4419	sp|Q8WVV9-5|HNRLL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9303.11	113.4919	2	1256.4900	1256.4946	R	P	218	228
PSM	QNVAVNELCGR	4420	sp|Q15942|ZYX_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	9-UNIMOD:4	ms_run[1]:scan=1.1.9453.10	117.4851	2	1258.6082	1258.6088	R	C	376	387
PSM	KTGCNVLLIQK	4421	sp|P50991|TCPD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	4-UNIMOD:4	ms_run[1]:scan=1.1.9195.10	110.6301	2	1272.7216	1272.7224	K	S	292	303
PSM	EIQDSQVPLEK	4422	sp|P48681|NEST_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9257.11	112.2761	2	1284.6492	1284.6561	K	E	533	544
PSM	TQIQSVEPYTK	4423	sp|P40763-2|STAT3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9275.9	112.7416	2	1292.6594	1292.6612	K	Q	632	643
PSM	IRYESLTDPSK	4424	sp|P07900-2|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9359.9	114.9659	2	1307.6694	1307.6721	K	L	181	192
PSM	DGVIEASINHEK	4425	sp|O43242|PSMD3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9284.10	112.9799	2	1310.6426	1310.6466	R	G	444	456
PSM	HGESAWNLENR	4426	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9509.3	118.9803	3	1311.5947	1311.5956	R	F	11	22
PSM	PSVYLSTPSSASK	4427	sp|Q9Y5K6|CD2AP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9435.9	116.9976	2	1322.6676	1322.6718	K	A	545	558
PSM	QVDVVITCTGNK	4428	sp|O43865|SAHH2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	8-UNIMOD:4	ms_run[1]:scan=1.1.9460.10	117.6742	2	1332.6682	1332.6708	R	N	366	378
PSM	SDLCDIPACDSK	4429	sp|Q01973|ROR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	4-UNIMOD:4,9-UNIMOD:4	ms_run[1]:scan=1.1.9486.10	118.3743	2	1379.5646	1379.5697	K	D	383	395
PSM	YANEVNSDAGAFK	4430	sp|Q9UHB9|SRP68_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9383.11	115.6128	2	1384.6228	1384.6259	K	N	492	505
PSM	VAQPGPLEPEEPR	4431	sp|Q96HY6|DDRGK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9487.11	118.4029	2	1417.7146	1417.7201	R	A	47	60
PSM	QAEETYENIPGQSK	4432	sp|O00410-3|IPO5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9204.11	110.869	2	1592.7268	1592.7318	K	I	46	60
PSM	VQYTETEPYHNYR	4433	sp|Q86VM9|ZCH18_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9270.9	112.6113	3	1698.7591	1698.7638	R	E	390	403
PSM	KEEELQGALAR	4434	sp|P35580-3|MYH10_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8434.5	90.433	3	1242.6601	1242.6568	K	G	1109	1120
PSM	HALLEADVAAHQDR	4435	sp|Q13813|SPTN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8788.9	99.88695	3	1544.7685	1544.7695	K	I	720	734
PSM	CGAALAGHQLIR	4436	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	1-UNIMOD:4	ms_run[1]:scan=1.1.9416.4	116.4859	3	1265.6698	1265.6663	R	G	25	37
PSM	CGAALAGHQLIR	4437	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	1-UNIMOD:4	ms_run[1]:scan=1.1.9401.4	116.0866	3	1265.6698	1265.6663	R	G	25	37
PSM	EVDGLDVSK	4438	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8642.5	95.94943	2	960.4754	960.4764	K	E	532	541
PSM	SSFSSDPDEK	4439	sp|P46013|KI67_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7187.9	57.64305	2	1097.4520	1097.4513	R	A	127	137
PSM	RAATLAQELEK	4440	sp|Q14683|SMC1A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9293.5	113.2126	3	1228.6768	1228.6775	K	F	385	396
PSM	RAATLAQELEK	4441	sp|Q14683|SMC1A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9292.4	113.1841	3	1228.6768	1228.6775	K	F	385	396
PSM	AESPEEVACR	4442	sp|Q7Z6Z7-2|HUWE1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	9-UNIMOD:4	ms_run[1]:scan=1.1.7583.10	68.16032	2	1146.5018	1146.4975	R	K	1393	1403
PSM	LQHLAESWGGK	4443	sp|Q7Z6Z7-2|HUWE1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9528.5	119.4946	3	1224.6235	1224.6251	R	E	163	174
PSM	DAALATALGDKK	4444	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9274.10	112.7171	2	1172.6248	1172.6401	K	S	146	158
PSM	NDVLAHQATVETVNK	4445	sp|Q9UPN3|MACF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8789.11	99.9171	3	1637.8312	1637.8373	K	A	6271	6286
PSM	QVLQLQASHR	4446	sp|Q9P2E9|RRBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8202.10	84.3547	2	1178.6512	1178.6520	K	E	865	875
PSM	STPVIVSATTK	4447	sp|Q02952-2|AKA12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8508.10	92.41168	2	1102.6220	1102.6234	K	K	1385	1396
PSM	SDTQLVVR	4448	sp|Q92616|GCN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8026.5	79.7518	2	916.4964	916.4978	R	Q	1894	1902
PSM	RQLDTETNLHLNTK	4449	sp|P12270|TPR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9116.4	108.5319	4	1681.8753	1681.8747	K	E	878	892
PSM	PGGGPGLSTPGGHPKPPHR	4450	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7458.3	64.79626	5	1801.9371	1801.9336	K	G	218	237
PSM	VDKLDASESLR	4451	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8465.10	91.27441	2	1231.6384	1231.6408	K	K	1610	1621
PSM	CRDDSFFGETSHNYHK	4452	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	1-UNIMOD:4	ms_run[1]:scan=1.1.9499.6	118.7171	4	1998.8249	1998.8279	R	F	230	246
PSM	DYSDHPSGGSYR	4453	sp|P38159-2|RBMX_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7362.6	62.20973	3	1339.5463	1339.5429	R	D	258	270
PSM	STAGDTHLGGEDFDNR	4454	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8994.9	105.3169	3	1690.7209	1690.7183	K	M	221	237
PSM	RGGSGSHNWGTVK	4455	sp|Q8NC51-3|PAIRB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7195.3	57.851	4	1341.6577	1341.6538	K	D	216	229
PSM	KQELQPGTAYK	4456	sp|P51610-2|HCFC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7404.7	63.34133	3	1261.6681	1261.6666	K	F	1784	1795
PSM	SSEPVQHEESIR	4457	sp|Q9UDY2|ZO2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7254.11	59.41487	3	1396.6618	1396.6582	R	K	952	964
PSM	LNGHQLENHALK	4458	sp|Q9NZI8|IF2B1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8963.3	104.4865	4	1372.7465	1372.7211	K	V	139	151
PSM	GDAMIMEETGK	4459	sp|Q9UQ80|PA2G4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9466.9	117.8343	2	1180.5128	1180.5104	K	I	52	63
PSM	RTAEHEAAQQDLQSK	4460	sp|Q86UP2-4|KTN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.6851.11	48.6339	3	1710.8323	1710.8285	K	F	507	522
PSM	YDDMASAMK	4461	sp|Q04917|1433F_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8788.9	99.88695	2	1030.4106	1030.4099	R	A	20	29
PSM	NSVVEASEAAYK	4462	sp|Q04917|1433F_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9442.9	117.1863	2	1266.6028	1266.6092	K	E	144	156
PSM	HTNYTMEHIR	4463	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7777.7	73.26736	3	1300.6024	1300.5982	K	V	724	734
PSM	LTDCVVMR	4464	sp|P22626-2|ROA2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	4-UNIMOD:4	ms_run[1]:scan=1.1.9135.8	109.029	2	992.4766	992.4783	K	D	35	43
PSM	AYTGFSSNSER	4465	sp|O15355|PPM1G_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8152.3	83.0508	3	1217.5450	1217.5313	K	G	210	221
PSM	VLEEANQAINPK	4466	sp|Q92841-3|DDX17_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9044.5	106.6441	3	1324.7008	1324.6986	K	L	457	469
PSM	SDISPLTPR	4467	sp|P46821|MAP1B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9251.7	112.1135	2	984.5198	984.5240	K	E	1782	1791
PSM	VNTPTTTVYR	4468	sp|P26639-2|SYTC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8305.9	87.02219	2	1150.5978	1150.5983	K	C	277	287
PSM	VAEDFVSPEHVK	4469	sp|Q7LBC6|KDM3B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9503.8	118.8277	3	1355.6728	1355.6721	K	H	1700	1712
PSM	EFEDPRDAPPPTR	4470	sp|P08621|RU17_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8878.7	102.2688	3	1525.7134	1525.7161	R	A	47	60
PSM	TVSHEAEVHAESLQQK	4471	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8257.11	85.7535	3	1791.8773	1791.8751	K	L	1363	1379
PSM	SSDVSWSDTR	4472	sp|O14776-2|TCRG1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8754.9	98.9702	2	1138.4836	1138.4891	R	R	892	902
PSM	TTYGGAAAAVR	4473	sp|P49790-3|NU153_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7768.9	73.03574	2	1036.5302	1036.5302	K	Q	264	275
PSM	PDYLGADQRK	4474	sp|P35998|PRS7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7734.4	72.17795	3	1161.5680	1161.5778	M	T	2	12
PSM	MEQQQLEEQK	4475	sp|Q9NRZ9-2|HELLS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7401.11	63.26663	2	1289.6060	1289.5921	K	K	70	80
PSM	LAGESESNLRK	4476	sp|P55072|TERA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7117.11	55.73512	2	1202.6288	1202.6255	K	A	278	289
PSM	VPPPPPIAR	4477	sp|P07910-2|HNRPC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8502.2	92.23904	3	942.5668	942.5651	R	A	130	139
PSM	HSEAFEALQQK	4478	sp|Q07065|CKAP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8950.3	104.138	3	1286.6257	1286.6255	R	S	395	406
PSM	VQQAELHTGSLPR	4479	sp|Q13085-2|ACACA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8810.8	100.4777	3	1434.7564	1434.7579	K	I	768	781
PSM	TTANAIYCPPK	4480	sp|O00231-2|PSD11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	8-UNIMOD:4	ms_run[1]:scan=1.1.8769.11	99.3787	2	1234.6018	1234.6016	R	L	195	206
PSM	YNLDASEEEDSNKK	4481	sp|O95218-2|ZRAB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8015.9	79.46568	3	1640.7100	1640.7165	K	K	183	197
PSM	AAELETDIR	4482	sp|O94906|PRP6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8939.9	103.8536	2	1016.5118	1016.5138	R	A	379	388
PSM	RSTTLDAGNIK	4483	sp|O75400-2|PR40A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7578.3	68.0135	3	1174.6330	1174.6306	K	L	681	692
PSM	LAQHITYVHQHSR	4484	sp|P33993|MCM7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7293.3	60.40197	4	1588.8253	1588.8222	R	Q	533	546
PSM	TPAQYDASELK	4485	sp|P07355-2|ANXA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8889.5	102.5484	3	1221.5878	1221.5877	K	A	123	134
PSM	HADIVTTTTHK	4486	sp|P34897-2|GLYM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.6948.5	51.22872	3	1222.6351	1222.6306	K	T	260	271
PSM	LFPVCHDSDESDTAK	4487	sp|Q9Y6K1|DNM3A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	5-UNIMOD:4	ms_run[1]:scan=1.1.8963.11	104.4999	3	1719.7393	1719.7410	K	A	383	398
PSM	TAVCDIPPR	4488	sp|Q9BVA1|TBB2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	4-UNIMOD:4	ms_run[1]:scan=1.1.9160.5	109.6881	2	1027.5000	1027.5121	K	G	351	360
PSM	TAVCDIPPR	4489	sp|Q9BVA1|TBB2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	4-UNIMOD:4	ms_run[1]:scan=1.1.8716.8	97.94365	2	1027.5130	1027.5121	K	G	351	360
PSM	VYDESIQLDHK	4490	sp|Q07954|LRP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9321.5	113.9623	3	1345.6519	1345.6514	K	G	1835	1846
PSM	VARPLPAEEPER	4491	sp|P26358|DNMT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7779.5	73.31578	3	1362.7252	1362.7255	R	A	213	225
PSM	IEQVDKEDEITEK	4492	sp|Q9Y2X3|NOP58_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8222.9	84.86103	3	1574.7640	1574.7675	K	K	445	458
PSM	EGGTVVYGGK	4493	sp|P49419-2|AL7A1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7347.10	61.81272	2	965.4836	965.4818	K	V	363	373
PSM	IADGYEQAAR	4494	sp|P48643|TCPE_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7700.6	71.28257	3	1092.5215	1092.5200	R	V	133	143
PSM	VLVAQHDVYK	4495	sp|P13804|ETFA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8171.5	83.544	3	1170.6388	1170.6397	K	G	76	86
PSM	VLVAQHDVYK	4496	sp|P13804|ETFA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8174.9	83.62952	2	1170.6390	1170.6397	K	G	76	86
PSM	HGVIVAADSR	4497	sp|P28074|PSB5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7211.3	58.2806	3	1023.5509	1023.5461	R	A	69	79
PSM	DTGKTPVEPEVAIHR	4498	sp|P60866-2|RS20_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9041.4	106.5623	4	1647.8605	1647.8580	K	I	5	20
PSM	DREEDEEDAYER	4499	sp|P49756|RBM25_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7768.9	73.03574	3	1554.6067	1554.6070	R	R	432	444
PSM	HVLTGSADNSCR	4500	sp|Q13347|EIF3I_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	11-UNIMOD:4	ms_run[1]:scan=1.1.6889.5	49.65457	3	1315.5979	1315.5939	K	L	66	78
PSM	KFEEEGNPYYSSAR	4501	sp|Q9HCC0-2|MCCB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9473.6	118.0179	3	1675.7419	1675.7478	K	V	474	488
PSM	LEAIEDDSVK	4502	sp|P54578-2|UBP14_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8830.11	101.0192	2	1117.5482	1117.5503	K	E	180	190
PSM	SEAQLQEIR	4503	sp|P35658-5|NU214_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8654.2	96.26707	3	1072.5520	1072.5513	K	R	796	805
PSM	DGNDLHMTYK	4504	sp|O60884|DNJA2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8652.3	96.21503	3	1192.5187	1192.5183	R	I	263	273
PSM	ADTLTPEECQQFKK	4505	sp|Q16181-2|SEPT7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	9-UNIMOD:4	ms_run[1]:scan=1.1.9091.8	107.8934	3	1693.7995	1693.7981	K	Q	195	209
PSM	REFTESQLQEGK	4506	sp|Q01995|TAGL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8346.9	88.10883	3	1450.7035	1450.7052	K	H	161	173
PSM	LQLVEAECK	4507	sp|Q9Y3P9|RBGP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	8-UNIMOD:4	ms_run[1]:scan=1.1.9485.6	118.3409	2	1088.5514	1088.5536	K	I	1019	1028
PSM	IQAGEIGEMK	4508	sp|P16989|YBOX3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9375.6	115.3887	2	1074.5392	1074.5379	R	D	259	269
PSM	IQTQPGYANTLR	4509	sp|Q00325-2|MPCP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9322.6	113.99	3	1360.7068	1360.7099	R	D	189	201
PSM	VLEEGSVEAR	4510	sp|Q96CT7|CC124_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7841.9	74.92532	2	1087.5520	1087.5509	R	T	136	146
PSM	VGIGPGSVCTTR	4511	sp|Q9P2T1-2|GMPR2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	9-UNIMOD:4	ms_run[1]:scan=1.1.9282.9	112.9256	2	1202.6074	1202.6078	K	K	196	208
PSM	EAYPDHTQFEK	4512	sp|Q9P016-2|THYN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8406.7	89.6994	3	1363.6075	1363.6044	K	N	132	143
PSM	SQPELIEAHTCER	4513	sp|Q9BTW9-4|TBCD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	11-UNIMOD:4	ms_run[1]:scan=1.1.8762.8	99.18497	3	1568.7253	1568.7253	R	I	889	902
PSM	ALAAPAAEEKEEAR	4514	sp|Q01650|LAT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7595.8	68.48164	3	1454.7421	1454.7365	R	E	10	24
PSM	THLASDDLYK	4515	sp|Q9H7B2|RPF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8436.3	90.4835	3	1161.5674	1161.5666	R	L	228	238
PSM	LITKPSEGTTLR	4516	sp|P49959-3|MRE11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8276.7	86.24384	3	1314.7513	1314.7507	K	V	420	432
PSM	SSHETLNIVEEK	4517	sp|O43491-4|E41L2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8972.7	104.7348	3	1384.6807	1384.6834	K	K	612	624
PSM	LNQSPSLAPVK	4518	sp|Q9H2P0|ADNP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8733.9	98.4032	2	1152.6480	1152.6503	R	R	706	717
PSM	PVFATVDGQEK	4519	sp|Q10713|MPPA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9410.9	116.3368	2	1189.5962	1189.5979	K	F	54	65
PSM	PVFATVDGQEK	4520	sp|Q10713|MPPA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9430.10	116.8645	2	1189.5962	1189.5979	K	F	54	65
PSM	CHPQTIAVVQTR	4521	sp|P23378|GCSP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	1-UNIMOD:4	ms_run[1]:scan=1.1.8179.6	83.75784	3	1408.7236	1408.7245	R	A	225	237
PSM	DSAQCAAIAER	4522	sp|Q96RS6-2|NUDC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	5-UNIMOD:4	ms_run[1]:scan=1.1.7700.11	71.2909	2	1190.5382	1190.5350	R	L	343	354
PSM	INVYYNESSSQK	4523	sp|Q9BUF5|TBB6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9186.6	110.386	3	1430.6662	1430.6677	R	Y	47	59
PSM	SCSNAAFALK	4524	sp|Q68CP9-3|ARID2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	2-UNIMOD:4	ms_run[1]:scan=1.1.9377.8	115.446	2	1067.5058	1067.5070	R	Q	81	91
PSM	TGVHHYSGNNIELGTACGK	4525	sp|P62888|RL30_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	17-UNIMOD:4	ms_run[1]:scan=1.1.8632.7	95.68397	4	2013.9301	2013.9327	K	Y	69	88
PSM	GALQQGEAFQR	4526	sp|Q96AQ6-2|PBIP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9109.10	108.3606	2	1203.5968	1203.5996	R	A	286	297
PSM	HQIVEVAGDDK	4527	sp|Q07960|RHG01_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7617.4	69.06423	3	1209.6013	1209.5990	R	Y	70	81
PSM	LCVQNSPQEAR	4528	sp|P33240-2|CSTF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	2-UNIMOD:4	ms_run[1]:scan=1.1.7576.5	67.96273	3	1300.6234	1300.6194	K	N	149	160
PSM	SLVESVSSSPNK	4529	sp|Q9H2U2-2|IPYR2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8520.11	92.72923	2	1232.6064	1232.6248	R	E	324	336
PSM	PGPTPSGTNVGSSGR	4530	sp|P60468|SC61B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7214.5	58.36493	3	1369.6612	1369.6586	M	S	2	17
PSM	FLQEHLAPK	4531	sp|P26440|IVD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8745.7	98.72387	2	1081.5902	1081.5920	K	A	59	68
PSM	RIIDDSEITK	4532	sp|Q96A72|MGN2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8678.2	96.91123	3	1188.6367	1188.6350	K	E	64	74
PSM	TPATAPVPAR	4533	sp|P18887|XRCC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7305.3	60.70908	2	979.5470	979.5451	R	A	281	291
PSM	EENSTEEQALEDQNAK	4534	sp|Q9NQZ2|SAS10_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8617.9	95.28422	3	1833.7888	1833.7864	K	R	393	409
PSM	SDSPVPTAPTSGGPK	4535	sp|Q86U44|MTA70_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8328.11	87.63744	2	1396.6902	1396.6834	R	P	48	63
PSM	QCFHEEVEQGVK	4536	sp|Q9Y3Q3-2|TMED3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	2-UNIMOD:4	ms_run[1]:scan=1.1.8322.9	87.47428	3	1488.6649	1488.6667	K	F	39	51
PSM	SQGGEPTYNVAVGR	4537	sp|P35080|PROF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9341.6	114.4884	3	1433.6893	1433.6899	K	A	92	106
PSM	RFVAGALGPTNK	4538	sp|Q99707|METH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8713.5	97.85876	3	1229.6902	1229.6880	K	T	140	152
PSM	PQNEYIELHR	4539	sp|O95478|NSA2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9512.3	119.0609	3	1297.6564	1297.6415	M	K	2	12
PSM	LTDEGAVHVNDR	4540	sp|O95487-2|SC24B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7653.7	70.0398	3	1324.6405	1324.6371	R	I	1092	1104
PSM	NCIAQTSAVVK	4541	sp|Q4VC31|CCD58_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	2-UNIMOD:4	ms_run[1]:scan=1.1.8263.4	85.89561	3	1189.6162	1189.6125	K	N	73	84
PSM	KFPHLAEAQK	4542	sp|Q9HD33-2|RM47_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7971.4	78.32295	3	1167.6418	1167.6400	K	S	217	227
PSM	GPLLVSTESHPVK	4543	sp|Q9Y3A4|RRP7A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9056.5	106.9648	3	1362.7468	1362.7507	K	S	137	150
PSM	GPLLVSTESHPVK	4544	sp|Q9Y3A4|RRP7A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.9037.4	106.4554	3	1362.7495	1362.7507	K	S	137	150
PSM	NEEENENSISQYK	4545	sp|P82673|RT35_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8635.8	95.7662	3	1582.6855	1582.6747	K	E	301	314
PSM	GHQDLDPDNEGELR	4546	sp|Q9ULF5|S39AA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8682.11	97.03408	3	1593.6919	1593.7019	R	H	293	307
PSM	LYDRDVASAAPEK	4547	sp|Q9Y2S7|PDIP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8158.7	83.21185	3	1433.7142	1433.7150	R	A	102	115
PSM	RSVIGSSCLIK	4548	sp|Q9NR50|EI2BG_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	8-UNIMOD:4	ms_run[1]:scan=1.1.9522.3	119.3297	3	1218.6712	1218.6754	K	D	372	383
PSM	SAGLPSHSSVISQHSK	4549	sp|P82909|RT36_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7662.6	70.28053	4	1620.8285	1620.8220	R	G	42	58
PSM	LGDAASSKPSIR	4550	sp|A6NKD9|CC85C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7326.3	61.25845	3	1200.6391	1200.6462	K	Q	396	408
PSM	QASEKELLIAGR	4551	sp|Q9NY91|SC5A4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7844.5	74.99516	3	1313.7118	1313.7303	K	I	416	428
PSM	DREVAEGGLPR	4552	sp|Q9BUA3|SPNDC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.7943.4	77.57667	3	1197.6136	1197.6102	K	A	295	306
PSM	FRNPPGGDNLEER	4553	sp|Q9NV96-2|CC50A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.8393.9	89.3653	3	1499.7106	1499.7117	K	F	178	191
PSM	MELKQSLSTHLEAEK	4554	sp|Q96MC5|CP045_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	1-UNIMOD:35	ms_run[1]:scan=1.1.7533.8	66.81033	4	1758.8993	1758.8822	-	P	1	16
PSM	DAPQDFHPDR	4555	sp|P21333|FLNA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.7787.7	73.52465	2	1197.531847	1196.521050	R	V	665	675
PSM	CMLQDREDQSILCTGESGAGK	4556	sp|P35580|MYH10_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21	1-UNIMOD:4,13-UNIMOD:4	ms_run[1]:scan=1.1.9134.9	109.0082	4	2356.005294	2354.030080	R	T	164	185
PSM	CPPGVVPACHNSK	4557	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:385,1-UNIMOD:4,9-UNIMOD:4	ms_run[1]:scan=1.1.9027.11	106.1997	2	1404.6267	1404.6273	R	D	634	647
PSM	VNGDASPAAAESGAK	4558	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.7123.11	55.89938	2	1344.618047	1343.631723	K	E	41	56
PSM	DGEEAGAYDGPR	4559	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.8002.9	79.12853	2	1236.506047	1235.505459	R	T	108	120
PSM	TVLDQQQTPSR	4560	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.7655.5	70.09052	3	1272.656171	1271.646979	K	L	1129	1140
PSM	LQDVADSFKK	4561	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.9109.2	108.3472	3	1150.609571	1149.602989	K	I	2425	2435
PSM	RQELEAELAK	4562	sp|Q15149|PLEC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.8510.5	92.45627	3	1186.642271	1185.635351	K	V	1887	1897
PSM	RGPAEESSSWR	4563	sp|Q14152|EIF3A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.7663.8	70.3104	3	1261.590071	1260.584713	R	D	1250	1261
PSM	TPTQTNGSNVPFKPR	4564	sp|P78347|GTF2I_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.9062.9	107.132	3	1643.821871	1642.842718	R	G	703	718
PSM	TPTQTNGSNVPFKPR	4565	sp|P78347|GTF2I_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.8845.7	101.4039	3	1643.823371	1642.842718	R	G	703	718
PSM	FHHTFSTEIAK	4566	sp|P13667|PDIA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.8594.4	94.66885	3	1317.641471	1316.651336	K	F	336	347
PSM	NIEELQQQNQR	4567	sp|P12270|TPR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.8358.11	88.4319	2	1399.686647	1398.685155	R	L	542	553
PSM	YHTINGHNAEVR	4568	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.7514.5	66.29568	4	1410.669294	1409.680010	K	K	174	186
PSM	YHTINGHNAEVR	4569	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.7495.6	65.7945	4	1410.669294	1409.680010	K	K	174	186
PSM	QEMQEVQSSR	4570	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:28	ms_run[1]:scan=1.1.8477.8	91.59364	2	1203.5191	1203.5185	R	S	191	201
PSM	VDEVPDGAVKPPTNK	4571	sp|O75475|PSIP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.8631.8	95.6588	3	1565.820671	1564.809687	R	L	25	40
PSM	CREMDEQIR	4572	sp|P06753-2|TPM3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.9372.11	115.3168	2	1219.5122	1218.5112	R	L	154	163
PSM	YGDGGSTFQSTTGHCVHMR	4573	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21	15-UNIMOD:4	ms_run[1]:scan=1.1.9397.7	115.9838	4	2097.876094	2096.879257	R	G	276	295
PSM	NFGDQPDIR	4574	sp|Q15393|SF3B3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.9265.5	112.4739	2	1061.497847	1060.493772	K	C	260	269
PSM	SEHPPLCGR	4575	sp|Q15393|SF3B3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21	7-UNIMOD:4	ms_run[1]:scan=1.1.7106.5	55.4245	3	1052.493371	1051.486913	R	D	1150	1159
PSM	LITDNTVEER	4576	sp|P28370|SMCA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.8585.5	94.44028	2	1189.599647	1188.598632	R	I	622	632
PSM	QTYSTEPNNLK	4577	sp|P46779|RL28_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:28	ms_run[1]:scan=1.1.9272.11	112.6666	2	1276.5891	1276.5930	K	A	23	34
PSM	ATTATMATSGSAR	4578	sp|P38919|IF4A3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:1	ms_run[1]:scan=1.1.8409.11	89.78322	2	1266.5965	1266.5869	M	K	2	15
PSM	ALAAAGYDVEK	4579	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	21		ms_run[1]:scan=1.1.9351.8	114.7528	2	1107.5652	1106.5602	K	N	65	76
PSM	SETAPAAPAAPAPAEK	4580	sp|P10412|H14_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:1	ms_run[1]:scan=1.1.9033.9	106.3569	3	1519.7524	1519.7513	M	T	2	18
PSM	EEAGGEAAAAAAAER	4581	sp|O14497|ARI1A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.8509.6	92.43153	3	1373.616671	1372.621886	R	G	33	48
PSM	AAVQAAEVK	4582	sp|Q15046|SYK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:1	ms_run[1]:scan=1.1.8789.6	99.90877	2	927.5015	927.5020	M	V	2	11
PSM	AAVQAAEVK	4583	sp|Q15046|SYK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:1	ms_run[1]:scan=1.1.8808.5	100.4186	2	927.5015	927.5020	M	V	2	11
PSM	QALHSGQNQLK	4584	sp|P54886|P5CS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:28	ms_run[1]:scan=1.1.7636.11	69.58852	2	1205.6154	1205.6148	R	E	139	150
PSM	MRAEDGENYDIK	4585	sp|O75347|TBCA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.8362.8	88.53381	3	1440.633371	1439.635093	K	K	40	52
PSM	ESVFTVEGGHR	4586	sp|Q99623|PHB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.9132.9	108.9537	2	1217.581847	1216.583650	R	A	38	49
PSM	RGAAGDWGER	4587	sp|Q14978|NOLC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.7538.2	66.93494	3	1074.519971	1073.500255	K	A	648	658
PSM	EGLDDQGLTK	4588	sp|Q9UKA9|PTBP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.8667.7	96.62331	2	1075.530847	1074.519319	R	D	420	430
PSM	TGVHHYSGNNIELGTACGK	4589	sp|P62888|RL30_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21	17-UNIMOD:4	ms_run[1]:scan=1.1.8998.7	105.4196	4	2014.920094	2013.932673	K	Y	69	88
PSM	AAPEGSGLGEDAR	4590	sp|Q96G03|PGM2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:1	ms_run[1]:scan=1.1.9108.11	108.3364	2	1270.5715	1270.5784	M	L	2	15
PSM	QCVDHYNEVK	4591	sp|O95299|NDUAA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:28,2-UNIMOD:4	ms_run[1]:scan=1.1.8286.9	86.51437	2	1273.5397	1273.5392	K	S	182	192
PSM	YRPGTVALR	4592	sp|Q16695|H31T_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.8191.2	84.05955	3	1032.590171	1031.587613	R	E	42	51
PSM	TTAARPTFEPAR	4593	sp|Q9P013|CWC15_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:1	ms_run[1]:scan=1.1.9483.11	118.2954	2	1358.6877	1358.6937	M	G	2	14
PSM	LQAEAQQLRK	4594	sp|Q16543|CDC37_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.7254.5	59.40487	3	1184.670971	1183.667320	R	E	84	94
PSM	VHPEIINENGNPSYK	4595	sp|O95881|TXD12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	21		ms_run[1]:scan=1.1.9462.11	117.7297	3	1710.8152	1709.8372	K	Y	124	139
PSM	GDPERPEAAGLDQDER	4596	sp|Q7LG56|RIR2B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:1	ms_run[1]:scan=1.1.9437.11	117.0549	2	1795.7890	1795.7968	M	S	2	18
PSM	NRDHDTFLAVR	4597	sp|Q12907|LMAN2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.8939.4	103.8453	3	1343.672771	1342.674196	R	Y	208	219
PSM	YSTSAPAISR	4598	sp|P56747|CLD6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.8200.10	84.30209	2	1052.531247	1051.529824	R	G	200	210
PSM	RPANQFVPR	4599	sp|P67870|CSK2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.7753.2	72.64073	3	1084.604771	1083.593761	K	L	178	187
PSM	SGSSSVAAMK	4600	sp|P63218|GBG5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:1	ms_run[1]:scan=1.1.7850.5	75.14964	2	965.4556	965.4483	M	K	2	12
PSM	SQAGAQEAPIK	4601	sp|Q8IVN3|MSTN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:1	ms_run[1]:scan=1.1.8776.4	99.55575	3	1141.5722	1140.5772	M	K	2	13
PSM	EPSEVPTPK	4602	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.7499.10	65.90688	2	983.499647	982.497127	K	R	47	56
PSM	SAAMTLNER	4603	sp|Q9NYF8|BCLF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.7921.6	77.00505	2	992.480447	991.475680	K	F	623	632
PSM	LLVSHGAEVTCK	4604	sp|O15084|ANR28_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21	11-UNIMOD:4	ms_run[1]:scan=1.1.7957.5	77.9497	3	1311.690671	1312.680922	K	D	191	203
PSM	RFPGYDSESK	4605	sp|P46777|RL5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.8052.7	80.45438	2	1183.555447	1184.546202	K	E	179	189
PSM	KGESQTDIEITR	4606	sp|P49368|TCPG_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.8064.6	80.77515	3	1377.712271	1375.694323	K	E	249	261
PSM	GAFCEVRPDDK	4607	sp|O60502|OGA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21	4-UNIMOD:4	ms_run[1]:scan=1.1.8146.9	82.90681	2	1291.579447	1292.581936	R	R	875	886
PSM	PGFSIADKK	4608	sp|P62913|RL11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.8175.2	83.64442	3	961.524671	961.523282	R	R	137	146
PSM	TDRPLPENPYHSR	4609	sp|P51970|NDUA8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.8314.10	87.26266	3	1580.769671	1580.769554	K	P	133	146
PSM	QQALTVSTDPEHR	4610	sp|P35606|COPB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.8355.6	88.34347	3	1479.723971	1480.727020	K	F	632	645
PSM	RGGPISFSSSR	4611	sp|P35580|MYH10_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.8397.2	89.45831	3	1151.576471	1149.589070	R	S	1930	1941
PSM	TDAVDSVVR	4612	sp|Q7KZF4|SND1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.8400.9	89.54795	2	961.486847	960.487624	R	D	811	820
PSM	VGQAVDVVGQAGK	4613	sp|Q13200|PSMD2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.8647.10	96.09261	2	1227.658247	1226.661900	R	P	846	859
PSM	TLLADQGEIR	4614	sp|O94776|MTA2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.8711.4	97.80405	3	1113.607871	1114.598238	K	V	139	149
PSM	AQQVAVQEQEIAR	4615	sp|O75955|FLOT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.8923.7	103.4262	3	1467.752171	1468.763406	R	R	262	275
PSM	DPNIVIAK	4616	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.8969.5	104.651	2	869.504847	868.501818	K	M	426	434
PSM	DPNIVIAK	4617	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.8988.6	105.1531	2	869.504447	868.501818	K	M	426	434
PSM	HQAFEAELHANADR	4618	sp|Q13813|SPTN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.9005.10	105.6104	3	1606.717871	1607.744067	K	I	1592	1606
PSM	CLGPLVSK	4619	sp|Q86VP6|CAND1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21	1-UNIMOD:4	ms_run[1]:scan=1.1.9110.4	108.3764	2	871.478647	872.478974	K	V	71	79
PSM	LTRDETNYGIPQR	4620	sp|P63244|RACK1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.9252.11	112.1462	2	1560.771847	1561.784869	K	A	45	58
PSM	LNGGLGTSMGCK	4621	sp|Q16851|UGPA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21	11-UNIMOD:4	ms_run[1]:scan=1.1.9265.8	112.4789	2	1194.534847	1193.553278	K	G	113	125
PSM	SVSLTGAPESVQK	4622	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.9298.4	113.3455	3	1302.661571	1301.682696	R	A	191	204
PSM	GFYSNGAASSVSTK	4623	sp|P35251|RFC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.9342.11	114.5228	2	1375.620847	1374.641559	K	H	701	715
PSM	LTNAEGVEFK	4624	sp|O76094|SRP72_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.9351.8	114.7528	2	1107.565447	1106.560789	K	L	288	298
PSM	LIQGAPTIR	4625	sp|P18065|IBP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.9403.6	116.1438	2	968.579647	967.581465	K	G	293	302
PSM	PSVICHTTVTALK	4626	sp|Q15583|TGIF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21	5-UNIMOD:4	ms_run[1]:scan=1.1.9487.5	118.3929	3	1425.764771	1425.764986	R	D	299	312
PSM	FHHTIGGSR	4627	sp|P61313|RL15_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.6904.2	50.01983	3	1010.5102	1010.5046	K	R	180	189
PSM	FHHTIGGSR	4628	sp|P61313|RL15_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.6854.3	48.7027	3	1010.5102	1010.5046	K	R	180	189
PSM	SAAETVTK	4629	sp|P61604|CH10_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.6687.3	44.162	2	805.4216	805.4181	R	G	21	29
PSM	VKVEEEEEEK	4630	sp|Q9Y2X3|NOP58_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.6937.5	50.93023	3	1246.5994	1246.5928	K	V	466	476
PSM	SHRPQQNVGVQGAATR	4631	sp|O75362|ZN217_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.6941.4	51.03738	4	1704.8877	1704.8768	K	Q	820	836
PSM	KPFSQHVR	4632	sp|Q02878|RL6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.6869.2	49.10998	3	997.5514	997.5457	K	K	131	139
PSM	HIVENAVQK	4633	sp|O00410-3|IPO5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.6930.9	50.7448	2	1036.5700	1036.5665	K	E	558	567
PSM	HGATHVFASK	4634	sp|O60264|SMCA5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.6901.5	49.94447	3	1053.5392	1053.5356	R	E	656	666
PSM	RHPAGPPGEAQEGSAK	4635	sp|Q6P1M3-2|L2GL2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.6750.5	45.89177	3	1587.7792	1587.7753	K	A	667	683
PSM	HADNCAGPDGVEGENGGETKK	4636	sp|P49711|CTCF_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	5-UNIMOD:4	ms_run[1]:scan=1.1.6946.11	51.18438	4	2140.9101	2140.9080	R	S	573	594
PSM	AEDGATPSPSNETPKK	4637	sp|P29966|MARCS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.6885.7	49.55008	3	1627.7737	1627.7689	K	K	138	154
PSM	RGSNTTSHLHQAVAK	4638	sp|P22695|QCR2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.6763.5	46.23767	4	1605.8373	1605.8335	K	A	301	316
PSM	TSYAQHQQVR	4639	sp|P61247|RS3A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.6833.11	48.1434	2	1216.5942	1216.5949	K	Q	153	163
PSM	AGEGRPNGEGAEPGPGR	4640	sp|Q9P2Y4|ZN219_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.6912.9	50.25045	3	1606.7434	1606.7448	R	S	386	403
PSM	PVYHAITK	4641	sp|O75643|U520_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7259.2	59.52875	3	927.5197	927.5178	K	H	1545	1553
PSM	KQDPPVTHDLR	4642	sp|P25685-2|DNJB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7149.2	56.59505	4	1304.6881	1304.6837	K	V	59	70
PSM	KPHTLLQR	4643	sp|P49915|GUAA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7150.4	56.62587	3	991.5970	991.5927	K	V	478	486
PSM	LGNDFHTNK	4644	sp|P08708|RS17_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7204.2	58.09497	3	1044.5035	1044.4989	R	R	24	33
PSM	KPPTDEELK	4645	sp|P35659|DEK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7092.2	55.0435	3	1055.5648	1055.5499	K	E	318	327
PSM	APQHTAVGFK	4646	sp|O43242|PSMD3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7344.3	61.71992	3	1054.5589	1054.5560	K	Q	316	326
PSM	YHTINGHNAEVR	4647	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7186.3	57.60588	4	1409.6849	1409.6800	K	K	162	174
PSM	ATTHEIMGPK	4648	sp|Q13492-2|PICAL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7208.4	58.20348	3	1083.5236	1083.5383	K	K	29	39
PSM	IIRPSETAGR	4649	sp|P19388|RPAB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7175.2	57.30423	3	1098.6190	1098.6145	K	Y	193	203
PSM	KLENEVEQR	4650	sp|P12270|TPR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7146.5	56.51773	3	1143.5869	1143.5884	K	H	854	863
PSM	ERPPEEVAAR	4651	sp|Q16891-2|MIC60_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7117.3	55.72178	3	1152.5950	1152.5887	R	L	185	195
PSM	AGHCAVAINTR	4652	sp|P51610-2|HCFC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	4-UNIMOD:4	ms_run[1]:scan=1.1.7280.6	60.07485	3	1168.5766	1168.5771	R	L	323	334
PSM	ITDESGHLAEK	4653	sp|P49750|YLPM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7186.6	57.61088	3	1198.5877	1198.5830	K	A	2128	2139
PSM	LRPEAQPHPSAGPKPAESK	4654	sp|Q07157-2|ZO1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7011.4	52.85475	5	1996.0591	1996.0490	R	Q	1091	1110
PSM	VAPHALSEEEK	4655	sp|Q9UI26-2|IPO11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7210.3	58.25425	3	1208.6086	1208.6037	R	T	117	128
PSM	RATVLESEGTR	4656	sp|Q9UJZ1-2|STML2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7279.7	60.0504	3	1217.6398	1217.6364	K	E	156	167
PSM	RHFNAPSHIR	4657	sp|P61254|RL26_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7250.6	59.30073	3	1233.6466	1233.6479	K	R	17	27
PSM	EHMQPTHPIR	4658	sp|P61981|1433G_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.6994.6	52.44613	3	1244.6116	1244.6084	K	L	163	173
PSM	AQLEVQASQHR	4659	sp|Q9UDT6|CLIP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7321.3	61.12103	3	1265.6530	1265.6476	R	L	705	716
PSM	DSYGGPPR	4660	sp|P38159-2|RBMX_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7168.7	57.12185	2	847.3842	847.3824	R	R	175	183
PSM	CGSSEDLHDVR	4661	sp|Q7Z4V5-2|HDGR2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	1-UNIMOD:4	ms_run[1]:scan=1.1.7323.7	61.1809	3	1273.5400	1273.5357	R	E	631	642
PSM	ESQKVELSESR	4662	sp|P25205|MCM3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7268.4	59.76417	3	1290.6529	1290.6415	K	L	733	744
PSM	AIIESDQEQGRK	4663	sp|Q12765-2|SCRN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7135.6	56.21993	3	1372.6978	1372.6946	R	L	376	388
PSM	FKDPNAPK	4664	sp|P09429|HMGB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.6970.2	51.81165	3	915.4867	915.4814	K	R	89	97
PSM	RPEGPGAQAPSSPR	4665	sp|P40222|TXLNA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7047.7	53.83498	3	1405.7107	1405.7062	R	V	504	518
PSM	TRAEAEAAAVHGAR	4666	sp|Q5T8P6-2|RBM26_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7099.6	55.23545	3	1408.7227	1408.7171	K	F	910	924
PSM	SKIETEIK	4667	sp|Q9HB71|CYBP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7251.3	59.32207	3	946.5370	946.5335	K	N	34	42
PSM	VQAQAEQGQQELK	4668	sp|Q9BW19|KIFC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7340.10	61.62342	3	1455.7300	1455.7317	K	N	195	208
PSM	AAANEQLTR	4669	sp|Q9NX63|MIC19_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1000663, ProteinPilot, ]	20		ms_run[1]:scan=1.1.7041.9	53.67333	2	972.51224709566	972.4988575413599	R	A	96	105
PSM	FHVEEEGK	4670	sp|P00558|PGK1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7333.7	61.43977	2	973.4522	973.4505	R	G	124	132
PSM	KVAPAPAVVK	4671	sp|P62424|RL7A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7109.9	55.51299	2	978.6272	978.6226	K	K	11	21
PSM	YGDGPRPPK	4672	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7000.6	52.58847	2	985.4992	985.4981	R	M	1155	1164
PSM	PHSVSLNDTETRK	4673	sp|Q9P0L0|VAPA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7204.9	58.10663	3	1482.7369	1482.7427	K	L	162	175
PSM	ITNHIHVR	4674	sp|P49736|MCM2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7046.8	53.80903	2	988.5588	988.5566	R	I	277	285
PSM	FHPIQGHR	4675	sp|Q13151|ROA0_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7005.2	52.71453	3	990.5185	990.5148	K	V	160	168
PSM	VAGDCLDEK	4676	sp|Q96AG4|LRC59_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	5-UNIMOD:4	ms_run[1]:scan=1.1.7282.10	60.13358	2	1005.4456	1005.4437	K	Q	127	136
PSM	VTEGGEPYR	4677	sp|Q14697|GANAB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7241.5	59.07063	2	1006.4734	1006.4720	K	L	270	279
PSM	HAYGDQYR	4678	sp|O75874|IDHC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7163.10	56.9907	2	1008.4420	1008.4413	R	A	133	141
PSM	CFGTGAAGNR	4679	sp|P78527|PRKDC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	1-UNIMOD:4	ms_run[1]:scan=1.1.7305.4	60.71242	2	1009.4418	1009.4400	K	T	1312	1322
PSM	GEGQLGPAER	4680	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7354.10	62.00175	2	1012.4954	1012.4938	K	A	240	250
PSM	KVHPAVVIR	4681	sp|P62829|RL23_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7247.2	59.21577	3	1017.6463	1017.6447	K	Q	75	84
PSM	NKFEEAER	4682	sp|P14314-2|GLU2B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7037.3	53.55368	3	1021.4872	1021.4828	R	S	372	380
PSM	EGIPPDQQR	4683	sp|P62979|RS27A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7057.10	54.11255	2	1038.5222	1038.5094	K	L	34	43
PSM	ANPFGGASHAK	4684	sp|P62266|RS23_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7312.2	60.88368	3	1055.5189	1055.5148	K	G	38	49
PSM	LDELRDEGK	4685	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7340.3	61.61175	3	1073.5417	1073.5353	K	A	206	215
PSM	IREEYPDR	4686	sp|Q9BVA1|TBB2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7267.5	59.74363	2	1076.5254	1076.5250	K	I	155	163
PSM	HNTAVSQLTK	4687	sp|Q9NTJ3|SMC4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7210.10	58.26591	2	1097.5856	1097.5829	R	A	513	523
PSM	ESPQDSAITR	4688	sp|Q9Y3P9|RBGP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7311.8	60.8667	2	1102.5356	1102.5255	K	D	599	609
PSM	GSEENLDEAR	4689	sp|P35611-2|ADDA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7310.7	60.83943	2	1118.4864	1118.4840	K	E	585	595
PSM	DAVTYTEHAK	4690	sp|P62805|H4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7276.4	59.968	3	1133.5405	1133.5353	R	R	69	79
PSM	DAVTYTEHAK	4691	sp|P62805|H4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7316.6	60.9917	3	1133.5405	1133.5353	R	R	69	79
PSM	TREEIQEVR	4692	sp|P08559-2|ODPA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7285.9	60.20882	2	1158.6020	1158.5993	R	S	310	319
PSM	LREIEENQK	4693	sp|Q14683|SMC1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7051.3	53.93699	3	1157.6059	1157.6040	K	R	425	434
PSM	RTDALTSSPGR	4694	sp|P49736|MCM2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7047.11	53.84165	2	1159.5956	1159.5945	R	D	34	45
PSM	EGTETFADHR	4695	sp|Q9Y490|TLN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7349.8	61.86347	2	1161.5090	1161.5051	R	E	2007	2017
PSM	VAVTEGCQPSR	4696	sp|O75369-2|FLNB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	7-UNIMOD:4	ms_run[1]:scan=1.1.7184.9	57.56138	2	1202.5712	1202.5714	K	V	1320	1331
PSM	ITTGAQDDLRK	4697	sp|Q9Y4W6|AFG32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7264.11	59.67367	2	1216.6414	1216.6412	R	V	642	653
PSM	VSRPENEQLR	4698	sp|Q8ND56-3|LS14A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7132.11	56.14639	2	1226.6394	1226.6367	K	N	203	213
PSM	FSSSSGYGGGSSR	4699	sp|P35527|K1C9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7309.11	60.82052	2	1234.5212	1234.5215	R	V	47	60
PSM	SSSSSAASDTATSTQRPLR	4700	sp|Q96T37-3|RBM15_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7349.10	61.8668	3	1908.9154	1908.9137	R	N	871	890
PSM	ARGDSEALDEES	4701	sp|Q7Z4V5-2|HDGR2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7331.7	61.38892	2	1277.5388	1277.5371	R	-	659	671
PSM	FIHDQTSPNPK	4702	sp|P53007|TXTP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7145.11	56.50042	2	1282.6324	1282.6306	K	Y	150	161
PSM	DKEQELSEEDK	4703	sp|Q13200|PSMD2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7107.11	55.46188	2	1348.6036	1348.5994	K	Q	40	51
PSM	KAQQELEEQTR	4704	sp|P26038|MOES_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7027.11	53.29342	2	1358.6808	1358.6790	K	R	360	371
PSM	EELEQASQAHGAR	4705	sp|Q14980-2|NUMA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7149.11	56.61005	3	1424.6668	1424.6644	K	L	483	496
PSM	ESEPQAAAEPAEAK	4706	sp|P80723|BASP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7281.11	60.10928	2	1426.6598	1426.6575	K	E	39	53
PSM	FSTYTSDKDENK	4707	sp|Q8WU90|ZC3HF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7268.6	59.7675	3	1433.6344	1433.6310	R	L	355	367
PSM	EVCSEQAETGPCR	4708	sp|P05067-11|A4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	3-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.7190.11	57.7279	2	1521.6196	1521.6188	R	A	284	297
PSM	DRDYSDHPSGGSYR	4709	sp|P38159-2|RBMX_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7263.11	59.64787	2	1610.6718	1610.6710	R	D	256	270
PSM	LTQTSGETTHTDKVPGGEDK	4710	sp|P46013|KI67_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7181.9	57.4798	4	2100.0021	2099.9971	K	S	1410	1430
PSM	SKFEDMAK	4711	sp|P26583|HMGB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7597.2	68.52592	3	954.4513	954.4480	K	S	58	66
PSM	IHNVGSPLK	4712	sp|P52701-3|MSH6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7468.4	65.06915	3	963.5512	963.5502	K	S	695	704
PSM	VKDDIESLHDK	4713	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7595.2	68.47163	4	1297.6577	1297.6514	R	F	612	623
PSM	ALIHSACVK	4714	sp|Q08257|QOR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	7-UNIMOD:4	ms_run[1]:scan=1.1.7463.3	64.93185	3	997.5415	997.5379	R	A	139	148
PSM	LKPLGEAER	4715	sp|Q9BYT8|NEUL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7461.3	64.87756	3	1011.5761	1011.5713	K	E	326	335
PSM	EGVHGGLINK	4716	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7432.2	64.0909	3	1022.5552	1022.5509	K	K	117	127
PSM	EGVHGGLINK	4717	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7451.4	64.60838	3	1022.5552	1022.5509	K	K	117	127
PSM	VLEDSDLKK	4718	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7368.4	62.36632	3	1045.5682	1045.5655	K	S	345	354
PSM	RVIEGSLSPK	4719	sp|Q8IX01-3|SUGP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7658.6	70.17313	3	1084.6261	1084.6240	K	E	596	606
PSM	LNARPGVGGVR	4720	sp|Q9BY77|PDIP3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7404.4	63.33633	3	1094.6326	1094.6309	R	S	21	32
PSM	VNHVTLSQPK	4721	sp|P61769|B2MG_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7434.3	64.14665	3	1121.6233	1121.6193	R	I	102	112
PSM	RLQELDAASK	4722	sp|P09497-2|CLCB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7619.7	69.1233	3	1129.6117	1129.6091	K	V	113	123
PSM	MLDHEYTTK	4723	sp|P11387|TOP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7486.2	65.55238	3	1136.5213	1136.5172	R	E	263	272
PSM	EHELLEQQK	4724	sp|Q13435|SF3B2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7421.4	63.79675	3	1152.5797	1152.5775	K	R	174	183
PSM	SHEGETSYIR	4725	sp|Q13242|SRSF9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7412.6	63.55612	3	1177.5403	1177.5363	R	V	172	182
PSM	VYGPGVAK	4726	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7375.4	62.55276	2	789.4408	789.4385	K	T	774	782
PSM	TENNDHINLK	4727	sp|P61956-2|SUMO2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7406.3	63.3888	3	1196.5807	1196.5785	K	V	12	22
PSM	DGDTLNQHGIK	4728	sp|Q9NRR5|UBQL4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7494.6	65.76814	3	1196.5798	1196.5786	K	D	63	74
PSM	KQAEILQESR	4729	sp|O75347|TBCA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7486.4	65.55572	3	1200.6493	1200.6462	K	M	52	62
PSM	SNIHCNTIAPNAGSR	4730	sp|P51659-2|DHB4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	5-UNIMOD:4	ms_run[1]:scan=1.1.7460.6	64.85547	4	1610.7665	1610.7583	K	M	210	225
PSM	TKTEISEMNR	4731	sp|P05787-2|K2C8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7371.4	62.44567	3	1207.5889	1207.5867	R	N	331	341
PSM	YCDPDSYHR	4732	sp|P26368-2|U2AF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	2-UNIMOD:4	ms_run[1]:scan=1.1.7459.4	64.82498	3	1211.4712	1211.4666	K	R	459	468
PSM	AVTKDEDEWK	4733	sp|Q9UKY7-2|CDV3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7626.6	69.31049	3	1219.5757	1219.5721	K	E	77	87
PSM	EHVGTDQFGNK	4734	sp|Q8N183|NDUF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7433.6	64.12466	3	1230.5662	1230.5629	K	Y	21	32
PSM	RLASTSDIEEK	4735	sp|O14974|MYPT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7444.6	64.42258	3	1247.6374	1247.6357	R	E	504	515
PSM	GPTVSNIR	4736	sp|Q9H7B2|RPF2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7470.9	65.13188	2	842.4616	842.4610	R	L	169	177
PSM	RCVCVSNTIR	4737	sp|O14497|ARI1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	2-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=1.1.7585.4	68.20437	3	1263.6175	1263.6176	K	S	1980	1990
PSM	TANEEEEIVHK	4738	sp|Q6GMV2|SMYD5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7615.8	69.01691	3	1297.6159	1297.6150	K	L	197	208
PSM	STGYDPVK	4739	sp|Q9UBT2|SAE2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7514.8	66.30068	2	865.4172	865.4182	K	L	246	254
PSM	YTGAGLSGR	4740	sp|Q05048|CSTF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7397.9	63.15547	2	880.4406	880.4403	R	Q	344	353
PSM	GDKEEVAYEER	4741	sp|Q9NRV9|HEBP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7422.9	63.83225	3	1323.5968	1323.5942	K	A	24	35
PSM	LCAGASEDIREK	4742	sp|Q9UM54-2|MYO6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	2-UNIMOD:4	ms_run[1]:scan=1.1.7581.6	68.09963	3	1347.6475	1347.6452	R	L	251	263
PSM	KDDALELQSHAK	4743	sp|Q02952|AKA12_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1000663, ProteinPilot, ]	20		ms_run[1]:scan=1.1.7544.8	67.10603	3	1353.6936706434901	1353.6888431390103	K	S	1316	1328
PSM	SLESINSR	4744	sp|P62888|RL30_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7664.5	70.33163	2	904.4622	904.4614	K	L	10	18
PSM	KNHEEEISTLR	4745	sp|P08727|K1C19_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1000663, ProteinPilot, ]	20		ms_run[1]:scan=1.1.7582.5	68.12497	3	1354.66987064349	1354.68409211174	K	G	216	227
PSM	VNTLIRPDGEKK	4746	sp|P62750|RL23A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7451.7	64.61338	3	1368.7744	1368.7725	K	A	124	136
PSM	PISTLDNR	4747	sp|P31689-2|DNJA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7661.6	70.2539	2	914.4844	914.4821	K	T	276	284
PSM	TGLEDPER	4748	sp|P35580-3|MYH10_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7538.6	66.9416	2	915.4322	915.4298	R	Y	5	13
PSM	AVELAANTK	4749	sp|P29401-2|TKT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7382.6	62.74527	2	915.5048	915.5025	K	G	465	474
PSM	AVELAANTK	4750	sp|P29401-2|TKT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7381.9	62.72327	2	915.5048	915.5025	K	G	465	474
PSM	AVELAANTK	4751	sp|P29401-2|TKT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7384.6	62.79917	2	915.5048	915.5025	K	G	465	474
PSM	VFNTGGAPR	4752	sp|P27708|PYR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7593.8	68.42735	2	917.4750	917.4719	R	I	169	178
PSM	GPSSVEDIK	4753	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7653.9	70.04314	2	930.4684	930.4658	K	A	240	249
PSM	VVSSSIVDK	4754	sp|P62333|PRS10_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7614.6	68.98676	2	932.5182	932.5179	K	Y	198	207
PSM	GSDSIAYDK	4755	sp|P35611-2|ADDA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7424.5	63.8798	2	954.4346	954.4294	R	G	132	141
PSM	ELAQQIQK	4756	sp|P60842-2|IF4A1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7452.9	64.64387	2	956.5308	956.5291	R	V	111	119
PSM	VTDALNATR	4757	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7566.8	67.69817	2	959.5040	959.5036	R	A	421	430
PSM	AFREEAIK	4758	sp|P13010|XRCC5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7592.2	68.39037	3	962.5225	962.5185	R	F	641	649
PSM	VNEYVDAR	4759	sp|Q96T88|UHRF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7613.9	68.96465	2	964.4662	964.4614	K	D	137	145
PSM	EPSEVPTPK	4760	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7518.9	66.40945	2	982.4992	982.4971	K	R	47	56
PSM	LLADQAEAR	4761	sp|P84098|RL19_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7630.8	69.42163	2	985.5210	985.5192	K	R	154	163
PSM	EVKPEETTCSEHCLQK	4762	sp|Q9Y5J7|TIM9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	9-UNIMOD:4,13-UNIMOD:4	ms_run[1]:scan=1.1.7383.8	62.77553	4	1973.8841	1973.8823	R	Y	40	56
PSM	AADIDQEVK	4763	sp|Q86VP6|CAND1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7531.6	66.7532	2	987.4884	987.4873	K	E	578	587
PSM	RSTVAQLVK	4764	sp|P25705-3|ATPA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7706.3	71.4382	3	1000.6057	1000.6029	K	R	231	240
PSM	ITSDEPLTK	4765	sp|Q9UBB4|ATX10_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7534.10	66.8406	2	1002.5234	1002.5233	K	D	254	263
PSM	EWSQHINGASHSR	4766	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7536.9	66.89283	3	1507.6972	1507.6916	K	R	305	318
PSM	SGTTPKPVINSTPGR	4767	sp|Q99459|CDC5L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7620.9	69.15362	3	1510.8091	1510.8104	R	T	427	442
PSM	NAGFTPQER	4768	sp|P27695|APEX1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7593.11	68.43235	2	1018.4846	1018.4832	K	Q	229	238
PSM	LSEPVPQTNAHESK	4769	sp|P19174-2|PLCG1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7520.10	66.46463	3	1535.7583	1535.7580	R	E	653	667
PSM	DCVGPEVEK	4770	sp|P00558|PGK1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	2-UNIMOD:4	ms_run[1]:scan=1.1.7477.8	65.31997	2	1031.4624	1031.4594	K	A	98	107
PSM	AEQESGLYR	4771	sp|Q9NU22|MDN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7597.11	68.54092	2	1051.4944	1051.4934	K	Y	3546	3555
PSM	DANGNSFATR	4772	sp|P62701|RS4X_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7359.9	62.13442	2	1051.4692	1051.4683	K	L	212	222
PSM	VVNDEEVVR	4773	sp|O75691|UTP20_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7691.8	71.04478	2	1057.5464	1057.5404	K	V	1812	1821
PSM	RLVEVDSSR	4774	sp|Q03252|LMNB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7382.10	62.75193	2	1059.5666	1059.5673	R	Q	240	249
PSM	QGVTQQQFK	4775	sp|Q14997|PSME4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7486.11	65.56738	2	1062.5538	1062.5458	R	G	1017	1026
PSM	NADVELQQR	4776	sp|O95782-2|AP2A1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7589.10	68.32235	2	1071.5340	1071.5309	R	A	571	580
PSM	QVQPEGPYR	4777	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7698.10	71.2357	2	1072.5292	1072.5302	R	V	2295	2304
PSM	EVDAEYEAR	4778	sp|Q8N6H7|ARFG2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7605.9	68.75195	2	1080.4764	1080.4723	R	S	440	449
PSM	ASGANYSFHK	4779	sp|Q9UJU6-2|DBNL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7549.11	67.24547	2	1080.5002	1080.4988	K	E	135	145
PSM	QQLTNTEVR	4780	sp|O60313-13|OPA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7386.9	62.85798	2	1087.5648	1087.5622	R	R	860	869
PSM	ETGTEHSPGVQPADVK	4781	sp|Q9H7C9|AAMDC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7415.9	63.64223	3	1650.7870	1650.7849	R	E	40	56
PSM	ALGSEVQDASK	4782	sp|Q9H2G2-2|SLK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7679.8	70.72659	2	1103.5454	1103.5459	K	V	664	675
PSM	SPPGQVTEAVK	4783	sp|P15121|ALDR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7642.11	69.74993	2	1111.5880	1111.5873	K	V	23	34
PSM	VENGQEPVIK	4784	sp|P55265-2|DSRAD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7559.10	67.51308	2	1111.5886	1111.5873	K	L	409	419
PSM	AEHDSILAEK	4785	sp|P26639-2|SYTC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7623.11	69.23788	2	1111.5646	1111.5509	K	A	66	76
PSM	MEGGTENDLR	4786	sp|Q9BXP5-2|SRRT_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7407.10	63.42752	2	1120.4824	1120.4819	K	I	257	267
PSM	VQPNEAVYTK	4787	sp|P11413-2|G6PD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7691.10	71.04812	2	1147.5876	1147.5873	R	M	440	450
PSM	QSTGSAPQGPAYHGVNR	4788	sp|O14497|ARI1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7553.10	67.35125	3	1725.8215	1725.8183	R	T	1512	1529
PSM	SHEGETAYIR	4789	sp|Q07955|SRSF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7485.4	65.52925	3	1161.5443	1161.5414	R	V	182	192
PSM	TDRGGDSIGETPTPGASK	4790	sp|O75533|SF3B1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7572.11	67.86473	3	1744.8244	1744.8228	R	R	316	334
PSM	GSSSANPVNSVR	4791	sp|Q99661|KIF2C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7411.11	63.53743	2	1173.5906	1173.5738	R	R	178	190
PSM	EDLPAENGETK	4792	sp|P05114|HMGN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7417.11	63.6997	2	1201.5482	1201.5462	K	T	72	83
PSM	MATNAAAQNAIK	4793	sp|Q9Y490|TLN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7672.11	70.55015	2	1202.6132	1202.6077	R	K	899	911
PSM	YLQDNPASGEK	4794	sp|Q16850-2|CP51A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7561.9	67.56532	2	1220.5674	1220.5673	R	F	327	338
PSM	DICACAATGTGK	4795	sp|Q96GQ7|DDX27_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	3-UNIMOD:4,5-UNIMOD:4	ms_run[1]:scan=1.1.7663.11	70.3154	2	1223.5288	1223.5275	K	T	257	269
PSM	QTPAPAASVTGSR	4796	sp|P46013|KI67_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7526.10	66.62535	2	1241.6366	1241.6364	K	R	2772	2785
PSM	HVTSEQEWDK	4797	sp|P37268-3|FDFT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7556.11	67.43382	2	1257.5646	1257.5626	K	Y	76	86
PSM	YNAQCQETIR	4798	sp|P21741|MK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	5-UNIMOD:4	ms_run[1]:scan=1.1.7620.6	69.14861	3	1281.5809	1281.5772	R	V	112	122
PSM	TEELKPQVEEK	4799	sp|Q9UN86-2|G3BP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7490.10	65.67	2	1328.6838	1328.6823	K	N	206	217
PSM	AAVVTSPPPTTAPHK	4800	sp|P35611-2|ADDA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7616.7	69.04232	3	1472.7985	1472.7987	R	E	7	22
PSM	KPVSSYLR	4801	sp|Q00059-2|TFAM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8036.2	80.01476	3	948.5428	948.5392	K	F	52	60
PSM	VHPVSTMIK	4802	sp|P00338-3|LDHA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7860.3	75.405	3	1010.5603	1010.5583	R	G	299	308
PSM	KLPEYNPR	4803	sp|Q9P258|RCC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7911.2	76.73508	3	1015.5460	1015.5450	K	T	513	521
PSM	VPVVHVDEK	4804	sp|Q8TEM1|PO210_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7814.3	74.21893	3	1020.5596	1020.5604	K	G	1329	1338
PSM	SPYLPSAHR	4805	sp|Q9NRH3|TBG2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7893.2	76.27493	3	1026.5251	1026.5247	K	V	364	373
PSM	SELTGKFEK	4806	sp|P08758|ANXA5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7958.3	77.97343	3	1037.5420	1037.5393	K	L	71	80
PSM	DYGNSPLHR	4807	sp|P26599-2|PTBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7740.2	72.3103	3	1057.4965	1057.4941	K	F	448	457
PSM	TTAAHGLELR	4808	sp|P08243-2|ASNS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8035.4	79.99147	3	1067.5738	1067.5723	R	V	387	397
PSM	SIQCLTVHK	4809	sp|O75083|WDR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	4-UNIMOD:4	ms_run[1]:scan=1.1.7976.2	78.45042	3	1084.5700	1084.5699	K	N	322	331
PSM	LLEVEHPAAK	4810	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8008.3	79.27385	3	1105.6129	1105.6131	K	V	64	74
PSM	LLEVEHPAAK	4811	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7959.6	78.00533	3	1105.6129	1105.6131	K	V	64	74
PSM	IQGIEEYKK	4812	sp|Q9Y6G9|DC1L1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8027.4	79.77693	3	1106.6008	1106.5971	K	G	87	96
PSM	KIAELCDDPK	4813	sp|P18206|VINC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	6-UNIMOD:4	ms_run[1]:scan=1.1.7778.4	73.28827	3	1187.5864	1187.5856	R	E	417	427
PSM	GRPYDYNGPR	4814	sp|P13667|PDIA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7997.3	78.99042	3	1193.5612	1193.5578	K	E	261	271
PSM	IGACPSAHKPLLGTEK	4815	sp|P07602-2|SAP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	4-UNIMOD:4	ms_run[1]:scan=1.1.8077.6	81.11968	4	1677.8933	1677.8872	K	C	481	497
PSM	AGPVAVQVK	4816	sp|Q13428-4|TCOF_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7805.6	73.98756	2	867.5182	867.5178	K	A	592	601
PSM	VLEAAVAAK	4817	sp|Q14232|EI2BA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7720.8	71.81992	2	870.5172	870.5174	R	K	137	146
PSM	SSELQAIK	4818	sp|Q9UKM9-2|RALY_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7991.3	78.83722	2	874.4742	874.4760	K	T	168	176
PSM	AEFAEVSK	4819	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7900.8	76.46322	2	879.4362	879.4338	K	L	250	258
PSM	AEFAEVSK	4820	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7880.8	75.94659	2	879.4362	879.4338	K	L	250	258
PSM	AVAEQVLHSQSR	4821	sp|Q01804|OTUD4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8025.6	79.7264	3	1323.6877	1323.6895	R	H	49	61
PSM	AAIAQLNGK	4822	sp|Q96PK6|RBM14_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7863.5	75.48695	2	884.5050	884.5079	K	E	127	136
PSM	LMELHGEGSSSGK	4823	sp|P61247|RS3A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7797.7	73.78055	3	1330.6213	1330.6187	K	A	228	241
PSM	GANRTETVTSFR	4824	sp|P78527|PRKDC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8063.7	80.75028	3	1337.6719	1337.6688	K	K	3861	3873
PSM	VLAAVQAAR	4825	sp|Q9NU22|MDN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7875.9	75.81505	2	897.5404	897.5396	R	N	5509	5518
PSM	NVPVITGSK	4826	sp|P35232|PHB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8080.8	81.20309	2	913.5248	913.5233	R	D	75	84
PSM	FRDQDLASCDR	4827	sp|Q9Y383|LC7L2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	9-UNIMOD:4	ms_run[1]:scan=1.1.8078.6	81.1464	3	1381.609571	1381.604462	R	D	340	351
PSM	PAAVVLQTK	4828	sp|Q14697|GANAB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8025.8	79.72974	2	925.5608	925.5597	K	G	900	909
PSM	ELEEEAEEEQR	4829	sp|Q9H2J4|PDCL3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1000663, ProteinPilot, ]	20		ms_run[1]:scan=1.1.8005.7	79.20243	3	1389.58267064349	1389.5895825902098	K	I	28	39
PSM	VPQDVLQK	4830	sp|P49903-2|SPS1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8063.8	80.75195	2	925.5244	925.5233	K	L	33	41
PSM	VPQDVLQK	4831	sp|P49903-2|SPS1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8082.8	81.25695	2	925.5246	925.5233	K	L	33	41
PSM	CASQSGMTAYGTR	4832	sp|Q99439|CNN2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	1-UNIMOD:4	ms_run[1]:scan=1.1.7822.10	74.44221	3	1388.5819	1388.5813	K	R	175	188
PSM	VSQVIMEK	4833	sp|O75475|PSIP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7882.5	75.99413	2	932.5004	932.5001	K	S	408	416
PSM	ANNLSSLSK	4834	sp|O75396|SC22B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7725.7	71.95139	2	932.4934	932.4927	K	K	170	179
PSM	GLVLDHGAR	4835	sp|P40227-2|TCPZ_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7743.6	72.3939	2	936.5146	936.5141	R	H	164	173
PSM	LGDQGPPEEAEDR	4836	sp|O00592-2|PODXL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7753.5	72.64906	3	1411.6147	1411.6215	K	F	413	426
PSM	AVVGVVAGGGR	4837	sp|P62917|RL8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7965.6	78.16673	2	940.5450	940.5454	R	I	164	175
PSM	EGSLVINSK	4838	sp|Q9Y5B9|SP16H_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7961.8	78.06263	2	945.5140	945.5131	R	N	358	367
PSM	LEGDAALNR	4839	sp|Q9Y2Z0-2|SGT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7711.9	71.58268	2	957.5020	957.4879	K	L	271	280
PSM	LEGDAALNR	4840	sp|Q9Y2Z0-2|SGT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7716.6	71.7103	2	957.5020	957.4879	K	L	271	280
PSM	ANGMELDGR	4841	sp|P62995-3|TRA2B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7937.8	77.42719	2	961.4316	961.4287	R	R	79	88
PSM	TSDQTWVK	4842	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8042.8	80.18642	2	963.4696	963.4662	R	L	2695	2703
PSM	CAMTALSSK	4843	sp|Q99832-3|TCPH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	1-UNIMOD:4	ms_run[1]:scan=1.1.7917.9	76.90276	2	967.4492	967.4467	K	L	114	123
PSM	IGDTSVSYK	4844	sp|P20700|LMNB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7867.8	75.59897	2	968.4822	968.4815	K	Y	475	484
PSM	ELAEAVAGGR	4845	sp|Q9UBT2|SAE2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8046.7	80.29255	2	971.5042	971.5036	R	V	10	20
PSM	ELAEAVAGGR	4846	sp|Q9UBT2|SAE2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8065.8	80.80503	2	971.5042	971.5036	R	V	10	20
PSM	HEQNIDCGGGYVK	4847	sp|P27797|CALR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	7-UNIMOD:4	ms_run[1]:scan=1.1.7803.7	73.93622	3	1475.6488	1475.6463	K	L	99	112
PSM	KYEEIDNAPEER	4848	sp|P49411|EFTU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7965.8	78.17007	3	1491.6853	1491.6841	K	A	91	103
PSM	DAEDAVYGR	4849	sp|Q07955|SRSF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8062.8	80.72493	2	994.4368	994.4356	R	D	66	75
PSM	YGMGTSVER	4850	sp|P08559-2|ODPA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8079.9	81.17812	2	998.4496	998.4491	R	A	234	243
PSM	DGYQQNFK	4851	sp|Q14444-2|CAPR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7957.8	77.9547	2	998.4458	998.4458	R	R	668	676
PSM	RLAEQVSSYNESK	4852	sp|Q8IXQ4-2|GPAM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7886.8	76.1029	3	1509.7429	1509.7423	K	R	110	123
PSM	TVAVITSDGR	4853	sp|O95777|LSM8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8020.9	79.59747	2	1017.5472	1017.5455	R	M	12	22
PSM	TVAVITSDGR	4854	sp|O95777|LSM8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8039.9	80.10723	2	1017.5472	1017.5455	R	M	12	22
PSM	TAVCDIPPR	4855	sp|Q9BVA1|TBB2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	4-UNIMOD:4	ms_run[1]:scan=1.1.8057.8	80.59052	2	1027.5126	1027.5121	K	G	351	360
PSM	YESLTDPSK	4856	sp|P07900-2|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8081.11	81.23493	2	1038.4890	1038.4869	R	L	183	192
PSM	VIVGGSSEYK	4857	sp|Q14683|SMC1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7873.8	75.75958	2	1037.5414	1037.5393	R	I	97	107
PSM	SFQQSSLSR	4858	sp|P43243|MATR3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7853.9	75.2347	2	1038.5124	1038.5094	K	D	4	13
PSM	SGGAVEPLGTR	4859	sp|O75312|ZPR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7867.9	75.60063	2	1042.5382	1042.5407	K	I	300	311
PSM	QQNFNTGIK	4860	sp|Q13813|SPTN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8083.8	81.28367	2	1048.5298	1048.5302	K	D	1660	1669
PSM	YGFGEAGKPK	4861	sp|Q13451|FKBP5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7831.9	74.67395	2	1052.5292	1052.5291	R	F	223	233
PSM	LQAEAQQLR	4862	sp|Q16543|CDC37_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7736.8	72.23587	2	1055.5692	1055.5723	R	K	84	93
PSM	YGQNGDFTR	4863	sp|O76094|SRP72_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7837.7	74.82674	2	1056.4626	1056.4625	R	A	21	30
PSM	DYGNSPLHR	4864	sp|P26599-2|PTBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7755.11	72.70667	2	1057.4962	1057.4941	K	F	448	457
PSM	TVEEVTVER	4865	sp|Q07157-2|ZO1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8056.10	80.56707	2	1060.5354	1060.5401	K	N	366	375
PSM	TTAAHGLELR	4866	sp|P08243-2|ASNS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8016.4	79.48344	3	1067.5738	1067.5723	R	V	387	397
PSM	AANGVVLATEK	4867	sp|P25787|PSA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8069.11	80.9156	2	1071.5934	1071.5924	K	K	40	51
PSM	QVQPEGPYR	4868	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7717.10	71.7432	2	1072.5292	1072.5302	R	V	2295	2304
PSM	DGGAWGTEQR	4869	sp|P09382|LEG1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8002.7	79.1252	2	1075.4676	1075.4683	K	E	65	75
PSM	CVSCLPGQR	4870	sp|Q9Y490|TLN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	1-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=1.1.7947.9	77.68912	2	1075.5106	1075.4903	R	D	1199	1208
PSM	FAQTLQQSR	4871	sp|P55072|TERA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1000663, ProteinPilot, ]	20		ms_run[1]:scan=1.1.7782.9	73.39982	2	1077.5566470956603	1077.5567067706502	M	G	758	767
PSM	DKDPPIPVAK	4872	sp|P13667|PDIA4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7915.3	76.83995	3	1078.6078	1078.6022	K	I	110	120
PSM	KYEPPVPTR	4873	sp|P62191|PRS4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7778.3	73.2866	3	1085.5903	1085.5869	K	V	24	33
PSM	RISAVSVAER	4874	sp|Q08211|DHX9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7738.6	72.27219	2	1086.6118	1086.6145	R	V	447	457
PSM	EKEDAQEVELQEGK	4875	sp|Q02952-2|AKA12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7947.10	77.69078	3	1630.7698	1630.7686	K	V	1639	1653
PSM	LCAGASEDIR	4876	sp|Q9UM54-2|MYO6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	2-UNIMOD:4	ms_run[1]:scan=1.1.7919.9	76.95648	2	1090.5074	1090.5077	R	E	251	261
PSM	TLESGMAETR	4877	sp|Q8WY07|CTR3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8046.9	80.29588	2	1093.5096	1093.5074	R	L	18	28
PSM	SQEQEVLER	4878	sp|Q9UKV3-5|ACINU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7953.9	77.84863	2	1116.5420	1116.5411	R	G	328	337
PSM	STTTGHLIYK	4879	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7747.2	72.48777	3	1119.5950	1119.5924	K	C	21	31
PSM	STTTGHLIYK	4880	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7767.11	73.01308	2	1119.5912	1119.5924	K	C	21	31
PSM	NLTQDEMQR	4881	sp|Q14152|EIF3A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7861.10	75.44257	2	1133.5140	1133.5135	K	M	309	318
PSM	GGPTPQEAIQR	4882	sp|Q9H444|CHM4B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8002.8	79.12687	2	1152.5892	1152.5887	K	L	18	29
PSM	IANPVEGSTDR	4883	sp|Q15366-2|PCBP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8016.10	79.49343	2	1157.5672	1157.5677	K	Q	324	335
PSM	AAAEEGHIIPR	4884	sp|O95551-3|TYDP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7917.5	76.8961	3	1162.6120	1162.6094	R	S	244	255
PSM	PALPAGTEDTAK	4885	sp|P06396-2|GELS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7875.11	75.81838	2	1169.5942	1169.5928	K	E	227	239
PSM	DSYESYGNSR	4886	sp|P38159-2|RBMX_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7783.6	73.42057	2	1176.4678	1176.4683	R	S	270	280
PSM	AWNNQVCCK	4887	sp|P51610-2|HCFC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	7-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.8057.11	80.59552	2	1178.4964	1178.4961	K	D	346	355
PSM	YSQSDLEQTK	4888	sp|Q14683|SMC1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7977.10	78.48969	2	1197.5522	1197.5513	K	T	714	724
PSM	SEETLDEGPPK	4889	sp|Q00688|FKBP3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7814.9	74.22894	2	1200.5514	1200.5510	K	Y	100	111
PSM	GGPGGPGGPGGPMGR	4890	sp|Q01844-3|EWS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7787.8	73.52631	2	1206.5602	1206.5564	R	M	471	486
PSM	HPQPGAVELAAK	4891	sp|P27708|PYR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7888.10	76.15788	2	1216.6584	1216.6564	R	H	2025	2037
PSM	AAEPQEQEFGK	4892	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7859.10	75.3908	2	1232.5654	1232.5673	R	S	944	955
PSM	VELAEEDDGEK	4893	sp|Q9H4A3-2|WNK1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7772.10	73.14191	2	1232.5436	1232.5408	R	I	487	498
PSM	IAPAEGPDVSER	4894	sp|Q9Y6M1-1|IF2B2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8048.11	80.35332	2	1239.6110	1239.6095	K	M	420	432
PSM	VNTLIRPDGEK	4895	sp|P62750|RL23A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8012.8	79.38811	2	1240.6774	1240.6775	K	K	124	135
PSM	SCYDLSCHAR	4896	sp|P41250|GARS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	2-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=1.1.7891.4	76.2253	3	1267.5094	1267.5074	R	A	465	475
PSM	YSSGGNFETPSK	4897	sp|Q16625-2|OCLN_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8054.9	80.51162	2	1272.5642	1272.5622	R	R	314	326
PSM	YNPSEEEYEK	4898	sp|O00443|P3C2A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7926.10	77.14436	2	1286.5372	1286.5302	K	A	1218	1228
PSM	NCTIVSPDAGGAK	4899	sp|P60891|PRPS1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	2-UNIMOD:4	ms_run[1]:scan=1.1.7912.11	76.77563	2	1288.6076	1288.6082	R	R	164	177
PSM	NCTIVSPDAGGAK	4900	sp|P60891|PRPS1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	2-UNIMOD:4	ms_run[1]:scan=1.1.7951.11	77.79823	2	1288.6076	1288.6082	R	R	164	177
PSM	AEFEDQDDEAR	4901	sp|Q14692|BMS1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7729.8	72.05627	2	1323.5218	1323.5215	R	V	864	875
PSM	TMQNTSDLDTAR	4902	sp|P14923|PLAK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7855.10	75.28796	2	1351.6076	1351.6038	R	C	192	204
PSM	EQADYCVSHMK	4903	sp|Q13813|SPTN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	6-UNIMOD:4	ms_run[1]:scan=1.1.7958.8	77.98177	3	1366.5664	1366.5646	R	P	2436	2447
PSM	ACIDSNEDGDLSK	4904	sp|P29144|TPP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	2-UNIMOD:4	ms_run[1]:scan=1.1.7973.9	78.38374	2	1422.5930	1422.5933	R	S	208	221
PSM	ADTTSTVTPVPGQEK	4905	sp|Q9H9B1|EHMT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7934.11	77.35429	2	1529.7600	1529.7573	K	G	645	660
PSM	AHQDIHTQLQDVK	4906	sp|O00461|GOLI4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8064.3	80.77015	4	1531.7785	1531.7743	K	Q	188	201
PSM	LAVDEEENADNNTK	4907	sp|P02786|TFR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7729.10	72.0596	2	1560.6910	1560.6903	K	A	40	54
PSM	GQGSVSASVTEGQQNEQ	4908	sp|P55735-2|SEC13_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7950.11	77.77158	2	1704.7542	1704.7551	K	-	292	309
PSM	RFPGYDSESK	4909	sp|P46777|RL5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8151.8	83.03342	2	1184.5498	1184.5462	K	E	179	189
PSM	DHPLPEVAHVK	4910	sp|P13073|COX41_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8323.3	87.49091	4	1240.6609	1240.6564	R	H	43	54
PSM	AIEALHGHELRPGR	4911	sp|Q96PK6|RBM14_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8385.2	89.14028	5	1554.8421	1554.8379	R	A	51	65
PSM	AEITFDDHK	4912	sp|O75369-2|FLNB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8414.3	89.89875	3	1074.4987	1074.4982	K	N	2212	2221
PSM	RTTLDSPLGK	4913	sp|P16455|MGMT_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8372.3	88.7938	3	1086.6040	1086.6033	K	L	9	19
PSM	LYDKIDPEK	4914	sp|O14561|ACPM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8333.3	87.757	3	1119.5818	1119.5812	K	L	89	98
PSM	IYHPNIDEK	4915	sp|P68036|UB2L3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8174.2	83.61785	3	1127.5636	1127.5611	K	G	74	83
PSM	QAGEVTFADAHRPK	4916	sp|Q13243-3|SRSF5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8282.3	86.39745	4	1525.7653	1525.7637	R	L	127	141
PSM	AGGPTTPLSPTR	4917	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8268.2	86.02229	3	1153.6120	1153.6091	R	L	15	27
PSM	THLASDDLYK	4918	sp|Q9H7B2|RPF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8417.4	89.97818	3	1161.5674	1161.5666	R	L	228	238
PSM	AIEALHGHELRPGR	4919	sp|Q96PK6|RBM14_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8372.5	88.79713	4	1554.8357	1554.8379	R	A	51	65
PSM	REDVNAWER	4920	sp|Q9UDR5|AASS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8432.4	90.37769	3	1173.5539	1173.5527	R	R	30	39
PSM	RFPGYDSESK	4921	sp|P46777|RL5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8173.5	83.59637	3	1184.5558	1184.5462	K	E	179	189
PSM	AQLGLGHSYSR	4922	sp|O00567|NOP56_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8402.5	89.59302	3	1187.6071	1187.6047	K	A	144	155
PSM	IKEENFVSPK	4923	sp|O00425|IF2B3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8359.5	88.44868	3	1189.6360	1189.6343	K	E	474	484
PSM	IKEENFVSPK	4924	sp|O00425|IF2B3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8340.4	87.94278	3	1189.6360	1189.6343	K	E	474	484
PSM	KPHIIIATPGR	4925	sp|Q9H0S4-2|DDX47_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8353.5	88.28837	3	1201.7317	1201.7295	K	L	142	153
PSM	GASQAGMLAPGTR	4926	sp|Q15417|CNN3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8369.3	88.71312	3	1215.6094	1215.6030	K	R	213	226
PSM	TKFETEQALR	4927	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8183.6	83.86175	3	1221.6400	1221.6353	R	L	167	177
PSM	VHSVAWSCDGR	4928	sp|Q96J01|THOC3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	8-UNIMOD:4	ms_run[1]:scan=1.1.8422.5	90.11121	3	1272.5725	1272.5670	K	R	58	69
PSM	SGASVVAIR	4929	sp|Q5SSJ5|HP1B3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8200.5	84.29375	2	858.4944	858.4923	K	K	176	185
PSM	KIDASQTEFEK	4930	sp|O94979-10|SC31A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8108.3	81.92813	3	1294.6447	1294.6405	K	N	461	472
PSM	TVGATALPR	4931	sp|P50990-2|TCPQ_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8131.6	82.51918	2	884.5074	884.5080	K	L	308	317
PSM	RLAPEYEAAATR	4932	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8368.7	88.69307	3	1346.6944	1346.6942	K	L	62	74
PSM	VREEEIEVDSR	4933	sp|Q14978-2|NOLC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8122.3	82.28838	3	1359.6658	1359.6630	R	V	638	649
PSM	IRVDVADQAQDK	4934	sp|P23588-2|IF4B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8349.5	88.18198	3	1356.7015	1356.6997	R	D	127	139
PSM	TPVYAEVK	4935	sp|Q9UKV8|AGO2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8190.4	84.0424	2	905.4850	905.4858	K	R	526	534
PSM	VQAVVAVAR	4936	sp|Q01082-2|SPTB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8116.7	82.1388	2	911.5560	911.5553	R	E	478	487
PSM	QLRPACAQALTR	4937	sp|Q8IXI1|MIRO2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	6-UNIMOD:4	ms_run[1]:scan=1.1.8473.6	91.48354	3	1383.7402	1383.7405	K	I	180	192
PSM	QAHLTNQYMQR	4938	sp|P11940-2|PABP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8141.7	82.77582	3	1388.6617	1388.6619	R	M	375	386
PSM	ISAVSVAER	4939	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8334.8	87.79202	2	930.5118	930.5134	R	V	448	457
PSM	FDGVQDPR	4940	sp|O00264-2|PGRC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8357.6	88.3968	2	932.4348	932.4352	R	I	81	89
PSM	LYEQLSGK	4941	sp|P30086|PEBP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8410.6	89.80061	2	936.4916	936.4916	K	-	180	188
PSM	TIDDLEDK	4942	sp|P06753-2|TPM3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8173.9	83.60303	2	947.4446	947.4447	K	L	216	224
PSM	SIDDLEEK	4943	sp|P09493-3|TPM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8433.7	90.4095	2	947.4446	947.4447	K	V	252	260
PSM	TIDDLEDK	4944	sp|P06753-2|TPM3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8193.7	84.11884	2	947.4446	947.4447	K	L	216	224
PSM	RFDDAVVQSDMK	4945	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	11-UNIMOD:35	ms_run[1]:scan=1.1.8376.8	88.90957	3	1425.6613	1425.6558	R	H	77	89
PSM	HNFTPLAR	4946	sp|P42765|THIM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8226.5	84.96273	2	954.5016	954.5035	K	I	271	279
PSM	AQADLALEK	4947	sp|Q14980-2|NUMA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8336.8	87.84563	2	957.5108	957.5131	R	A	1016	1025
PSM	CAADLGLNK	4948	sp|P49773|HINT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	1-UNIMOD:4	ms_run[1]:scan=1.1.8313.8	87.23288	2	960.4692	960.4698	K	G	84	93
PSM	LAHLGVQVK	4949	sp|P04843|RPN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8403.2	89.61373	3	963.5893	963.5865	R	G	81	90
PSM	AEDAVEAIR	4950	sp|Q9BWF3|RBM4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8424.7	90.16814	2	972.4860	972.4876	R	G	121	130
PSM	LQEIHPECGPCK	4951	sp|Q12789-3|TF3C1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	8-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=1.1.8143.7	82.82678	3	1466.6617	1466.6646	R	T	310	322
PSM	IDVGEAEPR	4952	sp|P54577|SYYC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8354.6	88.31673	2	984.4874	984.4876	K	T	392	401
PSM	VPDVQDGVR	4953	sp|Q15149|PLEC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8146.6	82.90182	2	983.5022	983.5036	R	A	402	411
PSM	AVLLTQDTK	4954	sp|Q9BV44|THUM3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8306.10	87.05065	2	987.5564	987.5601	R	C	441	450
PSM	SPSLLQSGAK	4955	sp|Q9BQG0-2|MBB1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8292.6	86.67018	2	986.5424	986.5396	R	K	1308	1318
PSM	LEALDANSR	4956	sp|P09496-2|CLCA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8099.8	81.706	2	987.5004	987.4985	R	K	121	130
PSM	CNSLEEIK	4957	sp|Q13813|SPTN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	1-UNIMOD:4	ms_run[1]:scan=1.1.8413.7	89.87955	2	991.4642	991.4644	R	A	2120	2128
PSM	CNSLEEIK	4958	sp|Q13813|SPTN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	1-UNIMOD:4	ms_run[1]:scan=1.1.8432.8	90.38435	2	991.4642	991.4644	R	A	2120	2128
PSM	FSATEVTNK	4959	sp|Q8N163|CCAR2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8130.7	82.49533	2	995.4918	995.4924	R	T	847	856
PSM	LVQTAELTK	4960	sp|P60983|GMFB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8273.7	86.16373	2	1001.5754	1001.5757	K	V	111	120
PSM	TLAEINANR	4961	sp|Q13409-2|DC1I2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8163.10	83.34562	2	1000.5302	1000.5301	R	A	611	620
PSM	VLNTNIDGR	4962	sp|P62269|RS18_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8350.5	88.20844	2	1000.5306	1000.5302	R	R	15	24
PSM	LITEDVQGK	4963	sp|P61247|RS3A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8098.8	81.6803	2	1001.5418	1001.5393	K	N	86	95
PSM	LITEDVQGK	4964	sp|P61247|RS3A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8101.7	81.7557	2	1001.5418	1001.5393	K	N	86	95
PSM	NFQLNQDK	4965	sp|Q9Y244|POMP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8391.8	89.31052	2	1005.4876	1005.4879	K	M	54	62
PSM	ALDLDSSCK	4966	sp|P31948|STIP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	8-UNIMOD:4	ms_run[1]:scan=1.1.8311.5	87.1749	2	1007.4586	1007.4594	K	E	454	463
PSM	DAHLLVESK	4967	sp|P42704|LPPRC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8191.7	84.07122	2	1010.5404	1010.5396	K	N	641	650
PSM	QGANINEIR	4968	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8110.8	81.9875	2	1013.5256	1013.5254	R	Q	298	307
PSM	QGANINEIR	4969	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8120.7	82.24078	2	1013.5256	1013.5254	R	Q	298	307
PSM	QGANINEIR	4970	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8130.8	82.497	2	1013.5256	1013.5254	R	Q	298	307
PSM	ITQSNAILR	4971	sp|P28161|GSTM2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8386.9	89.17873	2	1014.5812	1014.5822	K	Y	70	79
PSM	VVLVESSER	4972	sp|P50336|PPOX_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8172.10	83.57845	2	1016.5356	1016.5502	K	L	30	39
PSM	AQLNETLTK	4973	sp|Q86UP2-4|KTN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8152.6	83.0558	2	1016.5496	1016.5502	K	L	1232	1241
PSM	MLLQSSEGR	4974	sp|O75643|U520_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8464.8	91.24419	2	1019.5074	1019.5070	R	C	1367	1376
PSM	MNALNEVNK	4975	sp|Q93008-1|USP9X_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8315.11	87.29083	2	1031.5062	1031.5069	K	V	352	361
PSM	NDNDTFTVK	4976	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8290.7	86.61815	2	1052.4776	1052.4775	R	Y	829	838
PSM	VVLIGGKPDR	4977	sp|P61978-2|HNRPK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8139.4	82.72478	2	1052.6350	1052.6342	R	V	192	202
PSM	QPDSGISSIR	4978	sp|P04843|RPN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8409.10	89.78155	2	1058.5334	1058.5356	R	S	269	279
PSM	HYGGLTGLNK	4979	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8292.2	86.66351	3	1058.5528	1058.5509	R	A	91	101
PSM	IAELCDDPK	4980	sp|P18206|VINC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	5-UNIMOD:4	ms_run[1]:scan=1.1.8160.9	83.26646	2	1059.492647	1059.490661	K	E	418	427
PSM	ASLQETHFDSTQTK	4981	sp|O94888|UBXN7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8395.9	89.41787	3	1591.7476	1591.7478	R	Q	296	310
PSM	NADYVQEVK	4982	sp|Q9HCJ6|VAT1L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8266.10	85.98322	2	1064.5138	1064.5138	R	R	232	241
PSM	DGGFCEVCK	4983	sp|P07602-2|SAP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	5-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.8465.7	91.26942	2	1070.4156	1070.4161	K	K	407	416
PSM	NLQEGNLER	4984	sp|Q13445|TMED1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8108.8	81.93647	2	1071.5308	1071.5309	R	V	184	193
PSM	IMATPEQVGK	4985	sp|P12956-2|XRCC6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8297.7	86.80431	2	1072.5580	1072.5587	K	M	411	421
PSM	AQYEDIANR	4986	sp|P05787-2|K2C8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8260.8	85.82526	2	1078.5038	1078.5043	K	S	293	302
PSM	TIETSPSLSR	4987	sp|Q9NVI1|FANCI_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8307.10	87.07743	2	1089.5642	1089.5666	K	M	403	413
PSM	QGIETPEDQNDLRK	4988	sp|Q15637-3|SF01_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8463.9	91.21892	3	1641.7951	1641.7958	K	M	228	242
PSM	LQEALEDER	4989	sp|Q9UH65|SWP70_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8217.6	84.7304	2	1101.5348	1101.5302	K	Q	429	438
PSM	TCSNVNWAR	4990	sp|O95218-2|ZRAB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	2-UNIMOD:4	ms_run[1]:scan=1.1.8366.8	88.64105	2	1106.4908	1106.4927	K	R	73	82
PSM	INQLYEQAK	4991	sp|Q96AC1-2|FERM2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8287.9	86.54111	2	1105.5740	1105.5767	R	W	291	300
PSM	DANNGNLQLR	4992	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8309.10	87.1305	2	1113.5510	1113.5527	K	N	288	298
PSM	DAMQYASESK	4993	sp|Q00610-2|CLH1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8089.10	81.44752	2	1128.4756	1128.4757	K	D	1536	1546
PSM	DLDTGEEVTR	4994	sp|Q14166|TTL12_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8206.10	84.4549	2	1133.5212	1133.5201	R	D	231	241
PSM	ESVVDYCNR	4995	sp|Q99442|SEC62_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	7-UNIMOD:4	ms_run[1]:scan=1.1.8453.11	90.95322	2	1140.4784	1140.4870	R	L	76	85
PSM	VEHSDLSFSK	4996	sp|P61769|B2MG_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8310.8	87.15356	2	1147.5530	1147.5509	K	D	69	79
PSM	AEPPKAPEQEQAAPGPAAGGEAPK	4997	sp|P80723|BASP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8169.8	83.49692	4	2297.1249	2297.1287	K	A	98	122
PSM	VLDEYEEEK	4998	sp|Q8WXH0-2|SYNE2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8449.9	90.84257	2	1152.5200	1152.5186	K	R	1476	1485
PSM	NTTGVTEEALK	4999	sp|Q13813|SPTN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8189.10	84.02355	2	1161.5862	1161.5877	R	E	2316	2327
PSM	DRFVNDYDK	5000	sp|Q14257-2|RCN2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8215.9	84.68616	2	1170.5298	1170.5305	K	D	251	260
PSM	WNQDTMEQK	5001	sp|Q15637-3|SF01_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8182.10	83.84264	2	1178.5012	1178.5026	R	T	22	31
PSM	TYYYNTETK	5002	sp|O75400-2|PR40A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8242.11	85.3719	2	1181.5248	1181.5240	R	Q	129	138
PSM	ADTPSLGEGPEK	5003	sp|Q15833-2|STXB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8292.10	86.67685	2	1199.5498	1199.5670	K	T	211	223
PSM	ASDPGLPAEEPK	5004	sp|P27708|PYR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8430.10	90.33387	2	1209.5868	1209.5877	R	E	1858	1870
PSM	VEIIANDQGNR	5005	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8219.7	84.78474	3	1227.6214	1227.6207	R	I	50	61
PSM	STEFNEHELK	5006	sp|P62760|VISL1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8302.11	86.94475	2	1232.5702	1232.5673	K	Q	19	29
PSM	EVMLQNGETPK	5007	sp|Q14839-2|CHD4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8417.10	89.98818	2	1244.6040	1244.6071	K	D	1699	1710
PSM	QLVNGEVSDER	5008	sp|Q96T23-2|RSF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8098.11	81.6853	2	1244.6028	1244.5997	K	V	409	420
PSM	YTSLQEEAQGK	5009	sp|Q9Y496|KIF3A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8311.10	87.18324	2	1252.5908	1252.5935	K	T	532	543
PSM	ASRDEIFAQSK	5010	sp|P35580-3|MYH10_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8091.7	81.49615	3	1250.6299	1250.6255	R	E	1687	1698
PSM	NVQQQLDATSR	5011	sp|Q9BVW5|TIPIN_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8247.6	85.49893	2	1258.6270	1258.6266	K	N	285	296
PSM	SPPPGMGLNQNR	5012	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8468.11	91.35702	2	1266.6098	1266.6139	R	G	33	45
PSM	EENAEQQALAAK	5013	sp|Q9UQE7|SMC3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8350.11	88.21843	2	1300.6246	1300.6259	R	R	475	487
PSM	GYDDRDYYSR	5014	sp|P62995-3|TRA2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8454.10	90.97826	2	1308.5328	1308.5371	R	S	129	139
PSM	IHGTEEGQQILK	5015	sp|Q14980-2|NUMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8297.8	86.80598	2	1351.7074	1351.7096	R	Q	43	55
PSM	EATNPPVIQEEK	5016	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8241.5	85.34658	2	1353.6768	1353.6776	R	P	483	495
PSM	VREEEIEVDSR	5017	sp|Q14978-2|NOLC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8102.5	81.778	3	1359.6658	1359.6630	R	V	638	649
PSM	SPVESTTEPPAVR	5018	sp|P53992|SC24C_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8297.9	86.80765	2	1368.6866	1368.6885	K	A	957	970
PSM	AAQNSGEAEYIEK	5019	sp|P07942|LAMB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8093.10	81.554	2	1408.6490	1408.6470	K	V	1662	1675
PSM	GGCPGGEATLSQPPPR	5020	sp|P20290|BTF3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	3-UNIMOD:4	ms_run[1]:scan=1.1.8460.11	91.14145	2	1579.7374	1579.7413	R	G	20	36
PSM	QEAESQPCTSTLPR	5021	sp|Q6ZN17|LN28B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	8-UNIMOD:4	ms_run[1]:scan=1.1.8280.11	86.35745	2	1602.7244	1602.7308	R	E	180	194
PSM	PSDAASEAARPATSTLNR	5022	sp|Q04637-3|IF4G1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8332.10	87.74218	3	1813.8895	1813.8918	K	F	1065	1083
PSM	ASAPSPNAQVACDHCLK	5023	sp|Q14258|TRI25_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	12-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=1.1.8422.8	90.11622	3	1824.8188	1824.8247	R	E	96	113
PSM	FHHTFSTEIAK	5024	sp|P13667|PDIA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8527.2	92.89827	4	1316.6573	1316.6513	K	F	336	347
PSM	MKPILLQGHER	5025	sp|Q13347|EIF3I_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8708.2	97.72075	4	1320.7385	1320.7336	-	S	1	12
PSM	VLKDEIDVK	5026	sp|Q9Y4W6|AFG32_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8557.2	93.70329	3	1057.6042	1057.6019	K	F	298	307
PSM	HRELFLSR	5027	sp|O94776|MTA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8624.5	95.46563	3	1056.5818	1056.5828	R	Q	85	93
PSM	LEAHSDWVR	5028	sp|P55735-2|SEC13_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8769.2	99.3637	3	1111.5406	1111.5410	K	D	194	203
PSM	SIRPGLSPYR	5029	sp|Q14697|GANAB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8807.6	100.3932	3	1144.6366	1144.6353	R	A	52	62
PSM	IVGPSGAAVPCK	5030	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	11-UNIMOD:4	ms_run[1]:scan=1.1.8561.3	93.81253	3	1154.6143	1154.6118	K	V	1008	1020
PSM	VETFSGVYKK	5031	sp|P62081|RS7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8727.2	98.22993	3	1156.6144	1156.6128	K	L	170	180
PSM	AILQNHTDFK	5032	sp|Q86X55-1|CARM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8763.4	99.20535	3	1185.6136	1185.6142	R	D	175	185
PSM	WKPGSLASHVK	5033	sp|P06493|CDK1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8635.2	95.7562	3	1208.6674	1208.6666	K	N	244	255
PSM	EFFNGKEPSR	5034	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8691.4	97.2654	3	1209.5803	1209.5778	K	G	377	387
PSM	DFEEYPEHR	5035	sp|O14980|XPO1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8753.3	98.9333	3	1220.5117	1220.5098	K	T	837	846
PSM	HIDLVEGDEGR	5036	sp|P19367-3|HXK1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8740.7	98.58868	3	1238.5909	1238.5891	R	M	248	259
PSM	STVAQLVK	5037	sp|P25705-3|ATPA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8653.5	96.24515	2	844.5010	844.5018	R	R	232	240
PSM	STVAQLVK	5038	sp|P25705-3|ATPA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8634.6	95.73598	2	844.5010	844.5018	R	R	232	240
PSM	SFAATISR	5039	sp|Q5T4S7-2|UBR4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8802.5	100.2567	2	851.4454	851.4501	K	T	2131	2139
PSM	ATFDAISK	5040	sp|P15880|RS2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8712.4	97.83062	2	851.4390	851.4389	K	T	239	247
PSM	ATFDAISK	5041	sp|P15880|RS2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8712.5	97.83228	2	851.4390	851.4389	K	T	239	247
PSM	CLADAVVK	5042	sp|Q5TGZ0-2|MIC10_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	1-UNIMOD:4	ms_run[1]:scan=1.1.8803.4	100.282	2	874.4556	874.4582	R	I	13	21
PSM	LRQENIELGEK	5043	sp|Q9NUQ3-2|TXLNG_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8653.7	96.24848	3	1327.7083	1327.7095	K	L	133	144
PSM	VVTDTDETELAR	5044	sp|P05198|IF2A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8823.3	100.8199	3	1347.6547	1347.6518	K	Q	277	289
PSM	AAVAWEAGK	5045	sp|P11766|ADHX_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8662.7	96.4891	2	901.4660	901.4657	K	P	10	19
PSM	RTQEVLQAVAEK	5046	sp|Q02952-2|AKA12_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8825.7	100.8803	3	1370.7532	1370.7518	R	V	940	952
PSM	GHNQPCLLVGSGR	5047	sp|P27708|PYR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	6-UNIMOD:4	ms_run[1]:scan=1.1.8827.8	100.9355	3	1393.6894	1393.6885	R	C	275	288
PSM	EREQQDLEFAK	5048	sp|O43242|PSMD3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8693.6	97.32269	3	1391.6419	1391.6681	R	E	513	524
PSM	TLVPGPPGSSRPVK	5049	sp|Q14318-2|FKBP8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8712.7	97.83562	3	1390.7941	1390.7933	K	G	106	120
PSM	LALNCVGGK	5050	sp|Q9BV79-2|MECR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	5-UNIMOD:4	ms_run[1]:scan=1.1.8818.6	100.6903	2	930.4944	930.4957	R	S	183	192
PSM	TVSVSEAIK	5051	sp|P15924|DESP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8693.7	97.32435	2	932.5136	932.5179	K	K	2104	2113
PSM	GAVVEVIQK	5052	sp|A1X283|SPD2B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8685.7	97.10845	2	941.5544	941.5546	R	N	245	254
PSM	SDLTVDAVK	5053	sp|Q5JTH9|RRP12_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8758.5	99.07183	2	946.4950	946.4971	R	L	49	58
PSM	FDDDVVSR	5054	sp|Q93009-3|UBP7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8687.6	97.16082	2	951.4310	951.4298	K	C	464	472
PSM	HVEDLLTK	5055	sp|P12270|TPR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8658.9	96.38607	2	953.5198	953.5182	K	L	253	261
PSM	QLAVAEGKPPEAPK	5056	sp|P56192|SYMC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8618.6	95.30603	3	1433.7856	1433.7878	K	G	882	896
PSM	LRVELAEK	5057	sp|P35580-3|MYH10_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8537.2	93.16463	3	956.5690	956.5654	R	A	1295	1303
PSM	LGYTPVCR	5058	sp|Q15102|PA1B3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	7-UNIMOD:4	ms_run[1]:scan=1.1.8753.8	98.94164	2	964.4808	964.4800	R	A	199	207
PSM	LGYTPVCR	5059	sp|Q15102|PA1B3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	7-UNIMOD:4	ms_run[1]:scan=1.1.8734.6	98.42513	2	964.4808	964.4800	R	A	199	207
PSM	IIEVGDTPK	5060	sp|P61619|S61A1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8645.6	96.03194	2	970.5338	970.5335	K	D	99	108
PSM	RVTLELGGK	5061	sp|P05091-2|ALDH2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8788.2	99.87528	3	971.5795	971.5764	K	S	234	243
PSM	QDAQILYK	5062	sp|P12429|ANXA3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8699.7	97.48611	2	977.5154	977.5182	K	A	177	185
PSM	SGTSEFLNK	5063	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8555.9	93.66088	2	981.4760	981.4767	K	M	169	178
PSM	LQELEGAVK	5064	sp|P35580-3|MYH10_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8775.9	99.53713	2	985.5428	985.5444	K	S	1822	1831
PSM	INAAEIESR	5065	sp|Q06124-2|PTN11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8689.7	97.2165	2	1001.5150	1001.5141	R	V	221	230
PSM	ILNDDTALK	5066	sp|P54727|RD23B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8787.6	99.85498	2	1001.5370	1001.5393	K	E	52	61
PSM	YGINTDPPK	5067	sp|Q9Y3B4|SF3B6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8504.5	92.29705	2	1003.5010	1003.4975	K	-	117	126
PSM	VVDTLYNGK	5068	sp|Q07157-2|ZO1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8505.7	92.327	2	1007.5284	1007.5288	R	L	545	554
PSM	IVADQLCAK	5069	sp|P53990-2|IST1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	7-UNIMOD:4	ms_run[1]:scan=1.1.8476.10	91.57055	2	1016.5304	1016.5325	K	Y	119	128
PSM	IVADQLCAK	5070	sp|P53990-2|IST1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	7-UNIMOD:4	ms_run[1]:scan=1.1.8484.6	91.7756	2	1016.5304	1016.5325	K	Y	119	128
PSM	IVADQLCAK	5071	sp|P53990-2|IST1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	7-UNIMOD:4	ms_run[1]:scan=1.1.8482.9	91.72916	2	1016.5304	1016.5325	K	Y	119	128
PSM	GVLLTDGSEK	5072	sp|P51532-2|SMCA4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8611.9	95.1231	2	1017.5326	1017.5342	K	D	1015	1025
PSM	TLDGELDEK	5073	sp|P07942|LAMB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8532.9	93.04277	2	1018.4862	1018.4819	K	Y	1689	1698
PSM	SETDTSLIR	5074	sp|P40227-2|TCPZ_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8503.7	92.27383	2	1020.5172	1020.5087	K	G	155	164
PSM	ADLAEEYSK	5075	sp|P68036|UB2L3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8557.7	93.71162	2	1024.4722	1024.4713	R	D	123	132
PSM	MAGDPVANVR	5076	sp|P30153|2AAA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8505.8	92.32867	2	1028.5088	1028.5073	R	F	528	538
PSM	GQLQELSTR	5077	sp|Q9UPN3|MACF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8648.7	96.11438	2	1030.5394	1030.5407	K	W	6741	6750
PSM	AVLAESYER	5078	sp|P21399|ACOC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8773.5	99.47645	2	1036.5150	1036.5189	K	I	794	803
PSM	LFDDDETGK	5079	sp|P41208|CETN2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8493.9	92.01514	2	1038.4540	1038.4506	R	I	112	121
PSM	ACGQIFCGK	5080	sp|O14964|HGS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	2-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=1.1.8485.9	91.80647	2	1039.4574	1039.4579	R	C	184	193
PSM	TADGIVSHLK	5081	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8795.3	100.0648	3	1039.5688	1039.5662	R	K	120	130
PSM	TADGIVSHLK	5082	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8776.3	99.55408	3	1039.5688	1039.5662	R	K	120	130
PSM	SNTPILVDGK	5083	sp|P06744-2|G6PI_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8810.9	100.4793	2	1042.5642	1042.5659	R	D	146	156
PSM	SQPELIEAHTCER	5084	sp|Q9BTW9-4|TBCD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	11-UNIMOD:4	ms_run[1]:scan=1.1.8781.9	99.69867	3	1568.7220	1568.7253	R	I	889	902
PSM	CNSLSTLEK	5085	sp|P13473-2|LAMP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	1-UNIMOD:4	ms_run[1]:scan=1.1.8510.9	92.46294	2	1050.5020	1050.5015	R	N	153	162
PSM	DCGSVDGVIK	5086	sp|P61916|NPC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	2-UNIMOD:4	ms_run[1]:scan=1.1.8713.9	97.86543	2	1048.4832	1048.4859	K	E	26	36
PSM	LWAEDSTEK	5087	sp|O14974|MYPT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8607.10	95.01767	2	1077.4972	1077.4978	R	E	613	622
PSM	VSALNSVHCEHVEDEGESR	5088	sp|Q13085-2|ACACA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	9-UNIMOD:4	ms_run[1]:scan=1.1.8721.7	98.07639	4	2152.9441	2152.9444	R	Y	1703	1722
PSM	GHAVGDIPGVR	5089	sp|P62266|RS23_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8665.10	96.57471	2	1076.5710	1076.5727	K	F	109	120
PSM	IEYVDETGR	5090	sp|O43290|SNUT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8721.8	98.07805	2	1080.5060	1080.5087	K	K	710	719
PSM	YGTFVNEEK	5091	sp|O60934|NBN_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8730.7	98.319	2	1085.5036	1085.5029	K	M	74	83
PSM	LQQAQEMLK	5092	sp|P40222|TXLNA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.8805.10	100.3458	2	1087.579047	1087.569580	K	E	341	350
PSM	LKGDDLQAIK	5093	sp|P07910-2|HNRPC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8492.2	91.97728	3	1099.6279	1099.6237	K	Q	175	185
PSM	TTEILVANDK	5094	sp|Q96RG2-2|PASK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8676.10	96.8704	2	1102.5880	1102.5870	K	A	141	151
PSM	STPVIVSATTK	5095	sp|Q02952-2|AKA12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8528.9	92.93629	2	1102.6220	1102.6234	K	K	1385	1396
PSM	NCLNPQFSK	5096	sp|O75131|CPNE3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	2-UNIMOD:4	ms_run[1]:scan=1.1.8714.9	97.89212	2	1106.5172	1106.5179	K	T	53	62
PSM	GLDNTEFQGK	5097	sp|Q9BWF3|RBM4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8705.9	97.6517	2	1107.5182	1107.5197	R	R	130	140
PSM	ETVNSPAIYK	5098	sp|Q9Y3A2|UTP11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8706.11	97.68217	2	1120.5728	1120.5764	K	F	237	247
PSM	TPCEEVYVK	5099	sp|Q14315-2|FLNC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	3-UNIMOD:4	ms_run[1]:scan=1.1.8557.10	93.71661	2	1123.5194	1123.5220	K	H	2644	2653
PSM	IPGSPPESMGR	5100	sp|P50395|GDIB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8522.7	92.77472	2	1126.5446	1126.5441	K	G	58	69
PSM	EGSVTSVNLTK	5101	sp|Q03154-4|ACY1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8666.9	96.59985	2	1133.5926	1133.5928	K	L	210	221
PSM	FIAEEAAASGAK	5102	sp|O14732-2|IMPA2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8685.11	97.11512	2	1163.5826	1163.5822	R	C	51	63
PSM	CYEMASHLR	5103	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	1-UNIMOD:4	ms_run[1]:scan=1.1.8604.3	94.9262	3	1165.5025	1165.5008	K	R	128	137
PSM	WQDIQNDPR	5104	sp|Q14839-2|CHD4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8828.9	100.9641	2	1170.5386	1170.5418	R	Y	1777	1786
PSM	VDNDENEHQLSLR	5105	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8572.3	94.10387	4	1567.7257	1567.7226	K	T	33	46
PSM	ELGVSTNANYK	5106	sp|Q8WVY7|UBCP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8654.8	96.27707	2	1194.5868	1194.5880	K	I	196	207
PSM	YSTNEGETWK	5107	sp|Q92673|SORL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8654.9	96.27873	2	1213.5228	1213.5251	K	T	563	573
PSM	VDVDEYDENK	5108	sp|O15511-2|ARPC5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8517.11	92.65055	2	1224.5148	1224.5146	K	F	14	24
PSM	ITQCSVEIQR	5109	sp|O15400-2|STX7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	4-UNIMOD:4	ms_run[1]:scan=1.1.8551.11	93.55634	2	1232.6178	1232.6183	K	T	25	35
PSM	YDEMVESMKK	5110	sp|P62258|1433E_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8600.5	94.8251	3	1258.5598	1258.5573	R	V	20	30
PSM	VYIASSSGSTAIK	5111	sp|O75368|SH3L1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8703.10	97.59935	2	1282.6750	1282.6769	R	K	5	18
PSM	VTVLDTNDNAPK	5112	sp|Q08174-2|PCDH1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8669.9	96.68044	2	1285.6428	1285.6514	R	F	268	280
PSM	GTNIQENEYVK	5113	sp|Q9BRX2|PELO_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8669.10	96.6821	2	1293.6174	1293.6201	K	M	85	96
PSM	GSQFGQSCCLR	5114	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	8-UNIMOD:4,9-UNIMOD:4	ms_run[1]:scan=1.1.8716.3	97.93532	3	1298.5501	1298.5496	K	A	329	340
PSM	EAEQMGNELER	5115	sp|Q14980-2|NUMA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8645.11	96.04027	2	1304.5666	1304.5666	R	L	973	984
PSM	NSNPALNDNLEK	5116	sp|O00299|CLIC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8499.9	92.17187	2	1327.6346	1327.6368	K	G	120	132
PSM	ELEQANDDLER	5117	sp|Q9NXR1-1|NDE1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8485.11	91.8098	2	1330.6012	1330.6001	R	A	116	127
PSM	IYIDSNNNPER	5118	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8588.10	94.52537	2	1333.6234	1333.6262	K	F	882	893
PSM	GQNPNATFGEVSK	5119	sp|O94842-2|TOX4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8707.11	97.70903	2	1347.6390	1347.6419	K	I	220	233
PSM	ADEASELACPTPK	5120	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	9-UNIMOD:4	ms_run[1]:scan=1.1.8815.11	100.6176	2	1387.6268	1387.6289	K	E	2194	2207
PSM	FNQCGTCNEFK	5121	sp|Q9UBR2|CATZ_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	4-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=1.1.8668.11	96.65672	2	1403.5554	1403.5598	K	E	167	178
PSM	DISTNYYASQKK	5122	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8507.10	92.38512	2	1416.6844	1416.6885	K	T	672	684
PSM	NEEENENSISQYK	5123	sp|P82673|RT35_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8627.10	95.55438	2	1582.6728	1582.6747	K	E	301	314
PSM	GTVRPANDFNPDADAK	5124	sp|P08133-2|ANXA6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8590.11	94.57832	2	1686.7900	1686.7962	K	A	323	339
PSM	RESVELALK	5125	sp|O43719|HTSF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9066.3	107.2285	3	1043.5990	1043.5975	K	L	191	200
PSM	LLSESAQPLK	5126	sp|Q9H3N1|TMX1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9144.2	109.2533	3	1084.6219	1084.6128	K	K	224	234
PSM	DHNIPGELER	5127	sp|P35580-3|MYH10_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8866.4	101.9523	3	1178.5702	1178.5680	K	Q	207	217
PSM	GCHLLVATPGR	5128	sp|O00571|DDX3X_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	2-UNIMOD:4	ms_run[1]:scan=1.1.8977.3	104.86	3	1179.6193	1179.6183	R	L	316	327
PSM	FREDHPDLIQNAK	5129	sp|P17480|UBF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8925.4	103.4737	4	1581.7937	1581.7899	R	K	179	192
PSM	VTVAGLAGK	5130	sp|Q99497|PARK7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8865.6	101.9294	2	814.4906	814.4913	K	D	33	42
PSM	VFPSHFTQQR	5131	sp|Q7Z6Z7-2|HUWE1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8942.5	103.9271	3	1245.6265	1245.6255	K	T	3330	3340
PSM	TVAIHSDVDASSVHVK	5132	sp|P05165|PCCA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9139.5	109.1273	4	1663.8553	1663.8530	K	M	89	105
PSM	IKQEILPEER	5133	sp|O75534-2|CSDE1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8851.4	101.554	3	1253.6977	1253.6979	K	M	90	100
PSM	DLVKPGDENLR	5134	sp|Q4V328-4|GRAP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9006.2	105.6237	3	1254.6412	1254.6568	R	E	748	759
PSM	GPSVDWGK	5135	sp|Q16851|UGPA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8916.7	103.245	2	844.4078	844.4079	K	I	70	78
PSM	DPNIVIAK	5136	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9007.5	105.6554	2	868.5016	868.5018	K	M	426	434
PSM	DPNIVIAK	5137	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9026.5	106.1629	2	868.5018	868.5018	K	M	426	434
PSM	KVTEELLTDNR	5138	sp|Q9UHB9|SRP68_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9059.7	107.0484	3	1316.6962	1316.6936	K	Y	112	123
PSM	LCDSYEIRPGK	5139	sp|O43390-2|HNRPR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	2-UNIMOD:4	ms_run[1]:scan=1.1.8995.6	105.3385	3	1336.6432	1336.6445	K	H	225	236
PSM	VYGTVLSR	5140	sp|Q9UDR5|AASS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8872.6	102.1123	2	893.4952	893.4971	K	H	260	268
PSM	TDAPLNIR	5141	sp|Q12931|TRAP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9118.6	108.5871	2	898.4860	898.4872	K	S	333	341
PSM	TIAPALVSK	5142	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8984.5	105.0468	2	898.5500	898.5488	K	K	72	81
PSM	ESISRPPPVDVR	5143	sp|Q9UPN6-2|SCAF8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8855.6	101.6624	3	1350.7261	1350.7256	R	D	1091	1103
PSM	SSHETLNIVEEK	5144	sp|O43491-4|E41L2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8955.7	104.2785	3	1384.6807	1384.6834	K	K	612	624
PSM	VHSFPTLK	5145	sp|P07237|PDIA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8983.2	105.0156	3	927.5197	927.5178	K	F	437	445
PSM	ELAVQIQK	5146	sp|P38919|IF4A3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9052.4	106.8559	2	927.5386	927.5389	R	G	117	125
PSM	EDLQLDKPASGVK	5147	sp|P78347-2|GTF2I_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8868.7	102.0098	3	1398.7345	1398.7354	R	E	403	416
PSM	GDAHECFVSPVAK	5148	sp|Q6UB35|C1TM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	6-UNIMOD:4	ms_run[1]:scan=1.1.9050.8	106.8092	3	1415.6506	1415.6504	R	A	193	206
PSM	ANIQAVSLK	5149	sp|O43633|CHM2A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9177.6	110.1475	2	942.5488	942.5498	R	I	81	90
PSM	SGEVLVNVK	5150	sp|Q13347|EIF3I_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8876.5	102.2141	2	943.5320	943.5338	K	E	177	186
PSM	AVTLAVQPR	5151	sp|O14981|BTAF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9038.7	106.487	2	953.5644	953.5658	K	L	745	754
PSM	NTDVVATLK	5152	sp|Q7Z4V5-2|HDGR2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8868.8	102.0115	2	959.5280	959.5288	K	K	516	525
PSM	DVGAQILLHSHKK	5153	sp|Q96KP4|CNDP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9000.7	105.4726	3	1444.8142	1444.8150	K	D	290	303
PSM	LGPLVEQGR	5154	sp|P02649|APOE_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9037.6	106.4587	2	967.5436	967.5451	R	V	199	208
PSM	NRESYEVSLTQK	5155	sp|Q9NX40|OCAD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8949.5	104.1145	3	1452.7225	1452.7208	K	T	206	218
PSM	HIAVFPCK	5156	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	7-UNIMOD:4	ms_run[1]:scan=1.1.8940.9	103.8805	2	970.5042	970.5059	K	I	1086	1094
PSM	TNYNDRYDEIR	5157	sp|P62424|RL7A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8840.8	101.2754	3	1457.6533	1457.6535	R	R	224	235
PSM	QPTIFQNK	5158	sp|P62280|RS11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8865.7	101.9311	2	974.5180	974.5185	K	K	13	21
PSM	YATLATVSR	5159	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8975.8	104.8158	2	980.5286	980.5291	K	C	2350	2359
PSM	DAYSSFGSR	5160	sp|O00571|DDX3X_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9011.7	105.7653	2	988.4244	988.4250	K	S	67	76
PSM	VVGSEFVQK	5161	sp|P43686|PRS6B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8922.8	103.4018	2	991.5310	991.5339	R	Y	230	239
PSM	YALTGDEVK	5162	sp|P62701|RS4X_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8986.8	105.1039	2	994.4966	994.4971	K	K	54	63
PSM	AEDLNIAPR	5163	sp|Q96SZ5|AEDO_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9119.7	108.6149	2	997.5188	997.5192	R	K	63	72
PSM	NQGIEEALK	5164	sp|P18206|VINC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9004.6	105.5769	2	1000.5182	1000.5189	K	N	220	229
PSM	NQGIEEALK	5165	sp|P18206|VINC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9023.5	106.0826	2	1000.5182	1000.5189	K	N	220	229
PSM	AAAFEQLQK	5166	sp|O94826|TOM70_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20		ms_run[1]:scan=1.1.9087.8	107.7899	2	1004.5112	1004.5282	R	W	160	169
PSM	VIQWCTHHKDDPPPPEDDENK	5167	sp|P63208|SKP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	5-UNIMOD:4	ms_run[1]:scan=1.1.9015.6	105.8704	5	2556.1321	2556.1340	K	E	58	79
PSM	TGISEEAAIEENKR	5168	sp|Q5UIP0|RIF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9104.5	108.2231	3	1545.7456	1545.7634	K	N	1935	1949
PSM	HGIPTAQWK	5169	sp|P22102|PUR2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8864.10	101.9098	2	1036.5442	1036.5454	R	A	117	126
PSM	YVSQYYPK	5170	sp|Q5SSJ5|HP1B3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9138.8	109.1064	2	1046.5044	1046.5073	K	L	284	292
PSM	TLSDYNIQK	5171	sp|P62979|RS27A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9100.6	108.1219	2	1080.5428	1080.5451	R	E	55	64
PSM	LEEYITTSK	5172	sp|Q14683|SMC1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9060.9	107.0785	2	1082.5470	1082.5495	K	Q	438	447
PSM	AYTNFDAER	5173	sp|P07355-2|ANXA2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8960.8	104.4143	2	1085.4762	1085.4778	K	D	47	56
PSM	QENGASVILR	5174	sp|P29692-2|EF1D_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9106.9	108.2814	2	1085.5800	1085.5829	R	D	405	415
PSM	FNEENYGVK	5175	sp|Q8WWM7|ATX2L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8898.5	102.7888	2	1098.4972	1098.4982	K	T	259	268
PSM	YDDMAACMK	5176	sp|P63104|1433Z_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	7-UNIMOD:4	ms_run[1]:scan=1.1.8891.9	102.6064	2	1103.4082	1103.4086	R	S	19	28
PSM	VFSQTTICR	5177	sp|Q01860|PO5F1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	8-UNIMOD:4	ms_run[1]:scan=1.1.8850.10	101.538	2	1110.5478	1110.5492	K	F	178	187
PSM	VFSQTTICR	5178	sp|Q01860|PO5F1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	8-UNIMOD:4	ms_run[1]:scan=1.1.8869.10	102.0409	2	1110.5478	1110.5492	K	F	178	187
PSM	NICQQVNIK	5179	sp|Q14152|EIF3A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	3-UNIMOD:4	ms_run[1]:scan=1.1.9048.8	106.756	2	1115.5732	1115.5757	K	S	76	85
PSM	VEYSEEELK	5180	sp|P12956-2|XRCC6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8944.8	103.9858	2	1124.5234	1124.5237	K	T	516	525
PSM	KPGDLSDELR	5181	sp|Q13435|SF3B2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8993.4	105.2821	3	1128.5824	1128.5775	K	I	605	615
PSM	LGAEVYHTLK	5182	sp|P09104-2|ENOG_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9171.3	109.9811	3	1129.6144	1129.6131	R	G	141	151
PSM	LNFSHGTHEYHAETIK	5183	sp|P14618-2|KPYM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9062.2	107.1203	5	1882.8996	1882.8962	R	N	74	90
PSM	LLLQVQHASK	5184	sp|P05141|ADT2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8851.3	101.5523	3	1135.6756	1135.6713	K	Q	34	44
PSM	GSFSDTGLGDGK	5185	sp|Q9Y2W1|TR150_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8991.8	105.2358	2	1139.5078	1139.5095	K	M	376	388
PSM	HTVDDGLDIR	5186	sp|Q86VP6|CAND1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9184.8	110.3368	2	1139.5560	1139.5571	K	K	1073	1083
PSM	RILDAAGANLK	5187	sp|Q9UBQ7|GRHPR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9174.10	110.0736	2	1140.6552	1140.6615	K	V	66	77
PSM	WAAAQAEVAPK	5188	sp|Q12830-2|BPTF_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9073.9	107.4227	2	1140.5896	1140.5927	R	T	51	62
PSM	EAESSPFVER	5189	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8899.3	102.8011	3	1149.5308	1149.5302	K	L	548	558
PSM	GGDLMAYDRR	5190	sp|P61978-2|HNRPK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8937.3	103.7903	3	1152.5362	1152.5346	R	G	317	327
PSM	THIDVIHYR	5191	sp|P33991|MCM4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9011.9	105.7686	2	1152.6008	1152.6040	K	K	414	423
PSM	GPPVFTQEER	5192	sp|Q99447-3|PCY2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9173.10	110.0466	2	1158.5670	1158.5669	K	Y	67	77
PSM	LSDDNTIGKEEIQQR	5193	sp|Q13813|SPTN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8942.9	103.9338	3	1744.8541	1744.8591	K	L	1830	1845
PSM	GEFVTTVQQR	5194	sp|P40925-3|MDHC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9009.6	105.7105	2	1163.5910	1163.5935	K	G	239	249
PSM	EITALAPSTMK	5195	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	10-UNIMOD:35	ms_run[1]:scan=1.1.8922.10	103.4052	2	1176.6032	1176.6060	K	I	316	327
PSM	EITALAPSTMK	5196	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	10-UNIMOD:35	ms_run[1]:scan=1.1.8941.8	103.9054	2	1176.6040	1176.6060	K	I	316	327
PSM	RGLAVNMVDSK	5197	sp|Q9UMR2-4|DD19B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8977.4	104.8617	3	1188.6283	1188.6285	K	H	410	421
PSM	QPAPTTIGGLNK	5198	sp|P27816-6|MAP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9049.9	106.7843	2	1195.6534	1195.6561	K	K	727	739
PSM	LTSLNEEYTK	5199	sp|P43246|MSH2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9110.9	108.3848	2	1196.5906	1196.5925	K	N	556	566
PSM	ECFVCTACR	5200	sp|Q14192|FHL2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	2-UNIMOD:4,5-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.8857.11	101.7241	2	1201.4656	1201.4678	K	K	184	193
PSM	FQTEIQTVNK	5201	sp|P14868|SYDC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9168.10	109.9119	2	1206.6212	1206.6245	R	Q	321	331
PSM	EFSQTLENEK	5202	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8965.11	104.5533	2	1223.5646	1223.5670	K	N	1866	1876
PSM	NNNSNQNFFK	5203	sp|O60763-2|USO1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8967.11	104.6072	2	1225.5474	1225.5476	K	E	246	256
PSM	LFVSGACDASAK	5204	sp|P62873-2|GBB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	7-UNIMOD:4	ms_run[1]:scan=1.1.9077.10	107.5299	2	1224.5778	1224.5809	R	L	198	210
PSM	RGDTYELQVR	5205	sp|Q9H0U3|MAGT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8863.10	101.883	2	1235.6242	1235.6258	K	G	150	160
PSM	EESDDEAAVEEEEEEK	5206	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9176.10	110.1273	3	1865.7130	1865.7174	K	K	304	320
PSM	MEEESGAPGVPSGNGAPGPK	5207	sp|P52272-2|HNRPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9038.10	106.492	3	1866.8353	1866.8418	K	G	18	38
PSM	EQVANSAFVER	5208	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9111.10	108.4122	2	1248.6046	1248.6098	K	V	492	503
PSM	EQVANSAFVER	5209	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9151.8	109.4512	2	1248.5902	1248.6098	K	V	492	503
PSM	EYDELAETQGK	5210	sp|O60341-2|KDM1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8843.10	101.3568	2	1281.5716	1281.5724	K	L	517	528
PSM	FVQCPDGELQK	5211	sp|Q9Y230-2|RUVB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	4-UNIMOD:4	ms_run[1]:scan=1.1.8936.5	103.7669	3	1319.6200	1319.6180	K	R	179	190
PSM	TEEGEIDYSAEEGENRR	5212	sp|Q8WVV9-5|HNRLL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9130.10	108.904	3	1982.8435	1982.8453	K	E	27	44
PSM	DTSVEGSEMVPGK	5213	sp|P18754-2|RCC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9084.11	107.7168	2	1334.5990	1334.6024	R	V	133	146
PSM	NGNQAFNEDNLK	5214	sp|Q9Y2Q5-2|LTOR2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8959.11	104.3924	2	1362.6140	1362.6164	R	F	59	71
PSM	LNQPPEDGISSVK	5215	sp|O43684-2|BUB3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9193.11	110.5789	2	1382.7002	1382.7041	K	F	9	22
PSM	IYDLNKPEAEPK	5216	sp|Q9Y3F4-2|STRAP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8881.10	102.3509	2	1415.7230	1415.7296	R	E	139	151
PSM	TATTQETDGFQVK	5217	sp|Q96GM5-2|SMRD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9042.11	106.6005	2	1424.6754	1424.6784	R	R	261	274
PSM	ETYGEMADCCAK	5218	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	9-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.8844.11	101.3846	2	1433.5232	1433.5261	R	Q	106	118
PSM	SSGASVTTQPTEFK	5219	sp|Q9BY77|PDIP3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8837.8	101.1967	3	1438.6930	1438.6940	K	I	405	419
PSM	ELAGHTGYLSCCR	5220	sp|P62873-2|GBB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	11-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.8932.11	103.6707	2	1522.6606	1522.6657	R	F	138	151
PSM	SPDLAPTPAPQSTPR	5221	sp|Q9BY44-3|EIF2A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9002.10	105.5306	2	1533.7764	1533.7787	K	N	481	496
PSM	EQLQSVTTNSGYTR	5222	sp|Q12888-2|TP53B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9151.11	109.4562	2	1582.7556	1582.7587	K	L	198	212
PSM	MLQPCGPPADKPEEN	5223	sp|Q9BWJ5|SF3B5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	5-UNIMOD:4	ms_run[1]:scan=1.1.8925.11	103.4854	2	1681.7422	1681.7440	K	-	72	87
PSM	SPSWQRPNQGVPSTGR	5224	sp|Q96HC4|PDLI5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9192.9	110.549	3	1752.8572	1752.8656	K	I	360	376
PSM	TAENATSGETLEENEAGD	5225	sp|Q9UQ80|PA2G4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9000.10	105.4776	3	1836.7444	1836.7497	K	-	377	395
PSM	GGVSLAALKK	5226	sp|Q02539|H11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9208.2	110.9596	3	942.5875	942.5862	R	A	58	68
PSM	DFSHPQMPK	5227	sp|P48643|TCPE_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9442.2	117.1746	3	1085.4979	1085.4964	K	K	233	242
PSM	SEEAHAEDSVMDHHFR	5228	sp|Q8NC51-3|PAIRB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9448.2	117.3368	5	1895.7881	1895.7857	K	K	315	331
PSM	KVHVIFNYK	5229	sp|P27797|CALR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9377.3	115.4377	3	1146.6592	1146.6550	K	G	143	152
PSM	HMYHSLYLK	5230	sp|P84098|RL19_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9291.4	113.1573	3	1190.5852	1190.5906	R	V	118	127
PSM	HMYHSLYLK	5231	sp|P84098|RL19_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9272.3	112.6533	3	1190.5852	1190.5906	R	V	118	127
PSM	ALDLVAAK	5232	sp|O43242|PSMD3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9472.3	117.9858	2	799.4814	799.4803	R	C	202	210
PSM	VLTLDHPDAVK	5233	sp|O95749-2|GGPPS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9470.2	117.9304	3	1206.6625	1206.6608	K	L	49	60
PSM	HIYYITGETK	5234	sp|P07900-2|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9206.5	110.9118	3	1223.6194	1223.6186	K	D	612	622
PSM	VAEFHTELER	5235	sp|P48556|PSMD8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9467.3	117.8512	3	1229.6041	1229.6040	R	L	205	215
PSM	VTAQGPGLEPSGNIANK	5236	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9416.3	116.4843	4	1651.8461	1651.8529	K	T	384	401
PSM	KEEELQAALAR	5237	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9405.4	116.1943	3	1256.6728	1256.6724	K	L	1081	1092
PSM	PSPLLVGR	5238	sp|Q13283|G3BP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9517.6	119.2004	2	837.5076	837.5072	K	E	6	14
PSM	QSVENDIHGLR	5239	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9328.5	114.1452	3	1266.6322	1266.6317	R	K	176	187
PSM	KIENLQEQLR	5240	sp|O15083|ERC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9284.4	112.9699	3	1269.6901	1269.7041	K	D	547	557
PSM	VRIDEYDYSK	5241	sp|P31040-2|SDHA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9526.4	119.4392	3	1286.6140	1286.6143	K	P	551	561
PSM	TSASIILR	5242	sp|P17987|TCPA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9437.3	117.0415	2	859.5124	859.5127	R	G	371	379
PSM	SVQTTLQTDEVK	5243	sp|O94905|ERLN2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9319.4	113.9083	3	1347.6865	1347.6882	R	N	61	73
PSM	LALSVGTDK	5244	sp|Q9NWT1|PK1IP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9360.6	114.9875	2	902.5084	902.5073	K	T	137	146
PSM	VFGPGIEGK	5245	sp|O75369-2|FLNB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9297.5	113.3203	2	902.4862	902.4862	K	D	1233	1242
PSM	TFEGIDPK	5246	sp|P50395|GDIB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9257.4	112.2645	2	905.4480	905.4494	R	K	157	165
PSM	IQTQPGYANTLR	5247	sp|Q00325-2|MPCP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9345.4	114.5894	3	1360.7068	1360.7099	R	D	189	201
PSM	KEPLYVGVDDDK	5248	sp|Q9NVP1|DDX18_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9318.4	113.8821	3	1376.6770	1376.6824	K	A	381	393
PSM	TWEQQQEVVSR	5249	sp|Q9UJU6-2|DBNL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9312.8	113.7292	3	1388.6695	1388.6684	R	N	237	248
PSM	AEAAELGLR	5250	sp|Q5TZA2|CROCC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9231.7	111.5824	2	928.4962	928.4978	R	L	1396	1405
PSM	TLATTLAPR	5251	sp|Q9H583|HEAT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9398.8	116.0125	2	942.5492	942.5498	K	V	1812	1821
PSM	AFAVQSAVR	5252	sp|Q14692|BMS1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9233.10	111.6412	2	947.5192	947.5189	K	M	44	53
PSM	ELLKPNASVALHK	5253	sp|P43686|PRS6B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9465.8	117.8057	3	1418.8249	1418.8245	R	H	122	135
PSM	SQQQQLVESLHK	5254	sp|Q7Z3B4-3|NUP54_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9493.7	118.5575	3	1423.7368	1423.7419	R	V	156	168
PSM	HGLYLPTR	5255	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9239.7	111.7962	2	955.5212	955.5239	K	V	1044	1052
PSM	AFFESHPAPSAER	5256	sp|P55786|PSA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9436.6	117.0196	3	1444.6738	1444.6735	K	T	870	883
PSM	APDVTTLPR	5257	sp|Q92542-2|NICA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9280.7	112.8693	2	968.5278	968.5291	K	N	295	304
PSM	VQIVISSAR	5258	sp|P0CG13|CTF8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9499.5	118.7154	2	971.5746	971.5764	M	A	2	11
PSM	VVGSELIQK	5259	sp|P62191|PRS4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9240.6	111.8211	2	971.5632	971.5651	R	Y	250	259
PSM	VIGSELVQK	5260	sp|P35998|PRS7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9260.6	112.3457	2	971.5634	971.5651	R	Y	240	249
PSM	LAAFGQLHK	5261	sp|Q12906-7|ILF3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9456.2	117.553	3	983.5591	983.5552	R	V	324	333
PSM	LAAFGQLHK	5262	sp|Q12906-7|ILF3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9437.2	117.0399	3	983.5591	983.5552	R	V	324	333
PSM	NECVVVIR	5263	sp|P05198|IF2A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	3-UNIMOD:4	ms_run[1]:scan=1.1.9296.5	113.2934	2	987.5162	987.5172	R	V	68	76
PSM	ATDAEADVASLNRR	5264	sp|P09493-3|TPM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9507.5	118.9299	3	1487.7307	1487.7328	K	I	78	92
PSM	MTPSYEIR	5265	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9322.10	113.9967	2	995.4738	995.4746	K	A	17	25
PSM	APEIMLNSK	5266	sp|P28482|MK01_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9464.5	117.7737	2	1001.5302	1001.5215	R	G	195	204
PSM	VPVDEFDGK	5267	sp|Q92499-3|DDX1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9227.6	111.4733	2	1004.4788	1004.4815	K	V	551	560
PSM	DAIHFYNK	5268	sp|P31948|STIP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9482.6	118.2603	2	1006.4858	1006.4872	K	S	318	326
PSM	DDDIEEGDLPEHK	5269	sp|Q14696|MESD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9213.7	111.1	3	1510.6423	1510.6423	K	R	73	86
PSM	LVLVGDGGTGK	5270	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9392.7	115.8488	2	1014.5696	1014.5710	K	T	13	24
PSM	GLVSSDELAK	5271	sp|Q13813|SPTN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9282.3	112.9156	2	1017.5314	1017.5342	R	D	1360	1370
PSM	CIQSLVHACQCR	5272	sp|Q92793-2|CBP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	1-UNIMOD:4,9-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=1.1.9297.6	113.322	3	1530.6883	1530.6854	R	N	1737	1749
PSM	TVLAAAYGEK	5273	sp|Q9H583|HEAT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9212.7	111.0735	2	1021.5442	1021.5444	K	D	1427	1437
PSM	LNDFASTVR	5274	sp|P20674|COX5A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9511.9	119.0441	2	1021.5188	1021.5193	R	I	99	108
PSM	MAVLNEQVK	5275	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9522.8	119.338	2	1030.5464	1030.5481	R	E	618	627
PSM	IDDIADGAVKPPPNK	5276	sp|Q7Z4V5-2|HDGR2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9232.7	111.6093	3	1548.8146	1548.8148	R	Y	25	40
PSM	VGEGFEEETVDGRK	5277	sp|P29762|RABP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9409.7	116.3067	3	1550.7199	1550.7213	K	C	68	82
PSM	GDECGLALGR	5278	sp|P54886-2|P5CS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	4-UNIMOD:4	ms_run[1]:scan=1.1.9254.7	112.1914	2	1046.4800	1046.4815	R	L	85	95
PSM	IDSDISGTLK	5279	sp|Q9Y2B0|CNPY2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9495.8	118.6129	2	1047.5438	1047.5448	R	F	125	135
PSM	ADTLTLEER	5280	sp|Q9UHD8|SEPT9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9333.8	114.2816	2	1046.5240	1046.5244	K	V	446	455
PSM	SLLDACESR	5281	sp|Q01082-2|SPTB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	6-UNIMOD:4	ms_run[1]:scan=1.1.9341.8	114.4918	2	1049.4802	1049.4811	K	R	1895	1904
PSM	TYLPSQVSR	5282	sp|P35606-2|COPB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9216.10	111.1846	2	1049.5500	1049.5506	R	V	731	740
PSM	NETDEDGWTTVRR	5283	sp|Q14152|EIF3A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9373.8	115.3385	3	1577.7079	1577.7070	K	-	1370	1383
PSM	HWGGNVLGPK	5284	sp|P62424|RL7A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9330.7	114.201	2	1063.5554	1063.5563	R	S	236	246
PSM	LNEVYEAVK	5285	sp|Q86U86-8|PB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9403.7	116.1454	2	1063.5544	1063.5549	K	N	677	686
PSM	DSEGYIYAR	5286	sp|Q03154-4|ACY1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9402.10	116.1237	2	1072.4822	1072.4825	K	G	66	75
PSM	LTELGTVDPK	5287	sp|P46940|IQGA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9353.8	114.8056	2	1071.5818	1071.5812	K	N	1466	1476
PSM	LQEQVTDLR	5288	sp|P12270|TPR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9298.8	113.3522	2	1100.5804	1100.5826	K	S	700	709
PSM	TLFANTGGTVK	5289	sp|Q9UKA9-2|PTBP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9542.8	119.868	2	1107.5882	1107.5924	R	A	473	484
PSM	WSLQSEAHR	5290	sp|Q16658|FSCN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9346.3	114.614	3	1112.5402	1112.5363	R	R	101	110
PSM	EEGLAEETLK	5291	sp|Q2M389|WASC4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9407.11	116.2597	2	1117.5336	1117.5502	K	A	959	969
PSM	QDAQSLLAPGK	5292	sp|Q9UDR5|AASS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9505.10	118.8844	2	1126.5960	1126.5982	R	F	323	334
PSM	ACALSIEESCRPGDK	5293	sp|P31040-2|SDHA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	2-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.9391.5	115.8185	3	1691.7637	1691.7607	R	V	418	433
PSM	VYVGNLGTGAGK	5294	sp|Q16629-4|SRSF7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9205.8	110.8904	2	1134.6012	1134.6033	K	G	13	25
PSM	LEQDEYALR	5295	sp|P55084-2|ECHB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9481.10	118.2399	2	1135.5500	1135.5509	R	S	217	226
PSM	VNVPVIGGHAGK	5296	sp|P40926|MDHM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9518.3	119.2223	3	1146.6517	1146.6510	R	T	192	204
PSM	GNDPNVNIVPK	5297	sp|Q9Y520-4|PRC2C_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9306.7	113.5662	2	1165.6056	1165.6091	K	D	69	80
PSM	CSPIGVYTSGK	5298	sp|P33992|MCM5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	1-UNIMOD:4	ms_run[1]:scan=1.1.9527.9	119.4743	2	1167.5532	1167.5594	K	G	397	408
PSM	LFNTAVCESK	5299	sp|Q9BXJ9|NAA15_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	7-UNIMOD:4	ms_run[1]:scan=1.1.9423.6	116.6723	2	1167.5574	1167.5594	R	D	715	725
PSM	LVDEEPQLTK	5300	sp|Q9UG63-2|ABCF2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9224.9	111.3976	2	1170.6096	1170.6132	K	R	609	619
PSM	QGNLSSQVPLK	5301	sp|P78527|PRKDC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9267.8	112.531	2	1169.6376	1169.6404	K	R	3148	3159
PSM	DAALATALGDKK	5302	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9267.9	112.5327	2	1172.6248	1172.6401	K	S	146	158
PSM	LGTPELSTAER	5303	sp|Q13085-2|ACACA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9450.9	117.4025	2	1172.6008	1172.6037	R	K	2093	2104
PSM	LSSNAVSQITR	5304	sp|Q9BQ39|DDX50_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9224.10	111.3993	2	1174.6278	1174.6306	K	M	612	623
PSM	EVEQFTQVAK	5305	sp|O96000-2|NDUBA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9386.10	115.6922	2	1177.5946	1177.5979	K	A	122	132
PSM	ACSDELTVYK	5306	sp|Q92673|SORL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	2-UNIMOD:4	ms_run[1]:scan=1.1.9469.10	117.9167	2	1184.5360	1184.5383	K	V	1548	1558
PSM	LLSCSADGTLR	5307	sp|O43815-2|STRN_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	4-UNIMOD:4	ms_run[1]:scan=1.1.9313.8	113.7561	2	1191.5872	1191.5918	R	L	535	546
PSM	DETNYGIPQR	5308	sp|P63244|RACK1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9467.9	117.8612	2	1191.5504	1191.5520	R	A	48	58
PSM	ILQNEPLPER	5309	sp|O95793-2|STAU1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9510.10	119.0187	2	1207.6532	1207.6561	R	L	78	88
PSM	AADLNGDLTATR	5310	sp|Q15293|RCN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9325.11	114.0768	2	1216.6028	1216.6048	K	E	177	189
PSM	IDEIASNLQSK	5311	sp|Q96JM2-3|ZN462_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9478.9	118.1577	2	1216.6384	1216.6299	R	I	696	707
PSM	QYTEAISVGEK	5312	sp|Q9H9A5-6|CNO10_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9356.9	114.8861	2	1223.6026	1223.6034	R	L	185	196
PSM	HIYYITGETK	5313	sp|P07900-2|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9238.10	111.7747	2	1223.6152	1223.6186	K	D	612	622
PSM	VAEFHTELER	5314	sp|P48556|PSMD8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9448.4	117.3401	3	1229.6041	1229.6040	R	L	205	215
PSM	TSEEFVHINR	5315	sp|P50851|LRBA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9422.2	116.6394	3	1230.6040	1230.5993	K	L	2399	2409
PSM	QLQAETEPIVK	5316	sp|P60228|EIF3E_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9198.9	110.7076	2	1254.6792	1254.6819	K	M	83	94
PSM	LPTDLTACDNR	5317	sp|Q96RS6-2|NUDC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	8-UNIMOD:4	ms_run[1]:scan=1.1.9543.11	119.8988	2	1274.5874	1274.5925	R	L	75	86
PSM	VVTQNICQYR	5318	sp|Q8N163|CCAR2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	7-UNIMOD:4	ms_run[1]:scan=1.1.9251.11	112.1202	2	1279.6316	1279.6343	R	S	748	758
PSM	DISTNYYASQK	5319	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9358.4	114.9308	3	1288.5940	1288.5935	K	K	672	683
PSM	GTYADDCLVQR	5320	sp|Q9Y324|FCF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	7-UNIMOD:4	ms_run[1]:scan=1.1.9486.9	118.3726	2	1296.5730	1296.5769	K	V	138	149
PSM	VLTDGELAPNDR	5321	sp|Q5TAX3|TUT4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9454.10	117.5123	2	1298.6436	1298.6466	R	C	1282	1294
PSM	QYDTYGEEGLK	5322	sp|Q9UBS4|DJB11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9478.10	118.1594	2	1301.5748	1301.5775	K	D	85	96
PSM	SVSLTGAPESVQK	5323	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9307.10	113.598	2	1301.6774	1301.6827	R	A	191	204
PSM	ICEPGYSPTYK	5324	sp|P07858|CATB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	2-UNIMOD:4	ms_run[1]:scan=1.1.9393.11	115.8823	2	1313.5776	1313.5962	K	Q	210	221
PSM	EQAEAEVASLNR	5325	sp|P06753-2|TPM3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9456.9	117.5647	2	1315.6332	1315.6368	R	R	43	55
PSM	SINNDTTYCIK	5326	sp|Q53H82|LACB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	9-UNIMOD:4	ms_run[1]:scan=1.1.9241.10	111.8544	2	1327.6028	1327.6078	K	K	92	103
PSM	EAQLYAAQAHLK	5327	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9417.9	116.5204	2	1341.7008	1341.7041	K	L	536	548
PSM	TDNSSLSSPLNPK	5328	sp|Q9UIG0-2|BAZ1B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9415.9	116.468	2	1358.6658	1358.6678	K	L	323	336
PSM	TGQYSGIYDCAK	5329	sp|Q6NUK1-2|SCMC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	10-UNIMOD:4	ms_run[1]:scan=1.1.9449.11	117.3788	2	1361.5880	1361.5922	K	K	302	314
PSM	ATTGTQTLLSSGTR	5330	sp|Q8IX01-3|SUGP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9222.9	111.3439	2	1392.7138	1392.7209	R	L	696	710
PSM	NQIQDQEQLVSK	5331	sp|P49454|CENPF_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9345.9	114.5978	2	1428.7148	1428.7209	K	L	2625	2637
PSM	AFVRPSGTEDVVR	5332	sp|O95394-3|AGM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9401.10	116.0966	2	1431.7444	1431.7470	R	V	493	506
PSM	SQTTYYAQCYR	5333	sp|Q9NR46-2|SHLB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	9-UNIMOD:4	ms_run[1]:scan=1.1.9332.10	114.2587	2	1439.6128	1439.6140	K	H	263	274
PSM	LRYEIDTGEETK	5334	sp|Q0VDF9|HSP7E_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9468.6	117.8831	3	1452.7060	1452.7096	K	F	98	110
PSM	IADIPIDHPSCSK	5335	sp|Q8TAD8|SNIP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	11-UNIMOD:4	ms_run[1]:scan=1.1.9477.7	118.1275	3	1451.7112	1451.7079	R	Q	289	302
PSM	VGEGFEEETVDGRK	5336	sp|P29762|RABP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9388.9	115.7444	3	1550.7199	1550.7213	K	C	68	82
PSM	AEISFEDRK	5337	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8383.10	89.10028	2	1093.5392	1093.5404	K	D	2273	2282
PSM	SQLLGSAHEVQR	5338	sp|Q13813|SPTN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8142.8	82.80293	3	1323.6907	1323.6895	R	F	1226	1238
PSM	HQAFEAELHANADR	5339	sp|Q13813|SPTN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8974.7	104.7878	4	1607.7473	1607.7440	K	I	1592	1606
PSM	LACDVDQVTR	5340	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	3-UNIMOD:4	ms_run[1]:scan=1.1.8458.4	91.07607	3	1175.5606	1175.5605	R	Q	972	982
PSM	LGHELQQAGLK	5341	sp|Q14980-2|NUMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8536.6	93.1445	3	1192.6603	1192.6564	R	T	1641	1652
PSM	VAVVNQIAR	5342	sp|Q01082-2|SPTB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8744.7	98.69682	2	968.5758	968.5767	R	Q	905	914
PSM	LVSDGNINSDR	5343	sp|Q01082-2|SPTB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7702.4	71.33268	3	1188.5557	1188.5735	R	I	1235	1246
PSM	SIPLDEGEDEAQR	5344	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9499.5	118.7154	3	1457.6536	1457.6634	R	R	2384	2397
PSM	ASITALEAK	5345	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8957.7	104.3322	2	902.5084	902.5073	K	I	1807	1816
PSM	VPVDVAYQR	5346	sp|Q15149|PLEC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9091.5	107.8884	2	1045.5522	1045.5556	R	G	3620	3629
PSM	SSVINSIR	5347	sp|Q5T7N2|LITD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8682.5	97.02409	2	874.4896	874.4872	R	E	619	627
PSM	EQVANSAFVER	5348	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9383.10	115.6111	2	1248.5986	1248.6098	K	V	492	503
PSM	STVLQQQYNR	5349	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8387.5	89.19865	3	1235.6293	1235.6258	K	V	429	439
PSM	GSVEEPKPEEPK	5350	sp|Q02952-2|AKA12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7253.7	59.38175	3	1324.6555	1324.6510	K	R	561	573
PSM	DLHTLDSHVR	5351	sp|Q5T4S7-2|UBR4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8289.4	86.5864	3	1191.5968	1191.5996	R	G	3229	3239
PSM	AESQLLECK	5352	sp|P12270|TPR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	8-UNIMOD:4	ms_run[1]:scan=1.1.8450.9	90.86938	2	1076.5178	1076.5172	K	A	1120	1129
PSM	FGNTEQGFK	5353	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8281.8	86.3791	2	1026.4760	1026.4771	K	F	1852	1861
PSM	NTHCSSLPHYQK	5354	sp|P43243|MATR3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	4-UNIMOD:4	ms_run[1]:scan=1.1.7292.8	60.38992	2	1470.6664	1470.6674	K	L	818	830
PSM	YTQVGPDHNR	5355	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.6937.4	50.92857	3	1185.5632	1185.5527	K	S	200	210
PSM	AAECNIVVTQPR	5356	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	4-UNIMOD:4	ms_run[1]:scan=1.1.9034.8	106.3819	3	1356.6832	1356.6820	R	R	435	447
PSM	LAQGLTHLGK	5357	sp|Q13200|PSMD2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8544.2	93.35267	3	1036.6060	1036.6029	R	G	764	774
PSM	GEVRPELGSR	5358	sp|P27708|PYR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7444.3	64.41758	3	1098.5845	1098.5782	K	Q	1658	1668
PSM	MDATANDVPSDR	5359	sp|P13667|PDIA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7791.5	73.62382	3	1290.5503	1290.5510	K	Y	583	595
PSM	PAAVVLQTK	5360	sp|Q14697|GANAB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8029.10	79.84029	2	925.5608	925.5597	K	G	900	909
PSM	IGQQPQQPGAPPQQDYTK	5361	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8715.11	97.92208	3	1979.9638	1979.9701	K	A	629	647
PSM	LTIAEERDK	5362	sp|P62701|RS4X_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7446.7	64.4782	2	1073.5722	1073.5717	R	R	246	255
PSM	RALANSLACQGK	5363	sp|P04075-2|ALDOA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	9-UNIMOD:4	ms_run[1]:scan=1.1.7558.9	67.48435	2	1287.6716	1287.6717	K	Y	385	397
PSM	FEDSPSYVK	5364	sp|O60264|SMCA5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8743.7	98.66994	2	1070.4890	1070.4920	R	W	168	177
PSM	RPLEDGDQPDAK	5365	sp|Q96AE4-2|FUBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7030.8	53.3703	3	1339.6411	1339.6368	K	K	65	77
PSM	GEEGHDPKEPEQLR	5366	sp|P51991|ROA3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7318.7	61.04688	4	1619.7613	1619.7539	R	K	22	36
PSM	DANNGNLQLR	5367	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8307.3	87.06577	3	1113.5560	1113.5527	K	N	288	298
PSM	QKLEEDAEMK	5368	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7431.7	64.07222	3	1219.5799	1219.5754	K	S	215	225
PSM	QEYVDYSESAK	5369	sp|O60832|DKC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8797.11	100.1318	2	1317.5710	1317.5724	K	K	414	425
PSM	STCIYGGAPK	5370	sp|Q92841-3|DDX17_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	3-UNIMOD:4	ms_run[1]:scan=1.1.7984.11	78.67177	2	1052.4958	1052.4961	K	G	196	206
PSM	QKPCDLPLR	5371	sp|O00425|IF2B3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	4-UNIMOD:4	ms_run[1]:scan=1.1.8202.2	84.3397	3	1125.5986	1125.5965	K	L	191	200
PSM	LQQTEAELR	5372	sp|P26640|SYVC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7738.6	72.27219	2	1086.5648	1086.5669	K	K	1243	1252
PSM	ASAVSELSPR	5373	sp|Q9Y2W1|TR150_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8665.9	96.57305	2	1015.5308	1015.5298	R	E	236	246
PSM	GGGGGQDNGLEGLGNDSR	5374	sp|P08621|RU17_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9398.10	116.0158	3	1658.7196	1658.7245	R	D	394	412
PSM	SAVGFEYQGK	5375	sp|Q14247|SRC8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9480.11	118.2147	2	1084.5176	1084.5189	K	T	135	145
PSM	GCPEDAAVCAVDK	5376	sp|P11717|MPRI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	2-UNIMOD:4,9-UNIMOD:4	ms_run[1]:scan=1.1.9355.11	114.8631	2	1390.5798	1390.5857	R	N	530	543
PSM	NTKDEFEER	5377	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7261.3	59.5826	3	1166.5258	1166.5204	K	A	782	791
PSM	TLDPDPAIR	5378	sp|P55060-3|XPO2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9234.10	111.6678	2	996.5218	996.5240	K	R	18	27
PSM	QDAQSLHGDIPQK	5379	sp|Q9NR30|DDX21_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7971.8	78.32962	3	1435.7041	1435.7056	K	Q	462	475
PSM	PLSSVQENIQQK	5380	sp|P52732|KIF11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8856.7	101.6909	3	1369.7194	1369.7201	K	S	746	758
PSM	QLEEEQQALQK	5381	sp|P07951-2|TPM2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8359.10	88.45702	2	1342.6696	1342.6728	K	K	38	49
PSM	HGINCFINR	5382	sp|P78371|TCPB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	5-UNIMOD:4	ms_run[1]:scan=1.1.9526.9	119.4475	2	1129.5428	1129.5451	K	Q	285	294
PSM	ATAGDTHLGGEDFDNR	5383	sp|P0DMV8-2|HS71A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9148.7	109.3689	3	1674.7216	1674.7234	K	L	166	182
PSM	IIYGGSVTGATCK	5384	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	12-UNIMOD:4	ms_run[1]:scan=1.1.9409.8	116.3084	2	1325.6780	1325.6649	R	E	244	257
PSM	APPHELTEEEK	5385	sp|Q13409-2|DC1I2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7373.5	62.50067	3	1278.6151	1278.6092	K	Q	197	208
PSM	HYGGLTGLNK	5386	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8253.6	85.64304	2	1058.5504	1058.5509	R	A	91	101
PSM	VFQGCGPPK	5387	sp|O75487|GPC4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	5-UNIMOD:4	ms_run[1]:scan=1.1.7565.9	67.6729	2	988.4800	988.4801	K	P	337	346
PSM	LESENDEYER	5388	sp|O94906|PRP6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7425.11	63.91678	2	1282.5332	1282.5313	K	A	651	661
PSM	RAGELTEDEVER	5389	sp|P62269|RS18_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7930.9	77.24709	3	1402.6711	1402.6688	K	V	55	67
PSM	YHNVGLSK	5390	sp|Q14103-3|HNRPD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7183.6	57.52947	2	916.4786	916.4767	K	C	244	252
PSM	TAVCDIPPR	5391	sp|Q9BVA1|TBB2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	4-UNIMOD:4	ms_run[1]:scan=1.1.8775.10	99.5388	2	1027.5116	1027.5121	K	G	351	360
PSM	QVGLMVQER	5392	sp|P49419-2|AL7A1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9525.9	119.4206	2	1058.5498	1058.5543	K	F	253	262
PSM	NENNSHAFIR	5393	sp|Q9NTI5-2|PDS5B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7539.6	66.96851	3	1200.5707	1200.5636	K	K	1032	1042
PSM	KCEQVLIEK	5394	sp|Q13616|CUL1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	2-UNIMOD:4	ms_run[1]:scan=1.1.7622.3	69.19753	3	1145.6113	1145.6114	R	H	290	299
PSM	QACGFEYTSK	5395	sp|Q13616|CUL1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	3-UNIMOD:4	ms_run[1]:scan=1.1.8606.11	94.99253	2	1189.5076	1189.5074	K	L	494	504
PSM	RIHGVGFK	5396	sp|P62899|RL31_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7470.2	65.12022	3	912.5326	912.5294	K	K	32	40
PSM	GHYAYDCHR	5397	sp|Q16629-4|SRSF7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	7-UNIMOD:4	ms_run[1]:scan=1.1.7055.5	54.0496	3	1177.4764	1177.4723	K	Y	113	122
PSM	TGEVLHEVSNGSVVHR	5398	sp|Q14202|ZMYM3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9418.4	116.538	4	1718.8969	1718.8700	K	L	415	431
PSM	AVLIAGQPGTGK	5399	sp|Q9Y230-2|RUVB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8677.2	96.88419	3	1110.6418	1110.6397	R	T	27	39
PSM	QQKEEIEK	5400	sp|A4UGR9-8|XIRP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7146.9	56.5244	2	1030.5306	1030.5294	R	Q	2553	2561
PSM	MAQYLEEER	5401	sp|Q16204|CCDC6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9377.9	115.4477	2	1167.5208	1167.5230	K	H	287	296
PSM	VEAKPEVQSQPPR	5402	sp|Q9UN86-2|G3BP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7180.4	57.44418	4	1463.7769	1463.7732	R	V	245	258
PSM	VEAKPEVQSQPPR	5403	sp|Q9UN86-2|G3BP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7178.3	57.38782	4	1463.7769	1463.7732	R	V	245	258
PSM	AEITLVATKPEK	5404	sp|Q9UBF2|COPG2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9214.5	111.1232	3	1298.7445	1298.7445	K	L	591	603
PSM	AIVAGDQNVEYK	5405	sp|Q13642-1|FHL1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9021.3	106.0257	3	1305.6691	1305.6565	K	G	107	119
PSM	IVEPPENIQEK	5406	sp|A5YKK6-2|CNOT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9155.4	109.5521	3	1294.6759	1294.6768	R	I	1083	1094
PSM	TIAPALVSK	5407	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8973.2	104.753	3	898.5499	898.5488	K	K	72	81
PSM	MKPILLQGHER	5408	sp|Q13347|EIF3I_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8724.5	98.154	3	1320.7282	1320.7336	-	S	1	12
PSM	ELPGHTGYLSCCR	5409	sp|Q9HAV0|GBB4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	11-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.9535.8	119.6871	3	1548.6781	1548.6813	R	F	138	151
PSM	REATADDLIK	5410	sp|Q16531|DDB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8300.2	86.87601	3	1130.5954	1130.5931	K	V	1122	1132
PSM	DLEADEEDTR	5411	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8016.11	79.4951	2	1191.4890	1191.4891	K	K	53	63
PSM	IAPAEGPDVSER	5412	sp|Q9Y6M1-1|IF2B2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8067.10	80.86113	2	1239.6110	1239.6095	K	M	420	432
PSM	ETNISYSQEADDR	5413	sp|O00116|ADAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8429.7	90.30212	3	1526.6503	1526.6485	K	V	170	183
PSM	HSGPNSADSANDGFVR	5414	sp|P52597|HNRPF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7805.11	73.9959	3	1629.7141	1629.7132	K	L	99	115
PSM	GSGSGFKPFK	5415	sp|Q9NWH9|SLTM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8389.2	89.24713	3	1010.5252	1010.5185	R	G	1018	1028
PSM	INISEGNCPER	5416	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	8-UNIMOD:4	ms_run[1]:scan=1.1.8376.11	88.91457	2	1287.5854	1287.5877	R	I	47	58
PSM	KQPPVSPGTALVGSQK	5417	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8830.9	101.0159	3	1592.8885	1592.8886	R	E	31	47
PSM	VVEIVDEK	5418	sp|Q6PKG0|LARP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8408.5	89.74754	2	929.5056	929.5070	K	V	466	474
PSM	WTSQHSNTQTLGK	5419	sp|Q6PKG0|LARP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7379.8	62.66735	3	1486.7206	1486.7165	K	-	1084	1097
PSM	NSQSSSVSYLESK	5420	sp|Q92576-2|PHF3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9178.10	110.1809	2	1414.6562	1414.6576	R	S	384	397
PSM	GVLNVHPAASASKPSADQIR	5421	sp|Q92576-2|PHF3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9494.7	118.5845	4	2017.0713	2017.0705	K	Q	821	841
PSM	HLPSTEPDPHVVR	5422	sp|Q9BUJ2-2|HNRL1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8274.4	86.1854	4	1482.7605	1482.7579	K	I	271	284
PSM	EGGDGEEQDVGDAGR	5423	sp|Q8N1G4|LRC47_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7179.7	57.42178	3	1489.5955	1489.5917	R	L	292	307
PSM	QVQSLMVHQR	5424	sp|Q969G3-2|SMCE1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7985.4	78.6923	3	1224.6421	1224.6397	R	K	230	240
PSM	RPTAAELLR	5425	sp|O95747|OXSR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8927.3	103.5248	3	1025.6047	1025.5981	K	H	279	288
PSM	SIEEQQKPLTDSQR	5426	sp|Q9UKV8|AGO2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7586.9	68.23972	3	1657.8256	1657.8271	K	V	242	256
PSM	SGYGFNEPEQSR	5427	sp|Q5BKZ1|ZN326_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9411.6	116.3585	3	1369.5928	1369.5898	R	F	91	103
PSM	DSSGNLHGYVAEGGAK	5428	sp|Q8IZ83|A16A1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8558.10	93.74361	2	1560.7152	1560.7168	R	D	549	565
PSM	SEMTPEELQK	5429	sp|P62316|SMD2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8765.9	99.2677	2	1190.5508	1190.5489	K	R	9	19
PSM	ESSATDEAWR	5430	sp|Q12769|NU160_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8324.10	87.52928	2	1150.4880	1150.4891	K	L	1281	1291
PSM	NRPPLPAGTNSK	5431	sp|P42166|LAP2A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7211.5	58.28393	3	1250.6746	1250.6731	R	G	49	61
PSM	NQIVFDNR	5432	sp|Q8N8S7|ENAH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9087.8	107.7899	2	1004.5122	1004.5039	K	S	520	528
PSM	LGTSAEGAHLR	5433	sp|Q15042|RB3GP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7427.2	63.9559	3	1110.5848	1110.5782	K	A	661	672
PSM	KQEYLEVQR	5434	sp|O14964|HGS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8164.3	83.35989	3	1191.6238	1191.6248	K	Q	521	530
PSM	SGQQIVGPPR	5435	sp|Q9UNZ2-5|NSF1C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7899.8	76.43739	2	1037.5414	1037.5618	R	K	104	114
PSM	ATVELYEDR	5436	sp|Q15120-2|PDK3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9504.8	118.8543	2	1094.5240	1094.5244	R	K	255	264
PSM	SVQTTLQTDEVK	5437	sp|O94905|ERLN2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9320.9	113.9428	2	1347.6858	1347.6882	R	N	61	73
PSM	AQQVAVQEQEIAR	5438	sp|O75955-2|FLOT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8936.7	103.7703	3	1468.7602	1468.7634	R	R	214	227
PSM	IVIGYQSHADTATK	5439	sp|P06730-3|IF4E_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8819.2	100.7106	4	1502.7781	1502.7729	K	S	213	227
PSM	DAVTYTEHAK	5440	sp|P62805|H4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7296.3	60.4813	3	1133.5405	1133.5353	R	R	69	79
PSM	MKLPEHPEGGEPEDDEAPAK	5441	sp|Q9NX58|LYAR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9186.10	110.3927	4	2174.9537	2174.9790	K	G	287	307
PSM	ATTDPNECLICHR	5442	sp|Q9UJQ4|SALL4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	8-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=1.1.8793.9	100.0212	3	1585.6984	1585.6977	K	V	561	574
PSM	SKEESSGTPAHQMNLR	5443	sp|Q96AC1-2|FERM2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7415.7	63.6389	4	1770.8321	1770.8319	K	G	409	425
PSM	QFLSETEK	5444	sp|P09936|UCHL1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8453.9	90.94988	2	980.4824	980.4815	K	M	116	124
PSM	NEAIQAAHDAVAQEGQCR	5445	sp|P09936|UCHL1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	17-UNIMOD:4	ms_run[1]:scan=1.1.8075.11	81.07477	3	1966.8937	1966.8915	K	V	136	154
PSM	TPSPKEEDEEPESPPEK	5446	sp|Q9H1E3-2|NUCKS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7447.8	64.50678	4	1923.8629	1923.8585	K	K	162	179
PSM	ILHNDPEVEK	5447	sp|Q9UKE5-3|TNIK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7218.8	58.47873	3	1192.6123	1192.6088	K	K	1067	1077
PSM	AFAAGADIK	5448	sp|P30084|ECHM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8544.8	93.36266	2	862.4560	862.4548	K	E	93	102
PSM	QEIADIEEGR	5449	sp|P23378|GCSP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9508.8	118.9619	2	1158.5496	1158.5517	R	I	928	938
PSM	CHPQTIAVVQTR	5450	sp|P23378|GCSP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	1-UNIMOD:4	ms_run[1]:scan=1.1.8179.7	83.7595	3	1408.7236	1408.7245	R	A	225	237
PSM	VDQGAATALSR	5451	sp|Q8TBA6-2|GOGA5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7805.11	73.9959	2	1087.5654	1087.5622	R	K	18	29
PSM	LQFQQQQNSIHAAK	5452	sp|Q6PJT7-2|ZC3HE_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8741.10	98.6207	3	1639.8376	1639.8430	R	Q	232	246
PSM	LNELEAQTR	5453	sp|P41229-2|KDM5C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7996.6	78.96983	2	1072.5448	1072.5513	R	V	72	81
PSM	ELDSQLNEPR	5454	sp|P52948-2|NUP98_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8726.9	98.21465	2	1199.5734	1199.5782	K	E	1268	1278
PSM	EENIEDATEK	5455	sp|P82970|HMGN5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7599.10	68.59347	2	1176.5170	1176.5146	K	G	102	112
PSM	IPNQFQSDPPAPSDK	5456	sp|Q9NRV9|HEBP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9495.11	118.6179	2	1639.7562	1639.7842	R	S	104	119
PSM	VAEVEGEQVDNK	5457	sp|O95202|LETM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7461.10	64.88924	3	1315.6273	1315.6256	K	A	452	464
PSM	FGQVYTEAK	5458	sp|P46977-2|STT3A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8588.7	94.52036	2	1041.5110	1041.5131	R	R	555	564
PSM	TENCLSSCVDR	5459	sp|Q9Y5J9|TIM8B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	4-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.8218.8	84.7626	2	1339.5464	1339.5497	R	F	52	63
PSM	SYCENHLGSTAK	5460	sp|Q9UBD5-2|ORC3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	3-UNIMOD:4	ms_run[1]:scan=1.1.7211.7	58.28727	3	1365.6031	1365.5983	K	R	481	493
PSM	NGLSSFQAQPK	5461	sp|Q76NI1-3|KNDC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8378.9	88.96492	2	1175.5826	1175.5935	K	C	285	296
PSM	TGTSCALDCGAGIGR	5462	sp|Q9BV86-2|NTM1A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	5-UNIMOD:4,9-UNIMOD:4	ms_run[1]:scan=1.1.9497.7	118.6652	3	1494.6514	1494.6555	K	I	60	75
PSM	EDSGTFSLGK	5463	sp|O75569|PRKRA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9528.8	119.4996	2	1039.4822	1039.4822	R	M	16	26
PSM	DGANIVIAAK	5464	sp|Q6YN16-2|HSDL2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9169.5	109.9306	2	970.5448	970.5447	K	T	33	43
PSM	ATISDEEIER	5465	sp|Q9UQN3|CHM2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8789.2	99.9021	3	1161.5584	1161.5513	K	Q	196	206
PSM	EILDELQARK	5466	sp|Q9UPV0-2|CE164_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9148.8	109.3706	2	1213.6794	1213.6666	R	L	1002	1012
PSM	TAQGSLSLK	5467	sp|O15372|EIF3H_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7918.5	76.92294	2	903.5048	903.5025	K	A	157	166
PSM	ATKPQPVNTSSVTVK	5468	sp|Q8WWK9-6|CKAP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7689.7	70.98922	3	1555.8574	1555.8570	K	S	166	181
PSM	FIHDQTSPNPK	5469	sp|P53007|TXTP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7164.4	57.00802	3	1282.6327	1282.6306	K	Y	150	161
PSM	LEILSGDHEQR	5470	sp|Q4G0J3|LARP7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9174.7	110.0686	3	1295.6497	1295.6470	K	Y	521	532
PSM	IINNTENLVR	5471	sp|Q9Y617|SERC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9365.4	115.1177	3	1184.6548	1184.6513	K	E	52	62
PSM	AGPGGEAGPGGALHR	5472	sp|Q9P2Y4|ZN219_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7584.6	68.18066	3	1302.6460	1302.6429	R	C	633	648
PSM	LAIQGPEDSPSR	5473	sp|Q15773|MLF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9140.9	109.1599	2	1268.6510	1268.6361	R	Q	230	242
PSM	TIVEAASDEER	5474	sp|Q9NWY4|HPF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8208.10	84.50595	2	1218.5692	1218.5728	K	L	254	265
PSM	RFVSEAELDER	5475	sp|Q9GZU8|PIP30_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9515.6	119.1467	3	1349.6542	1349.6575	K	R	14	25
PSM	SFGGGCHVTAAVSSR	5476	sp|Q9NRA8-3|4ET_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	6-UNIMOD:4	ms_run[1]:scan=1.1.8507.8	92.38178	3	1491.6994	1491.6889	R	R	120	135
PSM	EATEAQSLEATCEK	5477	sp|Q96PC5|MIA2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	12-UNIMOD:4	ms_run[1]:scan=1.1.8605.11	94.96595	2	1565.6864	1565.6879	K	L	728	742
PSM	QQLVETHLAR	5478	sp|Q06481-2|APLP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8470.2	91.396	3	1193.6533	1193.6517	K	V	394	404
PSM	YNGEPEHIER	5479	sp|Q14739|LBR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7397.7	63.15213	3	1242.5668	1242.5629	R	N	132	142
PSM	KATVNLLGEEK	5480	sp|Q00765|REEP5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8945.11	104.0175	2	1200.6686	1200.6714	K	K	176	187
PSM	NRQEYEDIAVK	5481	sp|O15294-3|OGT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8712.6	97.83395	3	1363.6744	1363.6732	K	L	962	973
PSM	PAPPATPGAPTSPAEHR	5482	sp|Q96GE9-2|DMAC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7967.9	78.2252	3	1652.8255	1652.8271	K	L	26	43
PSM	AGCSNIAYPR	5483	sp|P53794|SC5A3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	3-UNIMOD:4	ms_run[1]:scan=1.1.8302.9	86.94141	2	1107.5212	1107.5131	R	L	344	354
PSM	KPASSSSAPQNIPK	5484	sp|Q96F86|EDC3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7099.7	55.23712	3	1410.7456	1410.7467	K	R	106	120
PSM	RQNALLEQQVR	5485	sp|P61244|MAX_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8418.7	90.00915	3	1353.7447	1353.7477	K	A	90	101
PSM	KAEEVQAWAQR	5486	sp|Q9BYN8|RT26_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8727.6	98.2366	3	1314.6676	1314.6680	R	K	142	153
PSM	SCCSCCPVGCAK	5487	sp|Q8N339|MT1M_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	2-UNIMOD:4,3-UNIMOD:4,5-UNIMOD:4,6-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.7103.8	55.34743	3	1444.5058	1444.5026	K	C	32	44
PSM	TLDAEVVEK	5488	sp|Q9H3P2|NELFA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8674.9	96.81461	2	1002.5228	1002.5233	K	P	277	286
PSM	HDELLAEHIK	5489	sp|Q68E01-3|INT3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8800.4	100.2008	3	1203.6217	1203.6248	K	S	677	687
PSM	LSASLLHSHDTETR	5490	sp|Q9HCU5|PREB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8572.3	94.10387	4	1565.7829	1565.7798	R	A	57	71
PSM	YSDVHNCSYNYK	5491	sp|Q6FIF0-2|ZFAN6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	7-UNIMOD:4	ms_run[1]:scan=1.1.7954.8	77.87382	3	1548.6292	1548.6303	R	A	163	175
PSM	TREVLIETAK	5492	sp|Q13126-2|MTAP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8010.5	79.3296	3	1158.6649	1158.6608	K	K	148	158
PSM	THSTSSSLGSGESPFSR	5493	sp|Q9UGV2-2|NDRG3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9432.8	116.915	3	1722.7828	1722.7809	R	S	317	334
PSM	VHSVAWSCDGR	5494	sp|Q96J01|THOC3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	8-UNIMOD:4	ms_run[1]:scan=1.1.8400.4	89.53962	3	1272.5677	1272.5670	K	R	58	69
PSM	TLSASAAEVAPR	5495	sp|Q16825|PTN21_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8267.5	86.00101	3	1171.6045	1171.6197	R	A	656	668
PSM	QNNYTVNNKR	5496	sp|P37088-2|SCNNA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.7444.6	64.42258	3	1249.6351	1249.6163	R	N	568	578
PSM	KNTAASLQQWK	5497	sp|Q16637-2|SMN_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.8730.5	98.31567	3	1273.6774	1273.6779	K	V	83	94
PSM	KLEDEFPGR	5498	sp|P63302|SELW_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9299.9	113.3807	2	1089.5470	1089.5455	K	L	25	34
PSM	EANSEKTNNGIHYR	5499	sp|Q9UH73-2|COE1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.9186.10	110.3927	3	1631.7640	1631.7652	K	L	98	112
PSM	DAPQDFHPDR	5500	sp|P21333|FLNA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.7766.9	72.98393	2	1197.531247	1196.521050	R	V	665	675
PSM	QEPERNECFLQHK	5501	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:28,8-UNIMOD:4	ms_run[1]:scan=1.1.9469.11	117.9183	2	1696.7583	1696.7622	K	D	118	131
PSM	YICENQDSISSK	5502	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	3-UNIMOD:4	ms_run[1]:scan=1.1.8661.11	96.46918	2	1443.617847	1442.634759	K	L	287	299
PSM	SIPLDEGEDEAQR	5503	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.9518.7	119.229	3	1457.653571	1457.663417	R	R	2384	2397
PSM	MEEESGAPGVPSGNGAPGPK	5504	sp|P52272|HNRPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.9320.11	113.9462	2	1867.820847	1866.841792	K	G	18	38
PSM	EGETVEPYK	5505	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.7630.9	69.4233	2	1049.499447	1050.486956	K	V	267	276
PSM	YHTVNGHNCEVR	5506	sp|P09651|ROA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	9-UNIMOD:4	ms_run[1]:scan=1.1.7103.4	55.34077	4	1485.647294	1484.657895	K	K	167	179
PSM	RALANSLACQGK	5507	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	9-UNIMOD:4	ms_run[1]:scan=1.1.7458.6	64.80127	3	1288.659371	1287.671754	K	Y	331	343
PSM	GDREQLLQR	5508	sp|Q04917|1433F_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1	ms_run[1]:scan=1.1.9003.10	105.5571	2	1155.5965	1155.5991	M	A	2	11
PSM	GDREQLLQR	5509	sp|Q04917|1433F_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1	ms_run[1]:scan=1.1.8984.11	105.0568	2	1155.5965	1155.5991	M	A	2	11
PSM	MEVKPPPGRPQPDSGR	5510	sp|P51991|ROA3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1	ms_run[1]:scan=1.1.8990.8	105.2093	3	1789.8962	1788.8932	-	R	1	17
PSM	MEVKPPPGRPQPDSGR	5511	sp|P51991|ROA3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1	ms_run[1]:scan=1.1.9028.9	106.2231	3	1788.8897	1788.8936	-	R	1	17
PSM	MEVKPPPGRPQPDSGR	5512	sp|P51991|ROA3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1	ms_run[1]:scan=1.1.9066.9	107.2385	3	1788.8897	1788.8936	-	R	1	17
PSM	AISSASSPQSPGDALR	5513	sp|Q96KR1|ZFR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.9125.11	108.7769	2	1543.764247	1542.763799	K	R	954	970
PSM	TLNGGSDAQDGNQPQHNGESNEDSK	5514	sp|O75475|PSIP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.6983.10	52.16948	3	2600.070071	2598.081458	K	D	477	502
PSM	CGESGHLAR	5515	sp|P62633|CNBP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.7359.8	62.13275	2	968.4151	968.4129	R	E	161	170
PSM	QRPGQQVATCVR	5516	sp|O75534|CSDE1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:28,10-UNIMOD:4	ms_run[1]:scan=1.1.8053.10	80.48628	2	1381.6875	1381.6879	K	L	497	509
PSM	SLQSVAEER	5517	sp|P61313|RL15_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.8409.8	89.77821	2	1018.510047	1017.509088	R	A	97	106
PSM	CGDSVYAAEK	5518	sp|Q16527|CSRP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.9347.8	114.6481	2	1081.4375	1081.4381	R	I	122	132
PSM	NSSYVHGGLDSNGKPADAVYGQK	5519	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.9512.9	119.0709	4	2364.108494	2363.114202	K	E	37	60
PSM	LGTPELSTAER	5520	sp|Q13085|ACACA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.9469.8	117.9133	2	1174.596847	1172.603717	R	K	2151	2162
PSM	QTYSTEPNNLK	5521	sp|P46779|RL28_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:28	ms_run[1]:scan=1.1.9252.10	112.1445	2	1276.5891	1276.5930	K	A	23	34
PSM	ANNIDYTVHSVR	5522	sp|P29144|TPP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.9068.6	107.2864	3	1388.685671	1387.684427	K	R	468	480
PSM	STSSHGTDEMESSSYR	5523	sp|Q8IWS0|PHF6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.7500.10	65.9334	3	1760.699771	1759.695522	R	D	181	197
PSM	QASEGPLK	5524	sp|P04406|G3P_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:28	ms_run[1]:scan=1.1.7940.6	77.50191	2	811.4072	811.4071	K	G	264	272
PSM	VTGPGGSPCLGSER	5525	sp|Q6ZN17|LN28B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	9-UNIMOD:4	ms_run[1]:scan=1.1.8458.11	91.08773	2	1373.640647	1372.640513	R	R	99	113
PSM	MENSQLCK	5526	sp|Q13151|ROA0_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1,7-UNIMOD:4	ms_run[1]:scan=1.1.8986.9	105.1056	2	1051.4502	1050.4472	-	L	1	9
PSM	LDAEPRPPPTQEAA	5527	sp|Q9Y285|SYFA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.8782.11	99.72877	2	1491.720847	1490.736522	R	-	495	509
PSM	QQTLEAEEAK	5528	sp|Q16643|DREB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:28	ms_run[1]:scan=1.1.8502.8	92.24903	2	1128.5282	1128.5294	K	R	239	249
PSM	TPEGLPDAPR	5529	sp|Q92673|SORL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.9092.10	107.9225	2	1052.529847	1051.529824	R	N	1646	1656
PSM	MLLHSEQHPGQLK	5530	sp|P32322|P5CR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.8206.4	84.4449	4	1517.785694	1516.782032	K	D	216	229
PSM	SEQSICQAR	5531	sp|Q8N8S7|ENAH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1,6-UNIMOD:4	ms_run[1]:scan=1.1.8095.8	81.60295	2	1120.5002	1119.4972	M	A	2	11
PSM	EGLDDQGLTK	5532	sp|Q9UKA9|PTBP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.8648.9	96.11771	2	1075.530847	1074.519319	R	D	420	430
PSM	SGEENPASKPTPVQDVQGDGR	5533	sp|Q15102|PA1B3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1	ms_run[1]:scan=1.1.9318.11	113.8938	3	2209.0181	2209.0242	M	W	2	23
PSM	RYEDQELTGK	5534	sp|Q9UIG0|BAZ1B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.7481.4	65.42153	3	1238.595971	1237.593881	K	N	579	589
PSM	AFVRPSGTEDVVR	5535	sp|O95394|AGM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.9389.6	115.7664	3	1431.747371	1431.747027	R	V	493	506
PSM	TAATLATHELR	5536	sp|Q8N1G4|LRC47_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.8324.5	87.52095	3	1183.637471	1182.635686	R	A	371	382
PSM	EFHLNESGDPSSK	5537	sp|P0DME0|SETLP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.9388.7	115.7411	3	1446.627971	1445.642287	K	S	165	178
PSM	EFHLNESGDPSSK	5538	sp|P0DME0|SETLP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.9369.6	115.2281	3	1446.627971	1445.642287	K	S	165	178
PSM	ALVHERDEAAYGELR	5539	sp|Q9UL46|PSME2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.9480.4	118.203	4	1728.858094	1727.859097	R	A	189	204
PSM	TRAEAEAAAVHGAR	5540	sp|Q5T8P6|RBM26_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20		ms_run[1]:scan=1.1.7099.7	55.23712	3	1409.7272	1408.7162	K	F	934	948
PSM	EGNGTVMGAEIR	5541	sp|P60660|MYL6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.9344.9	114.5717	2	1234.592047	1232.581936	K	H	99	111
PSM	THTITIESEGK	5542	sp|Q9P2D1|CHD7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.7625.6	69.28352	3	1217.605871	1214.614282	R	G	1495	1506
PSM	AAAAAAGEAR	5543	sp|P09417|DHPR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1	ms_run[1]:scan=1.1.7891.8	76.23196	2	899.4478	899.4456	M	R	2	12
PSM	KGGPSPGDVEAIK	5544	sp|P09661|RU2A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.8320.4	87.41268	3	1254.677771	1253.661566	K	N	193	206
PSM	GHQQLYWSHPR	5545	sp|P62273|RS29_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20		ms_run[1]:scan=1.1.8858.6	101.7427	3	1407.7012	1407.6792	M	K	2	13
PSM	ASPLFSQHTAADK	5546	sp|Q2NL82|TSR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.8529.5	92.95612	3	1372.680971	1371.678279	R	H	625	638
PSM	GAVTDDEVIRK	5547	sp|Q6I9Y2|THOC7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1	ms_run[1]:scan=1.1.9263.9	112.4285	2	1243.6361	1243.6403	M	R	2	13
PSM	CGNVYCGVHR	5548	sp|Q6FIF0|ZFAN6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:385,1-UNIMOD:4,6-UNIMOD:4	ms_run[1]:scan=1.1.9109.10	108.3606	2	1203.4869	1203.4908	R	Y	165	175
PSM	ATSLGSNTYNR	5549	sp|Q9NW64|RBM22_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1	ms_run[1]:scan=1.1.9516.9	119.1785	2	1225.5802	1224.5732	M	Q	2	13
PSM	ECVQQLAENTR	5550	sp|O15270|SPTC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	2-UNIMOD:4	ms_run[1]:scan=1.1.9196.10	110.6565	2	1347.621447	1346.624863	K	Y	437	448
PSM	ALSDADVQK	5551	sp|P36543|VATE1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1	ms_run[1]:scan=1.1.9173.7	110.0416	2	987.4898	987.4868	M	Q	2	11
PSM	AGELIGTCK	5552	sp|Q9NZJ0|DTL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	8-UNIMOD:4	ms_run[1]:scan=1.1.7808.8	74.0709	2	946.476647	947.474617	K	G	129	138
PSM	YHTVNGHNCEVR	5553	sp|P09651|ROA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	9-UNIMOD:4	ms_run[1]:scan=1.1.7122.4	55.86025	4	1486.648894	1484.657895	K	K	167	179
PSM	PGGGPGLSTPGGHPKPPHR	5554	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.7470.11	65.1352	3	1800.921071	1801.933599	K	G	218	237
PSM	TVSTLHHVLQR	5555	sp|O00764|PDXK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.7979.2	78.52813	4	1288.723294	1289.720418	K	T	259	270
PSM	ASREEILAQAK	5556	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.7979.6	78.5348	3	1216.668071	1214.661900	R	E	1659	1670
PSM	CVVVGDGAVGK	5557	sp|P60953|CDC42_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	1-UNIMOD:4	ms_run[1]:scan=1.1.8090.9	81.47269	2	1060.533447	1059.538280	K	T	6	17
PSM	ISAVSVAER	5558	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.8315.7	87.28416	2	931.511847	930.513445	R	V	448	457
PSM	TDRPLPENPYHSR	5559	sp|P51970|NDUA8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.8324.6	87.52261	4	1581.775694	1580.769554	K	P	133	146
PSM	PASGPIRPIVR	5560	sp|P26373|RL13_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.8337.4	87.86562	3	1161.699671	1161.698226	R	C	50	61
PSM	PSGLLAQER	5561	sp|Q9Y2W1|TR150_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.8407.7	89.7252	2	969.523847	969.524344	R	K	583	592
PSM	HVVFIAQR	5562	sp|P62081|RS7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.8469.8	91.379	2	969.558447	968.555585	K	R	91	99
PSM	NSALSAQLR	5563	sp|P47897|SYQ_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.8489.7	91.90735	2	959.519447	958.519593	K	E	26	35
PSM	ALAAAGYDVEKNNSR	5564	sp|Q02539|H11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.8529.9	92.96278	3	1576.799471	1577.779784	K	I	68	83
PSM	IFEPPPPK	5565	sp|O43143|DHX15_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.8699.6	97.48445	2	924.515447	923.511654	R	K	400	408
PSM	AETEEGPDVLR	5566	sp|Q15436|SC23A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.9023.9	106.0892	2	1214.600247	1214.577896	R	W	534	545
PSM	NNASTDYDLSDK	5567	sp|P39023|RL3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.9047.8	106.7292	2	1342.548247	1341.568454	K	S	301	313
PSM	KVTQLDLDGPK	5568	sp|Q13442|HAP28_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.9053.3	106.8811	3	1211.675771	1212.671403	K	E	95	106
PSM	TVSPALISR	5569	sp|Q86VP6|CAND1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.9257.5	112.2661	2	943.552047	942.549831	K	F	374	383
PSM	VIGSELVQK	5570	sp|P35998|PRS7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.9280.8	112.871	2	972.563847	971.565147	R	Y	240	249
PSM	LNGGLGTSMGCK	5571	sp|Q16851|UGPA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	11-UNIMOD:4	ms_run[1]:scan=1.1.9285.10	113.0063	2	1194.534847	1193.553278	K	G	113	125
PSM	KLNTETFGVSGR	5572	sp|Q9BX40|LS14B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.9302.3	113.4518	3	1306.677971	1307.683364	R	F	340	352
PSM	ATPSENLVPSSAR	5573	sp|Q8N684|CPSF7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.9333.11	114.2866	2	1326.649647	1327.673193	R	V	202	215
PSM	VDVGKDQEFTVK	5574	sp|P21333|FLNA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.9440.4	117.124	3	1366.701671	1363.698346	K	S	983	995
PSM	PGFSIADK	5575	sp|P62913|RL11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.9480.3	118.2014	2	833.431247	833.428319	R	K	137	145
PSM	RPLEDGDQPDAKK	5576	sp|Q96AE4-2|FUBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.6824.4	47.8937	4	1467.7373	1467.7317	K	V	65	78
PSM	DREVNAVDSEHEK	5577	sp|P14735|IDE_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.6903.4	49.99615	4	1526.7021	1526.6961	K	N	180	193
PSM	APGTPHSHTKPYVR	5578	sp|Q07020-2|RL18_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.6923.7	50.54913	4	1546.8069	1546.8005	K	S	126	140
PSM	KVSYSHIQSK	5579	sp|P27816-6|MAP4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.6902.5	49.97095	3	1175.6335	1175.6299	K	C	998	1008
PSM	FGGPVHHQAQR	5580	sp|Q15717-2|ELAV1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.6867.5	49.06078	3	1232.6197	1232.6163	R	F	234	245
PSM	KATPGAHTGAIPK	5581	sp|Q7L311|ARMX2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.6867.7	49.06412	3	1247.6992	1247.6986	K	A	258	271
PSM	HGRPGIGATHSSR	5582	sp|P62841|RS15_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.6704.6	44.63413	3	1331.6821	1331.6807	K	F	128	141
PSM	RAAEEEDEADPK	5583	sp|P20962|PTMS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.6698.7	44.47273	3	1358.5978	1358.5950	K	R	81	93
PSM	TEVHIRPK	5584	sp|P28838-2|AMPL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.6871.10	49.17788	2	978.5626	978.5611	K	S	199	207
PSM	RGAPAAATAPAPTAHK	5585	sp|Q92522|H1X_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.6863.8	48.9567	3	1486.8049	1486.8004	R	A	128	144
PSM	KPFSQHVR	5586	sp|Q02878|RL6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.6850.8	48.60152	2	997.5490	997.5457	K	K	131	139
PSM	YTQVGPDHNR	5587	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.6939.10	50.99288	2	1185.5550	1185.5527	K	S	200	210
PSM	IVTDRETGSSK	5588	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.6703.8	44.6135	2	1191.6108	1191.6095	R	G	600	611
PSM	CAGGHDDATLAR	5589	sp|P49916-3|DNLI3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	1-UNIMOD:4	ms_run[1]:scan=1.1.6952.5	51.33712	3	1242.5497	1242.5411	K	L	642	654
PSM	AQPAQPADEPAEK	5590	sp|P25786-2|PSA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.6941.10	51.04738	2	1350.6444	1350.6415	K	A	250	263
PSM	RQLEDGDQPESK	5591	sp|Q92945|FUBP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.6851.8	48.6289	3	1400.6575	1400.6532	K	K	110	122
PSM	VHGPGIQSGTTNKPNK	5592	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.6890.5	49.68167	4	1633.8569	1633.8536	R	F	1360	1376
PSM	VQQSSESSTSSPSQHEATPGAR	5593	sp|O75152|ZC11A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.6911.11	50.22637	3	2257.0222	2257.0207	R	R	485	507
PSM	KLEEVVNK	5594	sp|Q8WU90|ZC3HF_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7139.2	56.32107	3	957.5479	957.5495	K	K	157	165
PSM	HQPTAIIAK	5595	sp|P29401-2|TKT_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7224.3	58.62895	3	977.5690	977.5658	K	T	241	250
PSM	RDHALLEEQSK	5596	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7220.2	58.52252	4	1324.6797	1324.6735	K	Q	633	644
PSM	KFEEETVK	5597	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7193.2	57.79463	3	1008.5200	1008.5128	R	S	275	283
PSM	GEGQLGPAER	5598	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7345.2	61.7453	3	1012.4974	1012.4938	K	A	240	250
PSM	VYTDVNTHRPR	5599	sp|Q8NEV1|CSK23_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7180.2	57.44085	4	1356.6941	1356.6898	R	E	11	22
PSM	KLQEQLEK	5600	sp|Q9P2E9|RRBP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7188.4	57.66195	3	1014.5680	1014.5709	K	A	1390	1398
PSM	RLTDADAMK	5601	sp|P25705-3|ATPA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7317.5	61.01667	3	1019.5102	1019.5070	K	Y	240	249
PSM	QRVEQFAR	5602	sp|P34897-2|GLYM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7354.3	61.99008	3	1032.5503	1032.5465	R	A	477	485
PSM	KFVETPGQK	5603	sp|P05455|LA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7244.2	59.13867	3	1032.5638	1032.5604	K	Y	166	175
PSM	THVDSHGHNVFK	5604	sp|P49736|MCM2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7087.5	54.91751	4	1376.6653	1376.6586	R	E	205	217
PSM	SVHICHVAR	5605	sp|P27708|PYR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	5-UNIMOD:4	ms_run[1]:scan=1.1.7064.2	54.29168	3	1077.5509	1077.5502	R	K	1609	1618
PSM	DRVHHEPQLSDK	5606	sp|O43852-2|CALU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.6971.5	51.8435	4	1459.7225	1459.7168	K	V	26	38
PSM	IDDIVSGHKK	5607	sp|P49368|TCPG_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7132.3	56.13305	3	1110.6073	1110.6033	R	K	519	529
PSM	AYSEAHEISK	5608	sp|P61981|1433G_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7093.2	55.06967	3	1133.5408	1133.5353	K	E	153	163
PSM	LGIHEDSQNR	5609	sp|P07900-2|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7200.5	57.9911	3	1167.5851	1167.5632	K	K	569	579
PSM	KTQDQISNIK	5610	sp|Q14847-2|LASP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7218.7	58.47707	3	1173.6259	1173.6353	K	Y	112	122
PSM	TVSLGAGAK	5611	sp|P06748|NPM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7343.6	61.6978	2	802.4576	802.4549	R	D	46	55
PSM	KGQAVDYEGSR	5612	sp|P13667|PDIA4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7073.4	54.54023	3	1208.5834	1208.5786	K	T	145	156
PSM	DRDYSDHPSGGSYR	5613	sp|P38159-2|RBMX_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7274.4	59.91698	4	1610.6745	1610.6710	R	D	256	270
PSM	VQNIHPVESAK	5614	sp|P80303-2|NUCB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7169.5	57.14555	3	1220.6560	1220.6513	K	I	34	45
PSM	RSTCTINYSK	5615	sp|P49419-2|AL7A1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	4-UNIMOD:4	ms_run[1]:scan=1.1.7154.5	56.73713	3	1228.5904	1228.5870	R	D	491	501
PSM	RNEIDAEPPAK	5616	sp|Q8TDN6|BRX1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7262.7	59.61535	3	1238.6293	1238.6255	K	R	21	32
PSM	YSHVQEVQER	5617	sp|Q93008-1|USP9X_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7119.5	55.77991	3	1273.6024	1273.6051	R	L	648	658
PSM	APPHELTEEEK	5618	sp|Q13409-2|DC1I2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7354.7	61.99675	3	1278.6118	1278.6092	K	Q	197	208
PSM	LSSAMSAAK	5619	sp|P40925-3|MDHC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7119.6	55.78158	2	864.4394	864.4375	K	A	258	267
PSM	ASPNVEAPQPHR	5620	sp|P50851|LRBA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7330.4	61.36185	3	1301.6482	1301.6476	K	H	1260	1272
PSM	SNHPEDLQAANR	5621	sp|Q9UJY4|GGA2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7113.8	55.62078	3	1350.6364	1350.6276	K	L	201	213
PSM	NVTLCGHLHHGK	5622	sp|Q15029-2|U5S1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	5-UNIMOD:4	ms_run[1]:scan=1.1.7259.8	59.53875	3	1371.6832	1371.6830	R	T	96	108
PSM	IIIENKPK	5623	sp|P11388|TOP2A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.7249.9	59.2794	2	953.593647	953.590967	K	K	1063	1071
PSM	IHQETFGK	5624	sp|Q15393|SF3B3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7161.7	56.93139	2	958.4876	958.4872	K	S	102	110
PSM	LLEEEDSK	5625	sp|Q96CT7|CC124_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7318.10	61.05188	2	961.4578	961.4604	R	L	73	81
PSM	TIAPQNAPR	5626	sp|Q9NYF8-2|BCLF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7181.8	57.47813	2	966.5264	966.5247	K	D	302	311
PSM	HYASEEIK	5627	sp|Q01082-2|SPTB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7057.8	54.10921	2	975.4686	975.4661	K	E	1982	1990
PSM	QITASSSYK	5628	sp|Q08431-2|MFGM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7246.7	59.19837	2	983.4922	983.4924	K	T	133	142
PSM	MEEETEVRESEK	5629	sp|Q9H307|PININ_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7314.8	60.943	3	1494.6502	1494.6508	K	Q	366	378
PSM	LHTLEEEK	5630	sp|Q9UQE7|SMC3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7190.4	57.71623	3	997.5136	997.5080	R	E	200	208
PSM	EDAANNYAR	5631	sp|Q9BQE3|TBA1C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.6973.6	51.89835	2	1022.4434	1022.4417	K	G	97	106
PSM	VQRPPSAASAAPSSSK	5632	sp|Q5SRE5|NU188_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7025.9	53.23555	3	1539.8032	1539.8005	R	Q	1518	1534
PSM	TSEVNCYR	5633	sp|P62633-2|CNBP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	6-UNIMOD:4	ms_run[1]:scan=1.1.7200.10	57.99943	2	1027.4414	1027.4393	K	C	146	154
PSM	KYPDYESK	5634	sp|Q9Y4L1|HYOU1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7294.5	60.43732	2	1028.4872	1028.4814	K	G	530	538
PSM	RVEEELEK	5635	sp|Q9NWB6|ARGL1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.7146.9	56.5244	2	1030.530647	1030.529489	K	R	141	149
PSM	TVGVEPAADGK	5636	sp|P46779|RL28_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7231.8	58.81873	2	1042.5302	1042.5295	K	G	48	59
PSM	ESRYEEEEEQSR	5637	sp|Q9Y5B9|SP16H_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7214.7	58.36827	3	1569.6580	1569.6543	R	S	1003	1015
PSM	CRPLEENTADNEK	5638	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	1-UNIMOD:4	ms_run[1]:scan=1.1.7077.9	54.65745	3	1574.7031	1574.6994	K	E	2696	2709
PSM	SEHPPLCGR	5639	sp|Q15393|SF3B3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	7-UNIMOD:4	ms_run[1]:scan=1.1.7115.2	55.66543	3	1051.4908	1051.4869	R	D	1150	1159
PSM	KTESFQNAQAGSNPK	5640	sp|Q92667|AKAP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7097.9	55.18678	3	1605.7756	1605.7747	K	K	589	604
PSM	NTCTSVYTK	5641	sp|P78527|PRKDC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	3-UNIMOD:4	ms_run[1]:scan=1.1.7166.9	57.07078	2	1072.4872	1072.4859	K	D	109	118
PSM	IREEYPDR	5642	sp|Q9BVA1|TBB2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7247.3	59.21743	3	1076.5294	1076.5250	K	I	155	163
PSM	GEEGHDPKEPEQLR	5643	sp|P51991|ROA3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7323.10	61.1859	3	1619.7598	1619.7539	R	K	22	36
PSM	TTECSNTFK	5644	sp|Q2TAY7|SMU1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	4-UNIMOD:4	ms_run[1]:scan=1.1.7100.10	55.26917	2	1086.4684	1086.4652	K	S	380	389
PSM	HLTGEFEKK	5645	sp|P62826|RAN_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7147.5	56.5452	3	1087.5676	1087.5662	R	Y	30	39
PSM	ELTDEEAER	5646	sp|Q9Y266|NUDC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7344.10	61.73158	2	1090.4824	1090.4778	K	L	106	115
PSM	IINADSEDPK	5647	sp|P35998|PRS7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7337.11	61.5461	2	1100.5366	1100.5349	K	Y	101	111
PSM	IHVIDHSGAR	5648	sp|Q99426-2|TBCB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7037.9	53.56368	2	1103.5850	1103.5836	R	L	34	44
PSM	RHLTGEFEK	5649	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7298.3	60.53197	3	1115.5711	1115.5723	K	K	29	38
PSM	RFDAQTGADR	5650	sp|P43686|PRS6B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7071.9	54.4946	2	1135.5376	1135.5370	K	E	274	284
PSM	LGIHEDSTNR	5651	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7215.11	58.40207	2	1140.5534	1140.5523	K	R	439	449
PSM	FQGPDNGQGPK	5652	sp|O43396|TXNL1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7290.5	60.33915	2	1143.5360	1143.5309	K	Y	182	193
PSM	RYDDPEVQK	5653	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7137.5	56.27215	3	1148.5510	1148.5462	R	D	127	136
PSM	RYDDPEVQK	5654	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7118.9	55.75907	2	1148.5466	1148.5462	R	D	127	136
PSM	YHAEEVEER	5655	sp|Q6NZY4|ZCHC8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7140.9	56.3599	2	1160.5186	1160.5098	R	F	274	283
PSM	KPITDDDVDR	5656	sp|P53618|COPB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7152.11	56.6923	2	1172.5698	1172.5673	K	I	603	613
PSM	GTVQALHATGAR	5657	sp|Q7Z4W1|DCXR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7345.11	61.7603	2	1180.6316	1180.6313	R	V	22	34
PSM	NSHAPPAETIR	5658	sp|Q86V48|LUZP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7136.4	56.24365	3	1191.5968	1191.5996	R	W	890	901
PSM	FTQQNYHDR	5659	sp|Q9BZE4|NOG1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7044.5	53.74915	3	1207.5391	1207.5370	K	L	53	62
PSM	VQYPQSQACK	5660	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	9-UNIMOD:4	ms_run[1]:scan=1.1.7260.9	59.56647	2	1207.5646	1207.5656	K	M	625	635
PSM	EAHAQSIGMNR	5661	sp|P25205|MCM3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7220.11	58.53752	2	1212.5670	1212.5669	R	L	757	768
PSM	NTDVAQSPEAPK	5662	sp|Q9P2E9|RRBP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7234.8	58.89405	2	1255.6084	1255.6044	R	Q	609	621
PSM	RQVLIRPCSK	5663	sp|P62244|RS15A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	8-UNIMOD:4	ms_run[1]:scan=1.1.7299.3	60.55728	3	1255.7194	1255.7183	K	V	23	33
PSM	ESHTAVVYTEK	5664	sp|P51610-2|HCFC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7324.7	61.20715	3	1262.6185	1262.6143	R	D	201	212
PSM	QTTQDAPEEVR	5665	sp|Q9P013|CWC15_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7217.11	58.45653	2	1272.5952	1272.5946	R	N	45	56
PSM	IIHGSGYSDEDK	5666	sp|P50148|GNAQ_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7119.7	55.78325	3	1319.5981	1319.5993	R	R	61	73
PSM	VDESGPPAPSKPR	5667	sp|Q29RF7|PDS5A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7060.8	54.19147	3	1335.6823	1335.6783	K	R	1257	1270
PSM	MEADPDGQQPEK	5668	sp|Q92922|SMRC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7102.11	55.32525	2	1343.5696	1343.5663	K	A	781	793
PSM	ETPAATEAPSSTPK	5669	sp|P80723|BASP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7203.11	58.08293	2	1385.6666	1385.6674	K	A	185	199
PSM	CPVCSQECAER	5670	sp|O15164-2|TIF1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	1-UNIMOD:4,4-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.7046.11	53.81403	2	1394.5390	1394.5377	R	H	127	138
PSM	TYHYHCGVQDK	5671	sp|Q8IWS0-3|PHF6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	6-UNIMOD:4	ms_run[1]:scan=1.1.7139.11	56.33607	2	1406.6072	1406.6037	K	A	299	310
PSM	LEVQATDREENK	5672	sp|P11387|TOP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7229.8	58.76743	2	1430.7030	1430.7001	K	Q	701	713
PSM	EETVNDPEEAGHR	5673	sp|O00567|NOP56_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7130.11	56.09142	2	1481.6394	1481.6382	K	S	541	554
PSM	TTASEPVEQSEATSK	5674	sp|Q15007|FL2D_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7171.11	57.21008	2	1563.7296	1563.7264	R	D	254	269
PSM	RLASSVLR	5675	sp|P84098|RL19_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7618.2	69.08791	3	900.5461	900.5505	K	C	9	17
PSM	IGKPAPDFK	5676	sp|P32119|PRDX2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7660.3	70.222	3	971.5489	971.5440	R	A	8	17
PSM	RLQEALER	5677	sp|Q05682-4|CALD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7550.3	67.25903	3	1013.5636	1013.5618	K	Q	110	118
PSM	RPFDPNDR	5678	sp|Q16629-4|SRSF7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7385.5	62.82442	3	1015.4842	1015.4835	R	C	98	106
PSM	IQESHPELR	5679	sp|Q9H9B4|SFXN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7360.3	62.15117	3	1107.5713	1107.5672	K	R	306	315
PSM	HRDLTALCK	5680	sp|O60341-2|KDM1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	8-UNIMOD:4	ms_run[1]:scan=1.1.7496.3	65.81602	3	1112.5783	1112.5760	K	E	508	517
PSM	GAVIVVSHDAR	5681	sp|Q8NE71-2|ABCF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7643.4	69.76521	3	1122.6145	1122.6146	K	L	752	763
PSM	KGESGQSWPR	5682	sp|Q15185-3|TEBP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7478.3	65.33863	3	1130.5504	1130.5469	R	L	79	89
PSM	AGIIASAR	5683	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7554.4	67.3682	2	757.4474	757.4446	K	A	43	51
PSM	EHELLEQQK	5684	sp|Q13435|SF3B2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7416.4	63.66096	3	1152.5797	1152.5775	K	R	174	183
PSM	LTQDQDVDVK	5685	sp|P30153|2AAA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7472.2	65.17432	3	1159.5739	1159.5721	K	Y	567	577
PSM	VYEGERPLTK	5686	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7513.7	66.2722	3	1190.6332	1190.6295	K	D	465	475
PSM	ALQASALK	5687	sp|P04075-2|ALDOA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7686.5	70.90562	2	800.4772	800.4756	R	A	359	367
PSM	SAVLISSK	5688	sp|P40939|ECHA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7625.5	69.28185	2	803.4750	803.4752	R	P	87	95
PSM	DKLDETGNSLK	5689	sp|P11388-4|TOP2A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7601.5	68.63928	3	1218.6136	1218.6092	K	V	277	288
PSM	NHEAQIQDMR	5690	sp|P35580-3|MYH10_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7597.3	68.52758	3	1240.5652	1240.5618	K	Q	1210	1220
PSM	AAVPDAVGK	5691	sp|P05023-4|AT1A1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7412.8	63.55945	2	826.4570	826.4549	R	C	597	606
PSM	THEAQIQEMR	5692	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7504.4	66.02917	3	1241.5834	1241.5822	K	Q	1182	1192
PSM	RTLLVNCQNK	5693	sp|Q8TC07-2|TBC15_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	7-UNIMOD:4	ms_run[1]:scan=1.1.7514.7	66.29902	3	1244.6554	1244.6659	K	S	191	201
PSM	HVTSEQEWDK	5694	sp|P37268-3|FDFT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7552.8	67.3212	3	1257.5680	1257.5626	K	Y	76	86
PSM	YGIQADAK	5695	sp|Q96AC1-2|FERM2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7569.6	67.77578	2	864.4348	864.4341	K	L	82	90
PSM	RELHGQNPVVTPCNK	5696	sp|Q16630-2|CPSF6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	13-UNIMOD:4	ms_run[1]:scan=1.1.7365.5	62.28835	4	1747.8821	1747.8788	K	Q	147	162
PSM	TVTAAGAENIQQK	5697	sp|Q29RF7|PDS5A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7649.5	69.92841	3	1329.6832	1329.6888	R	T	1240	1253
PSM	GGSRGEEVGELSR	5698	sp|P09543|CN37_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7550.7	67.2657	3	1331.6497	1331.6429	K	G	357	370
PSM	SGYLSSER	5699	sp|P15311|EZRI_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7574.8	67.91376	2	897.4202	897.4192	K	L	144	152
PSM	SVQTFADK	5700	sp|P47756-2|CAPZB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7564.6	67.64105	2	894.4452	894.4447	R	S	245	253
PSM	ADYEIASK	5701	sp|Q9Y383-3|LC7L2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7708.5	71.49537	2	895.4292	895.4287	R	E	66	74
PSM	PGGGPGLSTPGGHPKPPHR	5702	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7482.6	65.45195	4	1801.9369	1801.9336	K	G	218	237
PSM	VISSIEQK	5703	sp|Q04917|1433F_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7440.8	64.3178	2	902.5092	902.5073	R	T	62	70
PSM	LQAGEETASHYR	5704	sp|Q9UBB6-2|NCDN_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7532.5	66.77837	3	1360.6423	1360.6371	R	M	690	702
PSM	ILTGTDAPK	5705	sp|P51532-2|SMCA4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7494.7	65.7698	2	914.5084	914.5073	K	A	627	636
PSM	TGLEDPER	5706	sp|P35580-3|MYH10_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7543.6	67.07578	2	915.4322	915.4298	R	Y	5	13
PSM	YTSQIVGR	5707	sp|Q9UNS2-2|CSN3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7708.8	71.50037	2	922.4872	922.4872	K	F	224	232
PSM	GKFEDMAK	5708	sp|P09429|HMGB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7546.3	67.15138	3	924.4405	924.4375	K	A	58	66
PSM	VAASPEDIK	5709	sp|Q92552-2|RT27_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7587.9	68.26672	2	928.4884	928.4865	K	L	280	289
PSM	HSQYHVDGSLEK	5710	sp|Q96HS1|PGAM5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7554.10	67.3782	3	1398.6517	1398.6528	R	D	105	117
PSM	SAVEDEGLK	5711	sp|P0DMV8-2|HS71A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7462.7	64.91142	2	946.4622	946.4607	K	G	496	505
PSM	GGQSGLNLSK	5712	sp|Q9NRZ9-2|HELLS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7668.7	70.4394	2	959.5176	959.5036	K	N	738	748
PSM	AFREEAIK	5713	sp|P13010|XRCC5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7573.2	67.87677	3	962.5225	962.5185	R	F	641	649
PSM	ALAAPAAEEK	5714	sp|Q01650|LAT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7373.9	62.50733	2	969.5148	969.5131	R	E	10	20
PSM	AQCPIVER	5715	sp|P46782|RS5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	3-UNIMOD:4	ms_run[1]:scan=1.1.7513.9	66.27554	2	971.4880	971.4858	K	L	64	72
PSM	AQCPIVER	5716	sp|P46782|RS5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	3-UNIMOD:4	ms_run[1]:scan=1.1.7532.7	66.7817	2	971.4880	971.4858	K	L	64	72
PSM	DCYPAVQK	5717	sp|Q14974|IMB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	2-UNIMOD:4	ms_run[1]:scan=1.1.7583.7	68.15532	2	979.4430	979.4433	K	T	542	550
PSM	EPSEVPTPK	5718	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7575.8	67.94085	2	982.4988	982.4971	K	R	47	56
PSM	EPSEVPTPK	5719	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7556.8	67.42882	2	982.4988	982.4971	K	R	47	56
PSM	FEESMSEK	5720	sp|Q92896|GSLG1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7585.9	68.2127	2	985.4094	985.4062	K	C	343	351
PSM	AAASTDYYK	5721	sp|P08559-2|ODPA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7468.8	65.07581	2	988.4516	988.4502	R	R	243	252
PSM	VSSDVIDQK	5722	sp|Q9Y262|EIF3L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7543.9	67.08078	2	989.5042	989.5029	R	V	79	88
PSM	QIDNPDYK	5723	sp|P27797|CALR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7398.8	63.18052	2	991.4622	991.4611	R	G	279	287
PSM	ALIHSACVK	5724	sp|Q08257|QOR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	7-UNIMOD:4	ms_run[1]:scan=1.1.7456.9	64.75211	2	997.5394	997.5379	R	A	139	148
PSM	VLEAAAQAAR	5725	sp|Q9NPD3|EXOS4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7637.9	69.61203	2	998.5532	998.5509	R	D	213	223
PSM	HVEEFSPR	5726	sp|Q14566|MCM6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7533.10	66.81367	2	999.4792	999.4774	K	A	408	416
PSM	ADDKETCFAEEGK	5727	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	7-UNIMOD:4	ms_run[1]:scan=1.1.7662.10	70.2872	3	1498.6261	1498.6246	K	K	585	598
PSM	QLNAIESTK	5728	sp|Q92576-2|PHF3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7676.7	70.64719	2	1002.5334	1002.5345	K	I	362	371
PSM	ASLCISTKK	5729	sp|P09874|PARP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	4-UNIMOD:4	ms_run[1]:scan=1.1.7450.6	64.58466	3	1006.5517	1006.5481	K	E	426	435
PSM	VPGLQNEQK	5730	sp|Q8WWM7|ATX2L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7549.10	67.2438	2	1011.5356	1011.5349	K	R	530	539
PSM	LSVAAQEAAR	5731	sp|Q15149|PLEC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7675.7	70.6212	2	1014.5456	1014.5458	R	L	2420	2430
PSM	FINNNAVTK	5732	sp|Q13616|CUL1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7589.9	68.32069	2	1019.5408	1019.5400	R	M	402	411
PSM	VSSQFDPNK	5733	sp|Q01780|EXOSX_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7551.9	67.29587	2	1020.4934	1020.4876	K	Q	836	845
PSM	VAAGTLDASTK	5734	sp|Q15003|CND2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7384.8	62.8025	2	1032.5436	1032.5451	K	I	153	164
PSM	LQELEQQREEQK	5735	sp|Q02040|AK17A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7418.7	63.72023	3	1556.7817	1556.7794	K	R	278	290
PSM	IYVSANSGAR	5736	sp|Q13085-2|ACACA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7531.10	66.75986	2	1036.5328	1036.5301	R	I	1656	1666
PSM	SVTTEPSSLK	5737	sp|Q6PJT7-2|ZC3HE_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7603.9	68.69902	2	1047.5460	1047.5448	R	S	75	85
PSM	GAAAAAVMSSSK	5738	sp|Q9H0E3|SP130_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.7466.10	65.0248	2	1049.515047	1049.517544	R	V	233	245
PSM	TAYGPNGMNK	5739	sp|P50990-2|TCPQ_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7478.8	65.34697	2	1051.4822	1051.4757	R	M	26	36
PSM	EGETVEPYK	5740	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7649.9	69.93508	2	1050.4830	1050.4869	K	V	267	276
PSM	TPGPGAQSALR	5741	sp|P62263|RS14_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7623.10	69.23621	2	1053.5576	1053.5567	K	A	107	118
PSM	IAPPETPDSK	5742	sp|Q9NZI8|IF2B1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7690.9	71.01955	2	1053.5356	1053.5342	K	V	441	451
PSM	RLEQLGAQR	5743	sp|P16435|NCPR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7417.10	63.69803	2	1069.5986	1069.5992	K	I	191	200
PSM	LAGESESNLR	5744	sp|P55072|TERA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7523.8	66.5415	2	1074.5320	1074.5305	K	K	278	288
PSM	KGGYTSGTFR	5745	sp|P25205|MCM3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7503.3	66.0012	3	1072.5319	1072.5302	K	T	248	258
PSM	IQEAGTEVVK	5746	sp|P40926|MDHM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7569.9	67.78078	2	1072.5770	1072.5764	R	A	230	240
PSM	GICECGVCK	5747	sp|P05556|ITB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	3-UNIMOD:4,5-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.7452.10	64.64553	2	1081.4358	1081.4355	R	C	611	620
PSM	YLATCADDR	5748	sp|Q9Y4P3|TBL2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	5-UNIMOD:4	ms_run[1]:scan=1.1.7477.9	65.32163	2	1083.4664	1083.4655	K	T	104	113
PSM	VAQPTITDNK	5749	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7462.10	64.91642	2	1085.5742	1085.5717	K	D	1807	1817
PSM	ASYDDPYKK	5750	sp|Q96PK6|RBM14_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7425.9	63.91345	2	1085.5066	1085.5029	R	A	586	595
PSM	ADILEDKDGK	5751	sp|P52272-2|HNRPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7553.8	67.34792	2	1102.5520	1102.5506	R	S	194	204
PSM	SQESGYYDR	5752	sp|P43243|MATR3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7415.10	63.6439	2	1103.4542	1103.4519	R	M	208	217
PSM	STAPAVAYDSK	5753	sp|Q96KR1|ZFR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7639.10	69.66752	2	1108.5404	1108.5400	R	Q	148	159
PSM	GQDWEQTQK	5754	sp|Q86X76-4|NIT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7545.9	67.13454	2	1118.5014	1118.4993	R	I	118	127
PSM	VTDAPTYTTR	5755	sp|Q9NXV6|CARF_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7621.9	69.1805	2	1123.5554	1123.5510	K	D	109	119
PSM	SITNTTVCTK	5756	sp|Q15637-3|SF01_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	8-UNIMOD:4	ms_run[1]:scan=1.1.7390.10	62.9679	2	1123.5562	1123.5543	R	C	272	282
PSM	IYSNNQYAR	5757	sp|Q08AM6|VAC14_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7506.8	66.08828	2	1127.5364	1127.5359	R	Q	184	193
PSM	EWSQHINGASHSR	5758	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7559.4	67.50308	4	1507.6993	1507.6916	K	R	305	318
PSM	SESPSLTQER	5759	sp|Q9BXW9-1|FACD2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7518.11	66.41278	2	1132.5352	1132.5360	R	A	590	600
PSM	MDETDASSAVK	5760	sp|Q13148|TADBP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7484.10	65.51266	2	1152.5006	1152.4969	K	V	85	96
PSM	AQGPQQQPGSEGPSYAK	5761	sp|Q3ZCQ8|TIM50_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7508.10	66.14429	3	1728.8173	1728.8067	K	K	48	65
PSM	GGLSDGEGPPGGR	5762	sp|Q7L0J3-2|SV2A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7520.11	66.4663	2	1154.5366	1154.5316	R	G	124	137
PSM	SHEGETAYIR	5763	sp|Q07955|SRSF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7488.8	65.61475	3	1161.5443	1161.5414	R	V	182	192
PSM	IAEVDCTAER	5764	sp|Q8NBS9|TXND5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	6-UNIMOD:4	ms_run[1]:scan=1.1.7553.11	67.35291	2	1162.5294	1162.5288	K	N	376	386
PSM	ESNCYDPER	5765	sp|Q00610-2|CLH1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	4-UNIMOD:4	ms_run[1]:scan=1.1.7364.9	62.26838	2	1168.4464	1168.4455	R	V	750	759
PSM	SHEGETSYIR	5766	sp|Q13242|SRSF9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7406.9	63.3988	2	1177.5364	1177.5363	R	V	172	182
PSM	IYGESADAVKK	5767	sp|P51114|FXR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7400.9	63.23622	2	1179.6152	1179.6135	R	A	264	275
PSM	CCSFDGDADR	5768	sp|O95394-3|AGM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	1-UNIMOD:4,2-UNIMOD:4	ms_run[1]:scan=1.1.7583.11	68.16198	2	1201.4156	1201.4128	R	I	272	282
PSM	ELEAASAPEER	5769	sp|O43432-3|IF4G3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7689.11	70.99588	2	1200.5630	1200.5622	K	T	867	878
PSM	QTEEQVNDLK	5770	sp|P12270|TPR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7555.11	67.40694	2	1202.5792	1202.5779	R	E	943	953
PSM	SNDDLDVSESK	5771	sp|Q96EB6|SIR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7632.10	69.47895	2	1207.5234	1207.5204	K	G	562	573
PSM	NSIVNSQPPEK	5772	sp|Q9UIA9|XPO7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7548.10	67.21695	2	1211.6156	1211.6146	R	Q	1021	1032
PSM	VAFERGEEPGK	5773	sp|Q08211|DHX9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7616.10	69.04732	2	1217.6046	1217.6040	R	S	457	468
PSM	EHVGTDQFGNK	5774	sp|Q8N183|NDUF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7434.10	64.15832	2	1230.5638	1230.5629	K	Y	21	32
PSM	CREMDEQIR	5775	sp|P06753-2|TPM3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	1-UNIMOD:4	ms_run[1]:scan=1.1.7441.11	64.34985	2	1235.5414	1235.5387	R	L	154	163
PSM	ERANGMELDGR	5776	sp|P62995-3|TRA2B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7669.4	70.46052	3	1246.5808	1246.5724	K	R	77	88
PSM	LCVQNSPQEAR	5777	sp|P33240-2|CSTF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	2-UNIMOD:4	ms_run[1]:scan=1.1.7558.10	67.48602	2	1300.6194	1300.6194	K	N	149	160
PSM	GPQNATDSYVHK	5778	sp|O43660-2|PLRG1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7361.7	62.18472	3	1315.6024	1315.6157	K	Q	69	81
PSM	NVLCSACSGQGGK	5779	sp|O60884|DNJA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	4-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=1.1.7581.11	68.10796	2	1336.5864	1336.5864	K	S	140	153
PSM	ETVEEQASTTER	5780	sp|Q13620-1|CUL4B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7529.9	66.70435	2	1378.6226	1378.6212	K	V	812	824
PSM	SLGHGLINK	5781	sp|Q8NI36|WDR36_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7967.2	78.21353	3	937.5376	937.5345	K	K	417	426
PSM	RVLIAAHGNSLR	5782	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7864.4	75.51193	4	1305.7677	1305.7629	K	G	180	192
PSM	VTVLGHVQR	5783	sp|P17858-2|PFKAL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7959.2	77.99866	3	1007.5885	1007.5876	R	G	340	349
PSM	KLPEYNPR	5784	sp|Q9P258|RCC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7960.5	78.0306	3	1015.5460	1015.5450	K	T	513	521
PSM	KLPEYNPR	5785	sp|Q9P258|RCC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7936.2	77.3912	3	1015.5460	1015.5450	K	T	513	521
PSM	GEHGFIGCR	5786	sp|Q16658|FSCN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	8-UNIMOD:4	ms_run[1]:scan=1.1.7751.3	72.59147	3	1031.4640	1031.4607	R	K	390	399
PSM	FLNAENAQK	5787	sp|P43487|RANG_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7726.2	71.96903	3	1033.5253	1033.5192	R	F	142	151
PSM	VSELKEELK	5788	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7961.5	78.05763	3	1073.5981	1073.5968	K	K	13	22
PSM	VSELKEELK	5789	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7972.3	78.34755	3	1073.5981	1073.5968	K	K	13	22
PSM	VSELKEELK	5790	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7966.4	78.19019	3	1073.5981	1073.5968	K	K	13	22
PSM	VSELKEELK	5791	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7971.2	78.31962	3	1073.5981	1073.5968	K	K	13	22
PSM	VSELKEELK	5792	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7970.3	78.29488	3	1073.5981	1073.5968	K	K	13	22
PSM	VSELKEELK	5793	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7967.4	78.21687	3	1073.5981	1073.5968	K	K	13	22
PSM	VSELKEELK	5794	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7969.3	78.26843	3	1073.5981	1073.5968	K	K	13	22
PSM	VSELKEELK	5795	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7968.5	78.24515	3	1073.5981	1073.5968	K	K	13	22
PSM	VSELKEELK	5796	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7965.2	78.16006	3	1073.5981	1073.5968	K	K	13	22
PSM	ALVNQLHER	5797	sp|Q9HCC0-2|MCCB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8055.4	80.5301	3	1078.5928	1078.5883	K	V	51	60
PSM	LATELYHQK	5798	sp|Q06210|GFPT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8041.3	80.15118	3	1101.5857	1101.5818	K	S	548	557
PSM	GSEHQAIVQHLEK	5799	sp|Q14690|RRP5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7848.6	75.09945	4	1474.7565	1474.7528	K	S	925	938
PSM	LLEVEHPAAK	5800	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7978.3	78.50397	3	1105.6129	1105.6131	K	V	64	74
PSM	ALEHVPNSVR	5801	sp|O94906|PRP6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7870.3	75.67077	3	1120.5994	1120.5989	K	L	396	406
PSM	RASAYEALEK	5802	sp|Q15785|TOM34_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7917.3	76.89277	3	1136.5849	1136.5825	R	Y	91	101
PSM	IVNSAQTGSFK	5803	sp|O75964|ATP5L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7803.4	73.93121	3	1150.5880	1150.5982	K	Q	56	67
PSM	GGPTPQEAIQR	5804	sp|Q9H444|CHM4B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8003.4	79.14585	3	1152.5926	1152.5887	K	L	18	29
PSM	AGLLSQAK	5805	sp|Q5RKV6|EXOS6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7909.4	76.68725	2	786.4594	786.4599	R	G	43	51
PSM	AIEALSGK	5806	sp|O00425|IF2B3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7828.4	74.58577	2	787.4456	787.4439	K	I	53	61
PSM	RFPGYDSESK	5807	sp|P46777|RL5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8050.7	80.40063	3	1184.5495	1184.5462	K	E	179	189
PSM	GRPYDYNGPR	5808	sp|P13667|PDIA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8036.4	80.0181	3	1193.5585	1193.5578	K	E	261	271
PSM	SGEVAVLK	5809	sp|Q9Y530|OARD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7920.9	76.98327	2	801.4610	801.4596	K	R	65	73
PSM	IMGPNYTPGKK	5810	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8012.3	79.37812	3	1204.6288	1204.6274	R	E	429	440
PSM	KYDEELEER	5811	sp|Q01995|TAGL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7812.2	74.16412	3	1209.5545	1209.5513	K	L	21	30
PSM	EDRYEEEIK	5812	sp|P09493-3|TPM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7933.4	77.31673	3	1209.5545	1209.5513	K	V	218	227
PSM	PVWGGGNK	5813	sp|Q16527|CSRP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7824.3	74.48193	2	813.4160	813.4133	M	C	2	10
PSM	NHEEEISTLR	5814	sp|P08727|K1C19_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8009.5	79.3033	3	1226.5921	1226.5891	K	G	217	227
PSM	QEYDESGPSIVHRK	5815	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7963.6	78.11317	4	1643.7905	1643.7903	K	C	360	374
PSM	HQVEQLSSSLK	5816	sp|Q14980-2|NUMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8071.5	80.95866	3	1254.6595	1254.6568	R	Q	551	562
PSM	DAIAQAVR	5817	sp|P29401-2|TKT_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7927.5	77.16227	2	842.4624	842.4610	R	G	618	626
PSM	AVDITTPK	5818	sp|O75475|PSIP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8006.4	79.22343	2	843.4688	843.4702	K	A	136	144
PSM	GANPVEIR	5819	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7917.7	76.89944	2	854.4626	854.4610	K	R	134	142
PSM	TADEVPLK	5820	sp|Q9NZI8|IF2B1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7780.5	73.34155	2	871.4668	871.4651	K	I	273	281
PSM	SSELQAIK	5821	sp|Q9UKM9-2|RALY_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8011.8	79.36087	2	874.4742	874.4760	K	T	168	176
PSM	TSVETALR	5822	sp|P47755|CAZA2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8045.4	80.2607	2	875.4722	875.4712	R	A	122	130
PSM	TGVQFTTK	5823	sp|P40763-2|STAT3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8035.8	79.99813	2	880.4626	880.4655	K	V	341	349
PSM	VGQDPVLR	5824	sp|Q04837|SSBP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7812.6	74.17077	2	882.4940	882.4923	R	Q	39	47
PSM	ATDFVADR	5825	sp|P48735|IDHP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8037.6	80.04829	2	893.4256	893.4243	K	A	181	189
PSM	AGEVFIHK	5826	sp|Q15233-2|NONO_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7853.2	75.22303	3	899.4889	899.4865	K	D	11	19
PSM	SYSDPPLK	5827	sp|P52597|HNRPF_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7888.8	76.15455	2	905.4518	905.4494	R	F	193	201
PSM	VLEDSDLK	5828	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8026.6	79.75346	2	917.4734	917.4706	K	K	345	353
PSM	EEELREYQER	5829	sp|Q14152|EIF3A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7997.4	78.99208	3	1379.6335	1379.6317	R	V	838	848
PSM	TDEGIAYR	5830	sp|P32119|PRDX2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7851.6	75.17744	2	923.4350	923.4348	K	G	120	128
PSM	QVNITVQK	5831	sp|Q9P035|HACD3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7905.6	76.58833	2	928.5366	928.5342	R	K	77	85
PSM	IDDVVNTR	5832	sp|P50991|TCPD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7821.7	74.4114	2	930.4782	930.4771	K	-	532	540
PSM	VSQVIMEK	5833	sp|O75475|PSIP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7886.6	76.09956	2	932.5004	932.5001	K	S	408	416
PSM	LAHEVGWK	5834	sp|P40429|RL13A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8040.4	80.12587	3	938.5003	938.4974	R	Y	141	149
PSM	LAHEVGWK	5835	sp|P40429|RL13A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8059.2	80.63428	3	938.5003	938.4974	R	Y	141	149
PSM	STETALYR	5836	sp|Q14318-2|FKBP8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7884.7	76.04947	2	939.4668	939.4661	R	K	359	367
PSM	EIAENALGK	5837	sp|P31942-2|HNRH3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8068.9	80.88593	2	943.4992	943.4974	K	H	68	77
PSM	IIVGDATEK	5838	sp|Q96I25|SPF45_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7739.4	72.29303	2	944.5166	944.5179	K	D	277	286
PSM	IGEEEIQKPEEK	5839	sp|Q15459|SF3A1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7916.8	76.87457	3	1427.7154	1427.7143	K	V	488	500
PSM	AVQFTEEK	5840	sp|Q9NR46-2|SHLB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7896.10	76.36337	2	950.4690	950.4709	R	L	19	27
PSM	STYVTEVR	5841	sp|Q86UP2-4|KTN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7992.8	78.87095	2	953.4834	953.4818	R	E	1221	1229
PSM	DDEVQVVR	5842	sp|Q9UNX3|RL26L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7870.8	75.6791	2	958.4758	958.4720	K	G	52	60
PSM	SGQFCDVR	5843	sp|Q9Y6Y0|NS1BP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	5-UNIMOD:4	ms_run[1]:scan=1.1.7788.7	73.55033	2	967.4192	967.4182	K	L	28	36
PSM	MINTDLSR	5844	sp|P36578|RL4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	1-UNIMOD:35	ms_run[1]:scan=1.1.7935.8	77.37528	2	964.4674	964.4648	K	I	284	292
PSM	SNTFYSAGK	5845	sp|Q96FV9|THOC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7935.9	77.37695	2	973.4518	973.4505	K	N	125	134
PSM	RPFIDEAK	5846	sp|P48431|SOX2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7913.5	76.7913	2	974.5196	974.5185	K	R	88	96
PSM	AGFAGDDAPR	5847	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7797.10	73.78722	2	975.4552	975.4410	K	A	19	29
PSM	AGFAGDDAPR	5848	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7780.8	73.34655	2	975.4424	975.4410	K	A	19	29
PSM	MVINHLEK	5849	sp|P50990-2|TCPQ_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8036.8	80.02477	2	982.5286	982.5270	K	L	36	44
PSM	DAEDAVYGR	5850	sp|Q07955|SRSF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8043.7	80.21177	2	994.4368	994.4356	R	D	66	75
PSM	TVVAPSAVAGK	5851	sp|Q9NX14-2|NDUBB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7840.8	74.89983	2	998.5742	998.5761	R	R	36	47
PSM	LIELQAGKK	5852	sp|P14314-2|GLU2B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8029.4	79.83028	3	998.6158	998.6124	K	S	159	168
PSM	HPPAPAEPSSDLASK	5853	sp|Q9P2E9|RRBP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7803.8	73.93788	3	1502.7358	1502.7365	K	L	1099	1114
PSM	YQELPNSGPPHDR	5854	sp|P19525|E2AK2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8048.7	80.34665	3	1508.7109	1508.7008	K	R	27	40
PSM	IIEDCSNSEETVK	5855	sp|Q93008-1|USP9X_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	5-UNIMOD:4	ms_run[1]:scan=1.1.7802.7	73.90985	3	1522.6828	1522.6821	K	L	2289	2302
PSM	VDNEFDQR	5856	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7757.8	72.75259	2	1021.4474	1021.4465	R	L	4256	4264
PSM	TVPVEAVTSK	5857	sp|Q14247|SRC8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8037.9	80.05328	2	1029.5710	1029.5706	K	T	337	347
PSM	SSFTVDCSK	5858	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	7-UNIMOD:4	ms_run[1]:scan=1.1.7922.8	77.03512	2	1029.4430	1029.4437	K	A	2568	2577
PSM	GEHGFIGCR	5859	sp|Q16658|FSCN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	8-UNIMOD:4	ms_run[1]:scan=1.1.7746.6	72.47058	2	1031.4604	1031.4607	R	K	390	399
PSM	NNFEGEVTK	5860	sp|P07237|PDIA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7939.8	77.47926	2	1036.4824	1036.4825	R	E	214	223
PSM	YESLTDPSK	5861	sp|P07900-2|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8043.8	80.21343	2	1038.4890	1038.4869	R	L	183	192
PSM	TEDQTLITK	5862	sp|Q12996|CSTF3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7881.10	75.97623	2	1047.5448	1047.5448	R	R	266	275
PSM	MAGDQVANVR	5863	sp|P30154-2|2AAB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7809.10	74.09972	2	1059.5126	1059.5131	K	F	540	550
PSM	QVSDDLTER	5864	sp|P35232|PHB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7956.10	77.93103	2	1061.4986	1061.4989	R	A	149	158
PSM	VATNPSFDGR	5865	sp|Q8NHH9-2|ATLA2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8048.9	80.34998	2	1062.5112	1062.5094	K	L	303	313
PSM	NMMAACDPR	5866	sp|Q9BVA1|TBB2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	6-UNIMOD:4	ms_run[1]:scan=1.1.8026.9	79.75847	2	1064.4204	1064.4201	K	H	298	307
PSM	AQYEDIAQK	5867	sp|P04264|K2C1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7897.9	76.38747	2	1064.5182	1064.5138	K	S	356	365
PSM	LAQALHEMR	5868	sp|P20700|LMNB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7888.3	76.14622	3	1067.5561	1067.5546	K	E	242	251
PSM	VTQEIVTER	5869	sp|Q14126|DSG2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7954.9	77.87548	2	1073.5890	1073.5717	K	S	902	911
PSM	VSELKEELK	5870	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7963.3	78.10817	3	1073.5981	1073.5968	K	K	13	22
PSM	VSELKEELK	5871	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7964.2	78.13323	3	1073.5981	1073.5968	K	K	13	22
PSM	TWQDSDTVK	5872	sp|Q8NFQ8|TOIP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7960.9	78.03727	2	1078.4926	1078.4931	R	L	336	345
PSM	QYNCLTQR	5873	sp|Q9Y3A2|UTP11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	4-UNIMOD:4	ms_run[1]:scan=1.1.7818.11	74.33935	2	1081.4986	1081.4975	K	I	198	206
PSM	VASLEESEGNKQDLK	5874	sp|Q07065|CKAP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7921.9	77.01005	3	1645.8181	1645.8159	K	A	273	288
PSM	MPEDGLSDDK	5875	sp|Q05682-4|CALD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8032.8	79.91752	2	1105.4628	1105.4597	K	K	367	377
PSM	LTQEETNFK	5876	sp|Q9NTJ3|SMC4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7915.10	76.85162	2	1108.5406	1108.5400	K	S	565	574
PSM	AYGELPEHAK	5877	sp|O14602|IF1AY_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7713.3	71.62642	3	1113.5488	1113.5454	K	I	105	115
PSM	GLTTTGNSSLNSTSNTK	5878	sp|Q96KR1|ZFR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7782.10	73.40148	3	1681.8139	1681.8119	K	V	468	485
PSM	EYAENIGDGR	5879	sp|Q8WYA6-4|CTBL1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8053.8	80.48295	2	1122.4972	1122.4941	K	S	508	518
PSM	TLEEPVSTEK	5880	sp|Q99590|SCAFB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7842.10	74.95243	2	1131.5676	1131.5659	K	N	1451	1461
PSM	ALELDSNNEK	5881	sp|Q02790|FKBP4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8044.11	80.24541	2	1131.5436	1131.5407	K	G	345	355
PSM	IAVAAQNCYK	5882	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	8-UNIMOD:4	ms_run[1]:scan=1.1.8017.9	79.51807	2	1136.5644	1136.5648	K	V	97	107
PSM	VEQIEAGTPGR	5883	sp|Q16881-3|TRXR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7732.8	72.13333	2	1155.5878	1155.5884	K	L	355	366
PSM	IANPVEGSTDR	5884	sp|Q15366-2|PCBP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8035.10	80.00146	2	1157.5684	1157.5677	K	Q	324	335
PSM	EMDPEYEEK	5885	sp|P28370|SMCA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7851.9	75.18243	2	1168.4608	1168.4594	K	M	78	87
PSM	AVAILCNHQR	5886	sp|P11387|TOP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	6-UNIMOD:4	ms_run[1]:scan=1.1.7924.8	77.08847	2	1180.6140	1180.6135	R	A	625	635
PSM	DLEADEEDTR	5887	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7993.10	78.89982	2	1191.4900	1191.4891	K	K	53	63
PSM	IYGETPEACR	5888	sp|P51116|FXR2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	9-UNIMOD:4	ms_run[1]:scan=1.1.7951.9	77.7949	2	1194.5332	1194.5339	R	Q	274	284
PSM	DLPVSEQQER	5889	sp|Q9UNM6-2|PSD13_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8051.10	80.43243	2	1199.5788	1199.5782	K	A	189	199
PSM	RGDTVATLSER	5890	sp|P22102|PUR2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7800.11	73.86449	2	1203.6228	1203.6208	K	V	965	976
PSM	ASREEILAQAK	5891	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7973.4	78.37542	3	1214.6617	1214.6618	R	E	1659	1670
PSM	ASREEILAQAK	5892	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7969.9	78.27843	2	1214.6610	1214.6618	R	E	1659	1670
PSM	GASSPYGAPGTPR	5893	sp|Q5UIP0|RIF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7938.11	77.45825	2	1216.5830	1216.5836	K	M	399	412
PSM	TESPVLTSSCR	5894	sp|Q9H3U1-2|UN45A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	10-UNIMOD:4	ms_run[1]:scan=1.1.7941.10	77.53471	2	1235.5826	1235.5816	K	E	639	650
PSM	EDSSSTEFVEK	5895	sp|O60749-2|SNX2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8001.9	79.10281	2	1256.5424	1256.5408	K	R	107	118
PSM	EAKPDELMDSK	5896	sp|Q9P0L0|VAPA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8022.10	79.65275	2	1261.5880	1261.5860	K	L	115	126
PSM	EAALVQQEEEK	5897	sp|Q15020-4|SART3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7838.7	74.84888	2	1272.6228	1272.6197	K	A	551	562
PSM	DEFTNTCPSDK	5898	sp|Q9Y696|CLIC4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	7-UNIMOD:4	ms_run[1]:scan=1.1.7899.10	76.44072	2	1312.5250	1312.5242	R	E	228	239
PSM	DVEGSTSPQIGDK	5899	sp|O75534-2|CSDE1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7879.11	75.9252	2	1331.6208	1331.6205	K	V	445	458
PSM	SVPTTQCLDNSK	5900	sp|P46013|KI67_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	7-UNIMOD:4	ms_run[1]:scan=1.1.7989.6	78.79124	2	1348.6318	1348.6293	K	K	220	232
PSM	VSAVPTNMAAK	5901	sp|Q96KR1|ZFR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8204.3	84.39555	2	1087.5702	1087.5696	K	K	485	496
PSM	VATMLATGGNR	5902	sp|Q9H3K2|GHITM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8213.5	84.62515	2	1089.5544	1089.5601	R	K	333	344
PSM	DHPLPEVAHVK	5903	sp|P13073|COX41_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8303.2	86.95667	4	1240.6609	1240.6564	R	H	43	54
PSM	NIPEDNADMAR	5904	sp|P31939-2|PUR9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8248.6	85.52088	2	1244.5464	1244.5455	R	L	79	90
PSM	EGEGLGSEGQGIK	5905	sp|Q8IWZ8|SUGP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8204.6	84.40555	2	1259.5936	1259.5993	K	N	577	590
PSM	YHPGYFGK	5906	sp|P46776|RL27A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8453.3	90.93988	3	967.4560	967.4552	K	V	48	56
PSM	FCHGILTK	5907	sp|Q92896|GSLG1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	2-UNIMOD:4	ms_run[1]:scan=1.1.8343.4	88.02108	3	974.5060	974.5008	K	A	949	957
PSM	FRPSLEER	5908	sp|P35221-2|CTNA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8392.2	89.32695	3	1032.5383	1032.5352	R	L	301	309
PSM	VIDDTNITR	5909	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8178.4	83.72797	3	1045.5433	1045.5404	K	L	188	197
PSM	AAPGAEFAPNK	5910	sp|Q15233-2|NONO_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8368.2	88.68473	3	1071.5323	1071.5349	R	R	368	379
PSM	AAPGAEFAPNK	5911	sp|Q15233-2|NONO_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8393.3	89.3553	3	1071.5323	1071.5349	R	R	368	379
PSM	AQYEDIANR	5912	sp|P05787-2|K2C8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8272.3	86.13043	3	1078.5064	1078.5043	K	S	293	302
PSM	RAEFTVETR	5913	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8111.4	82.00629	3	1107.5668	1107.5673	K	S	301	310
PSM	IKSEHPGLSIGDTAK	5914	sp|P26583|HMGB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8265.4	85.9473	4	1551.8277	1551.8257	K	K	113	128
PSM	LEHEVDLCR	5915	sp|Q7Z6Z7-2|HUWE1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	8-UNIMOD:4	ms_run[1]:scan=1.1.8309.5	87.12217	3	1169.5534	1169.5499	R	K	460	469
PSM	QVLQLQASHR	5916	sp|Q9P2E9|RRBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8207.3	84.46872	3	1178.6554	1178.6520	K	E	865	875
PSM	RFPGYDSESK	5917	sp|P46777|RL5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8195.5	84.16648	3	1184.5588	1184.5462	K	E	179	189
PSM	IDVSVAAGHTDR	5918	sp|Q4V328-4|GRAP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8410.4	89.79729	3	1239.6250	1239.6208	R	S	728	740
PSM	GALALEEK	5919	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8310.4	87.1469	2	829.4546	829.4545	K	R	1717	1725
PSM	FGALTAEK	5920	sp|O95372|LYPA2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8440.4	90.59261	2	835.4452	835.4440	R	L	183	191
PSM	ISSDLDGHPVPK	5921	sp|P29401-2|TKT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8117.3	82.1609	3	1263.6508	1263.6459	K	Q	103	115
PSM	FGDQGGFK	5922	sp|P49790-3|NU153_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8281.6	86.37576	2	854.3936	854.3923	K	I	957	965
PSM	QEPERNECFLQHK	5923	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	8-UNIMOD:4	ms_run[1]:scan=1.1.8105.3	81.85477	4	1713.7913	1713.7893	K	D	118	131
PSM	EVVAEVVK	5924	sp|O60832|DKC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8259.3	85.7913	2	871.5016	871.5015	K	A	426	434
PSM	FVTISGQK	5925	sp|Q9UPN3|MACF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8306.6	87.04398	2	878.4848	878.4862	R	V	3941	3949
PSM	QPSLHMSAAAASR	5926	sp|O94776|MTA2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8269.5	86.05382	3	1325.6485	1325.6510	R	D	215	228
PSM	AVVIVDDR	5927	sp|P23246|SFPQ_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8450.7	90.86605	2	885.4930	885.4920	R	G	400	408
PSM	RLAPEYEAAATR	5928	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8392.8	89.33695	3	1346.6944	1346.6942	K	L	62	74
PSM	AYAALTDEESRK	5929	sp|Q9UGP8|SEC63_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8168.5	83.46605	3	1352.6587	1352.6572	K	N	148	160
PSM	QTATQLLK	5930	sp|P62424|RL7A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8344.8	88.05431	2	901.5240	901.5233	R	L	90	98
PSM	QTATQLLK	5931	sp|P62424|RL7A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8325.5	87.54762	2	901.5240	901.5233	R	L	90	98
PSM	APTNIVYK	5932	sp|P15927-3|RFA2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8144.4	82.84745	2	904.5032	904.5018	K	I	174	182
PSM	YFDPANGK	5933	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8307.6	87.07077	2	910.4172	910.4185	R	F	265	273
PSM	NVPVITGSK	5934	sp|P35232|PHB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8099.7	81.70433	2	913.5248	913.5233	R	D	75	84
PSM	TEQLGLTR	5935	sp|Q9GZL7|WDR12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8409.6	89.77489	2	916.4854	916.4978	K	T	240	248
PSM	NLAENISR	5936	sp|P11216|PYGB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8163.8	83.34229	2	915.4770	915.4774	R	V	271	279
PSM	TEQLGLTR	5937	sp|Q9GZL7|WDR12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8414.8	89.90708	2	916.4854	916.4978	K	T	240	248
PSM	SDPVVSYR	5938	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8160.6	83.26147	2	921.4556	921.4556	K	E	573	581
PSM	TAEFQVAR	5939	sp|Q9NSD9|SYFB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8437.8	90.51855	2	920.4734	920.4716	K	T	444	452
PSM	TLVGICSEHQSR	5940	sp|Q9H3U1-2|UN45A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	6-UNIMOD:4	ms_run[1]:scan=1.1.8182.9	83.84097	3	1385.6716	1385.6722	R	T	203	215
PSM	FSELTAEK	5941	sp|P48643|TCPE_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8308.7	87.099	2	923.4592	923.4600	R	L	345	353
PSM	INEEISVK	5942	sp|Q9BUJ2-2|HNRL1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8388.8	89.23045	2	930.5016	930.5022	K	H	263	271
PSM	VCNPIITK	5943	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	2-UNIMOD:4	ms_run[1]:scan=1.1.8396.7	89.44064	2	943.5174	943.5161	K	L	602	610
PSM	GGYTSGTFR	5944	sp|P25205|MCM3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8187.8	83.96738	2	944.4354	944.4352	K	T	249	258
PSM	YLSNAYAR	5945	sp|O00299|CLIC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8137.4	82.68042	2	956.4724	956.4715	R	E	209	217
PSM	IASNVLNTK	5946	sp|Q12789-3|TF3C1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8160.7	83.26313	2	958.5428	958.5447	R	V	1278	1287
PSM	TIDDLEEK	5947	sp|P67936|TPM4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8181.6	83.81018	2	961.4604	961.4604	K	L	216	224
PSM	YHPGYFGK	5948	sp|P46776|RL27A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8434.2	90.428	3	967.4560	967.4552	K	V	48	56
PSM	GLVPEDDTK	5949	sp|Q15459|SF3A1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8167.9	83.44701	2	972.4744	972.4764	K	E	534	543
PSM	NCIEIVNK	5950	sp|O94874|UFL1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	2-UNIMOD:4	ms_run[1]:scan=1.1.8411.3	89.82122	2	988.5032	988.5011	R	L	31	39
PSM	DSQICELK	5951	sp|P55145|MANF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	5-UNIMOD:4	ms_run[1]:scan=1.1.8368.8	88.69473	2	991.4634	991.4644	K	Y	113	121
PSM	QAGPASVPLR	5952	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8430.6	90.3272	2	994.5552	994.5560	K	T	131	141
PSM	FSATEVTNK	5953	sp|Q8N163|CCAR2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8141.9	82.77915	2	995.4918	995.4924	R	T	847	856
PSM	DYDDMSPR	5954	sp|P61978-2|HNRPK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8253.4	85.6397	2	997.3804	997.3811	R	R	279	287
PSM	LVQTAELTK	5955	sp|P60983|GMFB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8292.7	86.67185	2	1001.5754	1001.5757	K	V	111	120
PSM	LQCPTCIK	5956	sp|P53582|MAP11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	3-UNIMOD:4,6-UNIMOD:4	ms_run[1]:scan=1.1.8135.8	82.62455	2	1018.5058	1018.4940	K	L	20	28
PSM	IVADQLCAK	5957	sp|P53990-2|IST1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	7-UNIMOD:4	ms_run[1]:scan=1.1.8474.6	91.51051	2	1016.5304	1016.5325	K	Y	119	128
PSM	SLQSVAEER	5958	sp|P61313|RL15_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8429.7	90.30212	2	1017.5086	1017.5091	R	A	97	106
PSM	EFTEAVEAK	5959	sp|P35232|PHB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8409.9	89.77988	2	1022.4938	1022.4920	K	Q	178	187
PSM	YRPGTVALR	5960	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8140.7	82.75034	2	1031.5884	1031.5876	R	E	42	51
PSM	SGLLTETSSR	5961	sp|Q9UDT6|CLIP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8474.7	91.51218	2	1049.5342	1049.5353	R	Y	337	347
PSM	NDNDTFTVK	5962	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8271.9	86.11373	2	1052.4776	1052.4775	R	Y	829	838
PSM	YGSIVDDER	5963	sp|Q13576|IQGA2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8469.9	91.38067	2	1052.4768	1052.4774	R	L	14	23
PSM	GLEVTDDSPK	5964	sp|P49588|SYAC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8090.9	81.47269	2	1059.5102	1059.5084	R	Y	477	487
PSM	AINTQEVAVK	5965	sp|O00291-4|HIP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8144.7	82.85245	2	1071.5948	1071.5924	K	E	18	28
PSM	DTTVGTLSQR	5966	sp|P51665|PSMD7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8106.8	81.88533	2	1076.5470	1076.5462	K	I	181	191
PSM	FDSQLGGQAR	5967	sp|Q9P2M7|CING_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8136.9	82.65168	2	1077.5270	1077.5203	K	G	179	189
PSM	EVNLAVQNAK	5968	sp|P49189|AL9A1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8283.7	86.43092	2	1084.5866	1084.5876	K	A	50	60
PSM	FNEGVSNAVR	5969	sp|Q8WVB6-2|CTF18_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8294.11	86.73193	2	1091.5352	1091.5360	R	R	985	995
PSM	DGLGSDNIGSR	5970	sp|P98175|RBM10_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.8234.5	85.16576	2	1089.501647	1089.505065	R	M	854	865
PSM	FGNDVQHFK	5971	sp|P62993|GRB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8331.10	87.7154	2	1090.5152	1090.5196	K	V	101	110
PSM	QGIETPEDQNDLRK	5972	sp|Q15637-3|SF01_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8425.10	90.19991	3	1641.7951	1641.7958	K	M	228	242
PSM	QLESTEFNK	5973	sp|Q92576-2|PHF3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8307.11	87.0791	2	1094.5256	1094.5244	R	S	322	331
PSM	GTVEPQLEAR	5974	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8416.9	89.96056	2	1098.5652	1098.5669	K	G	428	438
PSM	GTVEPQLEAR	5975	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8435.9	90.46653	2	1098.5652	1098.5669	K	G	428	438
PSM	VNEVGVDVNR	5976	sp|Q7KZ85|SPT6H_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8284.10	86.46253	2	1099.5626	1099.5622	R	A	966	976
PSM	VNLDSEQAVK	5977	sp|Q15054|DPOD3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8148.7	82.9546	2	1101.5658	1101.5666	K	E	249	259
PSM	EAALEPSMEK	5978	sp|Q9H3K2|GHITM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8446.9	90.76221	2	1103.5354	1103.5168	K	I	64	74
PSM	LQETLSAADR	5979	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8345.11	88.08577	2	1102.5610	1102.5618	R	C	15	25
PSM	DNQLSEVANK	5980	sp|Q14978-2|NOLC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8134.9	82.60073	2	1116.5416	1116.5411	R	F	24	34
PSM	DNQLSEVANK	5981	sp|Q14978-2|NOLC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8116.10	82.1438	2	1116.5416	1116.5411	R	F	24	34
PSM	IYHPNIDEK	5982	sp|P68036|UB2L3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8181.8	83.81351	2	1127.5598	1127.5611	K	G	74	83
PSM	REQEVNILK	5983	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8350.2	88.20343	3	1127.6326	1127.6298	K	K	1165	1174
PSM	LGSLVENNER	5984	sp|Q99613|EIF3C_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.8283.8	86.43259	2	1129.581847	1129.572751	K	V	863	873
PSM	IEALCDEER	5985	sp|Q12872-2|SFSWA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	5-UNIMOD:4	ms_run[1]:scan=1.1.8463.10	91.22058	2	1133.5166	1133.5023	R	Y	106	115
PSM	VEVEEDGQLK	5986	sp|O75190-3|DNJB6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8397.9	89.46999	2	1144.5614	1144.5612	R	S	216	226
PSM	HWDHLTQVK	5987	sp|P30084|ECHM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8291.4	86.64005	3	1162.5895	1162.5883	K	K	119	128
PSM	HWDHLTQVK	5988	sp|P30084|ECHM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8279.4	86.31905	3	1162.5913	1162.5883	K	K	119	128
PSM	EYTINIHKR	5989	sp|P62899|RL31_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8089.5	81.43919	3	1172.6314	1172.6302	R	I	24	33
PSM	NCIAQTSAVVK	5990	sp|Q4VC31|CCD58_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	2-UNIMOD:4	ms_run[1]:scan=1.1.8277.11	86.27728	2	1189.6122	1189.6125	K	N	73	84
PSM	IKEENFVSPK	5991	sp|O00425|IF2B3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8336.9	87.8473	2	1189.6316	1189.6343	K	E	474	484
PSM	VVVEPPEGEEK	5992	sp|Q14839-2|CHD4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8165.8	83.3941	2	1210.6084	1210.6081	K	V	1635	1646
PSM	STVLQQQYNR	5993	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8381.10	89.04675	2	1235.6224	1235.6258	K	V	429	439
PSM	QHLEITGGQVR	5994	sp|P47897-2|SYQ_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8364.8	88.58746	3	1236.6607	1236.6575	K	T	244	255
PSM	ISSDLDGHPVPK	5995	sp|P29401-2|TKT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8377.10	88.93982	2	1263.6440	1263.6459	K	Q	103	115
PSM	DGHYTTFACNK	5996	sp|P51784|UBP11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	9-UNIMOD:4	ms_run[1]:scan=1.1.8147.4	82.92405	3	1312.5517	1312.5506	R	D	886	897
PSM	TPTPEPAEVETR	5997	sp|Q9UHY1|NRBP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8245.6	85.44815	2	1325.6388	1325.6463	K	K	431	443
PSM	EYQNEEDSLGGSR	5998	sp|Q5HYK3|COQ5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8297.11	86.81098	2	1482.6212	1482.6223	K	V	154	167
PSM	IKSEHPGLSIGDTAK	5999	sp|P26583|HMGB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8238.3	85.25725	4	1551.8285	1551.8257	K	K	113	128
PSM	AQQGPSAQGKPTYFR	6000	sp|Q9H9Z2|LN28A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8412.10	89.8587	2	1634.8110	1634.8165	K	E	178	193
PSM	NQPQFQQMR	6001	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8584.10	94.42303	2	1175.5442	1175.5506	R	Q	281	290
PSM	VPPPPPIAR	6002	sp|P07910-2|HNRPC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8630.3	95.62347	3	942.5578	942.5651	R	A	130	139
PSM	HVLVTLGEK	6003	sp|P60660-2|MYL6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8792.3	99.98437	3	994.5838	994.5811	R	M	111	120
PSM	HSATFSSIVK	6004	sp|Q66K74-2|MAP1S_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8820.3	100.7392	3	1075.5682	1075.5662	R	G	38	48
PSM	AALLVTTRPR	6005	sp|Q9NX02|NALP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8545.5	93.38465	3	1096.6750	1096.6717	K	A	330	340
PSM	LLEAQSHFR	6006	sp|Q13813|SPTN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8665.3	96.56305	3	1099.5802	1099.5774	K	K	2079	2088
PSM	VTVVDVNESR	6007	sp|O60701|UGDH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8608.2	95.03114	3	1116.5635	1116.5775	R	I	32	42
PSM	INEGLEHLAK	6008	sp|Q99747|SNAG_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8752.2	98.9046	3	1122.6031	1122.6033	K	A	6	16
PSM	VVVLNCEPSK	6009	sp|Q14690|RRP5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	6-UNIMOD:4	ms_run[1]:scan=1.1.8625.2	95.48737	3	1143.5926	1143.5958	K	E	594	604
PSM	PVLGKDEDFK	6010	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8704.3	97.6146	3	1146.5941	1146.5921	K	Q	633	643
PSM	YIDQEELNK	6011	sp|P07900-2|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8492.3	91.97895	3	1150.5526	1150.5506	K	T	406	415
PSM	LTGVFAPRPSTGPHK	6012	sp|P62701|RS4X_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8831.4	101.0335	4	1563.8549	1563.8522	K	L	23	38
PSM	AAHLCAEAALR	6013	sp|Q9UQ80|PA2G4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	5-UNIMOD:4	ms_run[1]:scan=1.1.8517.3	92.63721	3	1181.6017	1181.5975	K	L	145	156
PSM	SEMTPEELQK	6014	sp|P62316|SMD2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8754.5	98.96353	3	1190.5588	1190.5489	K	R	9	19
PSM	YVECSALTQK	6015	sp|P60953|CDC42_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	4-UNIMOD:4	ms_run[1]:scan=1.1.8482.5	91.7225	3	1197.5722	1197.5700	K	G	154	164
PSM	VGVNGFGR	6016	sp|P04406|G3P_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8717.5	97.96523	2	804.4246	804.4243	K	I	6	14
PSM	EFFNGKEPSR	6017	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8672.5	96.7543	3	1209.5803	1209.5778	K	G	377	387
PSM	DFEEYPEHR	6018	sp|O14980|XPO1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8734.2	98.41846	3	1220.5120	1220.5098	K	T	837	846
PSM	IGVLDEGK	6019	sp|P46781|RS9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8713.6	97.86044	2	829.4542	829.4545	R	M	84	92
PSM	IGVLDEGK	6020	sp|P46781|RS9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8732.6	98.3713	2	829.4542	829.4545	R	M	84	92
PSM	EAIEGTYIDKK	6021	sp|P62280|RS11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8538.7	93.19975	3	1265.6542	1265.6503	K	C	49	60
PSM	HVVPNEVVVQR	6022	sp|P06396-2|GELS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8480.5	91.66888	3	1274.7097	1274.7095	K	L	127	138
PSM	LSVTVDPK	6023	sp|Q00341|VIGLN_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8677.6	96.89085	2	857.4864	857.4858	K	Y	1055	1063
PSM	VFGPGVER	6024	sp|O75369-2|FLNB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8488.5	91.87782	2	859.4562	859.4552	K	S	747	755
PSM	AFAAGADIK	6025	sp|P30084|ECHM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8525.6	92.852	2	862.4560	862.4548	K	E	93	102
PSM	SSVINSIR	6026	sp|Q5T7N2|LITD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8701.5	97.5371	2	874.4896	874.4872	R	E	619	627
PSM	AGVAPLQVK	6027	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8714.3	97.88212	2	881.5328	881.5334	K	V	1478	1487
PSM	AGVAPLQVK	6028	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8705.5	97.64503	2	881.5328	881.5334	K	V	1478	1487
PSM	EAILAIHK	6029	sp|O43707|ACTN4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8743.3	98.66327	2	893.5314	893.5334	R	E	585	593
PSM	TTAQVLIR	6030	sp|P15121|ALDR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8700.6	97.51148	2	900.5404	900.5393	K	F	244	252
PSM	FCLDNGAK	6031	sp|P00558|PGK1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	2-UNIMOD:4	ms_run[1]:scan=1.1.8644.6	96.00505	2	923.4166	923.4171	K	S	49	57
PSM	TLVPGPPGSSRPVK	6032	sp|Q14318-2|FKBP8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8731.7	98.34603	3	1390.7920	1390.7933	K	G	106	120
PSM	IEDEECVRLDK	6033	sp|Q6P1J9|CDC73_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	6-UNIMOD:4	ms_run[1]:scan=1.1.8743.5	98.6666	3	1404.6568	1404.6555	R	E	140	151
PSM	LYSESLAR	6034	sp|P50395|GDIB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8608.7	95.03947	2	937.4868	937.4869	K	Y	211	219
PSM	TETVTSFR	6035	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8478.6	91.61697	2	939.4650	939.4662	R	K	3865	3873
PSM	TETVTSFR	6036	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8498.6	92.14065	2	939.4650	939.4662	R	K	3865	3873
PSM	CESAFLSK	6037	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	1-UNIMOD:4	ms_run[1]:scan=1.1.8561.7	93.8192	2	940.4322	940.4324	K	R	36	44
PSM	VIQEIVDK	6038	sp|P51114|FXR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8625.6	95.49403	2	942.5506	942.5386	K	S	303	311
PSM	VPPPPPIAR	6039	sp|P07910-2|HNRPC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8705.6	97.6467	2	942.5642	942.5651	R	A	130	139
PSM	VPPPPPIAR	6040	sp|P07910-2|HNRPC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8528.7	92.93295	2	942.5662	942.5651	R	A	130	139
PSM	MINTDLSR	6041	sp|P36578|RL4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8707.6	97.7007	2	948.4688	948.4698	K	I	284	292
PSM	SYENQKPPFDAK	6042	sp|P16435|NCPR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8688.6	97.18774	3	1422.6814	1422.6779	K	N	268	280
PSM	ADGYVLEGK	6043	sp|P62241|RS8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8617.5	95.27755	2	950.4716	950.4709	R	E	185	194
PSM	SIRPDNMSEYSK	6044	sp|Q13547|HDAC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8482.7	91.72583	3	1425.6565	1425.6558	R	Q	78	90
PSM	TKQDEVNAAWQR	6045	sp|Q13813|SPTN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8575.8	94.1893	3	1444.7089	1444.7059	K	L	228	240
PSM	AQYDELAR	6046	sp|P05783|K1C18_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8525.9	92.857	2	964.4620	964.4614	R	K	254	262
PSM	AAEDYGVIK	6047	sp|Q01995|TAGL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8814.7	100.5839	2	964.4874	964.4865	K	T	100	109
PSM	GGGQIIPTAR	6048	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8566.9	93.9569	2	968.5394	968.5403	R	R	717	727
PSM	SEGFDTYR	6049	sp|P12004|PCNA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8823.4	100.8216	2	973.4144	973.4141	R	C	54	62
PSM	QMVETELK	6050	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8525.10	92.85867	2	976.4910	976.4899	R	L	87	95
PSM	IGSVAPDTINNHVK	6051	sp|Q9UHY1|NRBP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8744.8	98.69849	3	1463.7724	1463.7732	K	T	218	232
PSM	SGTSEFLNK	6052	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8594.6	94.67218	2	981.4760	981.4767	K	M	169	178
PSM	TLQEQLEK	6053	sp|Q9H307|PININ_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8552.9	93.58	2	987.5236	987.5237	R	A	7	15
PSM	SLPCDICK	6054	sp|P07602-2|SAP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	4-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=1.1.8720.6	98.04758	2	991.4456	991.4467	K	D	60	68
PSM	FELQHGTEEQQEEVRK	6055	sp|O94906|PRP6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8589.6	94.54435	4	1985.9461	1985.9443	K	R	884	900
PSM	ASSELFSQK	6056	sp|Q01581|HMCS1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8638.8	95.84682	2	995.4924	995.4924	K	T	322	331
PSM	KPPLLNNADSVQAK	6057	sp|P09874|PARP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8572.7	94.11053	3	1493.8174	1493.8202	K	V	748	762
PSM	EPGTVALVSK	6058	sp|Q9HAV7|GRPE1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8661.8	96.46418	2	999.5672	999.5601	K	V	187	197
PSM	QFAPEYEK	6059	sp|P13667|PDIA4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8673.8	96.786	2	1010.4722	1010.4709	K	I	96	104
PSM	IVADQLCAK	6060	sp|P53990-2|IST1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	7-UNIMOD:4	ms_run[1]:scan=1.1.8479.7	91.64533	2	1016.5304	1016.5325	K	Y	119	128
PSM	IVADQLCAK	6061	sp|P53990-2|IST1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	7-UNIMOD:4	ms_run[1]:scan=1.1.8483.6	91.7498	2	1016.5304	1016.5325	K	Y	119	128
PSM	TAVCDIPPR	6062	sp|Q9BVA1|TBB2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	4-UNIMOD:4	ms_run[1]:scan=1.1.8640.7	95.8989	2	1027.5088	1027.5121	K	G	351	360
PSM	AGITTTLNSR	6063	sp|P33992|MCM5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8614.9	95.20358	2	1032.5544	1032.5564	K	C	472	482
PSM	LQAEAFQAR	6064	sp|P02649|APOE_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8819.7	100.7189	2	1032.5346	1032.5352	R	L	270	279
PSM	PDYLGADQR	6065	sp|P35998|PRS7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8563.8	93.87462	2	1033.4836	1033.4829	M	K	2	11
PSM	GCVQTLVEK	6066	sp|Q9Y5L0-1|TNPO3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	2-UNIMOD:4	ms_run[1]:scan=1.1.8503.8	92.2755	2	1032.5278	1032.5274	K	Y	124	133
PSM	TADGIVSHLK	6067	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8763.8	99.21201	2	1039.5654	1039.5662	R	K	120	130
PSM	ALYEHLTAK	6068	sp|P42704|LPPRC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8778.3	99.608	3	1044.5614	1044.5604	K	N	1339	1348
PSM	NCLLSCER	6069	sp|Q9BXW9-1|FACD2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	2-UNIMOD:4,6-UNIMOD:4	ms_run[1]:scan=1.1.8587.9	94.49807	2	1050.4558	1050.4586	R	L	112	120
PSM	FQDELESGK	6070	sp|O15042-2|SR140_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8490.9	91.93678	2	1051.4822	1051.4822	K	R	853	862
PSM	DQLQEYEK	6071	sp|P49750|YLPM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8548.7	93.46888	2	1051.4830	1051.4822	K	Q	473	481
PSM	FINDQYEK	6072	sp|Q9UHD8|SEPT9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8480.11	91.67889	2	1055.4928	1055.4924	K	Y	382	390
PSM	TLEQHDNIVTHYK	6073	sp|O60763-2|USO1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8540.8	93.25512	3	1596.7894	1596.7896	K	N	655	668
PSM	TALIHDGLAR	6074	sp|P25398|RS12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8812.3	100.5232	3	1065.5977	1065.5931	K	G	24	34
PSM	GHAVGDIPGVR	6075	sp|P62266|RS23_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8684.8	97.0833	2	1076.5708	1076.5727	K	F	109	120
PSM	YLAEVATGEK	6076	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8673.9	96.78767	2	1079.5494	1079.5499	R	R	133	143
PSM	VNNEGCFIK	6077	sp|O43657|TSN6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	6-UNIMOD:4	ms_run[1]:scan=1.1.8711.8	97.81071	2	1079.5042	1079.5070	K	V	192	201
PSM	EQVYDAMGEKEEAK	6078	sp|P49321|NASP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8616.10	95.25892	3	1625.7418	1625.7243	R	K	145	159
PSM	YADITVTSSK	6079	sp|Q9UPN3|MACF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8574.11	94.16846	2	1083.5426	1083.5448	R	A	5543	5553
PSM	YDQNYDIR	6080	sp|O00203-3|AP3B1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8784.8	99.77757	2	1085.4780	1085.4778	K	D	515	523
PSM	TNLATGIPSSK	6081	sp|Q96A57-2|TM230_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8762.10	99.1883	2	1087.5876	1087.5873	R	V	69	80
PSM	EIVESCDLK	6082	sp|O94979-10|SC31A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	6-UNIMOD:4	ms_run[1]:scan=1.1.8641.9	95.92925	2	1091.5176	1091.5169	K	N	600	609
PSM	IVTVVPQDTK	6083	sp|O95163|ELP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8771.9	99.42934	2	1098.6272	1098.6285	R	L	697	707
PSM	LQQENSILR	6084	sp|Q9P2E9|RRBP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8816.10	100.6431	2	1099.5956	1099.5985	K	N	798	807
PSM	ETNNAAIIMK	6085	sp|P60983|GMFB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8734.9	98.43013	2	1103.5612	1103.5645	K	I	26	36
PSM	DGTISEDTIR	6086	sp|Q99816-2|TS101_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8753.10	98.94497	2	1105.5294	1105.5251	R	A	113	123
PSM	SLESTTLTEK	6087	sp|Q16527|CSRP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8667.8	96.62498	2	1107.5664	1107.5659	K	E	152	162
PSM	SSTITVDQMK	6088	sp|Q53EL6-2|PDCD4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8787.8	99.85831	2	1108.5396	1108.5434	K	R	382	392
PSM	LDDPSCPRPECYR	6089	sp|P41091|IF2G_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	6-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=1.1.8726.8	98.21298	3	1663.7065	1663.7083	K	S	91	104
PSM	AVLIAGQPGTGK	6090	sp|Q9Y230-2|RUVB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8653.10	96.25349	2	1110.6392	1110.6397	R	T	27	39
PSM	STTYSLESPK	6091	sp|Q9NTI5-2|PDS5B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8692.7	97.29735	2	1111.5290	1111.5397	K	D	1080	1090
PSM	VTVVDVNESR	6092	sp|O60701|UGDH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8609.7	95.06618	2	1116.5768	1116.5775	R	I	32	42
PSM	STVEGIQASVK	6093	sp|P18206|VINC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8811.11	100.5095	2	1117.5970	1117.5979	K	T	656	667
PSM	STVEGIQASVK	6094	sp|P18206|VINC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8830.2	101.0042	3	1117.5979	1117.5979	K	T	656	667
PSM	LLQDSLGGNSK	6095	sp|Q9Y496|KIF3A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8790.9	99.94062	2	1130.5786	1130.5931	R	T	305	316
PSM	YDDMATCMK	6096	sp|P27348|1433T_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	7-UNIMOD:4	ms_run[1]:scan=1.1.8685.10	97.11345	2	1133.4190	1133.4191	R	A	19	28
PSM	IGAEVYHNLK	6097	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8760.11	99.13585	2	1142.6074	1142.6084	R	N	184	194
PSM	YIDQEELNK	6098	sp|P07900-2|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8550.11	93.52935	2	1150.5512	1150.5506	K	T	406	415
PSM	EYVESQLQR	6099	sp|Q8NBS9|TXND5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8814.10	100.5889	2	1150.5594	1150.5618	R	T	288	297
PSM	EDTEEYNLR	6100	sp|P51991|ROA3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8639.8	95.8736	2	1167.5038	1167.5044	K	D	135	144
PSM	EDTEEYNLR	6101	sp|P51991|ROA3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8601.11	94.8612	2	1167.5038	1167.5044	K	D	135	144
PSM	NQPQFQQMR	6102	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8564.10	93.9049	2	1175.5558	1175.5506	R	Q	281	290
PSM	LNMTPEEAER	6103	sp|P60228|EIF3E_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8824.9	100.8568	2	1188.5436	1188.5444	K	W	360	370
PSM	DLETSCSDIR	6104	sp|Q14203-6|DCTN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	6-UNIMOD:4	ms_run[1]:scan=1.1.8747.8	98.77952	2	1194.5188	1194.5187	R	Q	779	789
PSM	GPGAGEGPGGAFAR	6105	sp|Q6VEQ5|WASH2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	19		ms_run[1]:scan=1.1.8726.9	98.21465	2	1199.5737	1199.5678	K	V	427	441
PSM	LQEESEVLQK	6106	sp|Q9H974-4|QTRT2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8548.9	93.47221	2	1201.6152	1201.6190	R	S	189	199
PSM	NIDQCSEIVK	6107	sp|Q92878-2|RAD50_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	5-UNIMOD:4	ms_run[1]:scan=1.1.8639.9	95.87527	2	1204.5748	1204.5758	K	C	1298	1308
PSM	VIDQQNGLYR	6108	sp|P27694|RFA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8756.9	99.02455	2	1204.6154	1204.6200	K	C	490	500
PSM	VVAEVYDQER	6109	sp|Q9UHX1-2|PUF60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8588.8	94.52203	2	1206.5852	1206.5881	K	F	525	535
PSM	EALCDPTVASR	6110	sp|Q9BRX2|PELO_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	4-UNIMOD:4	ms_run[1]:scan=1.1.8608.9	95.0428	2	1217.5710	1217.5710	K	L	255	266
PSM	EGNPAEINVER	6111	sp|Q9BXP5-2|SRRT_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8767.10	99.32315	2	1226.5878	1226.5891	K	D	591	602
PSM	NNTQVLINCR	6112	sp|P62316|SMD2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	9-UNIMOD:4	ms_run[1]:scan=1.1.8813.11	100.5635	2	1230.6114	1230.6139	K	N	38	48
PSM	NFSDNQLQEGK	6113	sp|P37802-2|TAGL2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8585.7	94.44362	2	1278.5822	1278.5840	R	N	182	193
PSM	HRPELIEYDK	6114	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8516.10	92.62268	2	1298.6594	1298.6619	R	L	205	215
PSM	SEHPGLSIGDTAK	6115	sp|P26583|HMGB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8519.5	92.69303	3	1310.6470	1310.6466	K	K	115	128
PSM	NDSESSGVLYSR	6116	sp|Q8IUI8-2|CRLF3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8590.10	94.57665	2	1312.5860	1312.5895	R	A	292	304
PSM	EGILPERAEEAK	6117	sp|O43768-3|ENSA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8819.11	100.7256	2	1340.6890	1340.6935	K	L	25	37
PSM	ATCFAYGQTGSGK	6118	sp|Q99661|KIF2C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	3-UNIMOD:4	ms_run[1]:scan=1.1.8656.8	96.33067	2	1346.5920	1346.5925	K	T	342	355
PSM	APEPTPQQVAQQQ	6119	sp|Q14839-2|CHD4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8820.11	100.7525	2	1420.6912	1420.6947	R	-	1928	1941
PSM	TQSPCFGDDDPAK	6120	sp|Q12765-2|SCRN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	5-UNIMOD:4	ms_run[1]:scan=1.1.8740.11	98.59535	2	1436.5868	1436.5878	K	K	340	353
PSM	IESSLQEDEPENDAK	6121	sp|Q9NPL8|TIDC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8704.11	97.62793	2	1702.7472	1702.7533	K	K	250	265
PSM	LAELHADLK	6122	sp|P30533|AMRP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8980.2	104.9368	3	1008.5674	1008.5604	R	I	76	85
PSM	GHQQLYWSHPR	6123	sp|P62273-2|RS29_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8877.2	102.2347	4	1407.6833	1407.6796	M	K	2	13
PSM	AVDDGVNTFK	6124	sp|P50990-2|TCPQ_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8944.2	103.9758	3	1064.5189	1064.5139	R	V	372	382
PSM	YLIVDEGHR	6125	sp|Q9NRZ9-2|HELLS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9147.2	109.3336	3	1100.5624	1100.5614	K	I	334	343
PSM	TFGETHPFTK	6126	sp|P09960|LKHA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8883.3	102.3907	3	1163.5615	1163.5611	K	L	356	366
PSM	DHNIPGELER	6127	sp|P35580-3|MYH10_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8879.2	102.286	3	1178.5759	1178.5680	K	Q	207	217
PSM	DHNIPGELER	6128	sp|P35580-3|MYH10_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8832.3	101.0579	3	1178.5681	1178.5680	K	Q	207	217
PSM	NSLVDKPFAAK	6129	sp|Q14192|FHL2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9169.2	109.9256	3	1188.6346	1188.6503	R	E	73	84
PSM	VDDVINVAGHR	6130	sp|Q9H6R3|ACSS3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9089.2	107.8317	3	1193.6134	1193.6153	R	I	555	566
PSM	LYASHSQFIK	6131	sp|Q9BW91|NUDT9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8894.3	102.6732	3	1192.6273	1192.6240	K	L	320	330
PSM	YHDIEPGAVVK	6132	sp|Q14690|RRP5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8870.3	102.0552	3	1226.6284	1226.6295	R	G	447	458
PSM	AASIFGGAK	6133	sp|P23588-2|IF4B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8964.4	104.515	2	820.4452	820.4443	R	P	318	327
PSM	LNQDQLDAVSK	6134	sp|Q14444-2|CAPR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9086.4	107.7573	3	1229.6239	1229.6252	R	Y	88	99
PSM	HGGVIHIYVDK	6135	sp|Q14498-2|RBM39_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9003.6	105.5504	3	1236.6619	1236.6615	K	N	451	462
PSM	APIIAVTR	6136	sp|P14618-2|KPYM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9136.3	109.0463	2	839.5240	839.5229	R	N	448	456
PSM	APIIAVTR	6137	sp|P14618-2|KPYM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9155.3	109.5504	2	839.5240	839.5229	R	N	448	456
PSM	HLQLAIR	6138	sp|P16104|H2AX_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9142.4	109.2037	2	849.5202	849.5184	R	N	83	90
PSM	HLQLAIR	6139	sp|P16104|H2AX_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9161.4	109.7132	2	849.5202	849.5184	R	N	83	90
PSM	DKEEIVICDR	6140	sp|Q9NRR5|UBQL4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	8-UNIMOD:4	ms_run[1]:scan=1.1.8960.4	104.4076	3	1275.6121	1275.6129	K	A	22	32
PSM	HLQLAIR	6141	sp|P16104|H2AX_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9102.5	108.1717	2	849.5200	849.5184	R	N	83	90
PSM	HLQLAIR	6142	sp|P16104|H2AX_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9122.4	108.6879	2	849.5200	849.5184	R	N	83	90
PSM	HLQLAIR	6143	sp|P16104|H2AX_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9063.2	107.1471	2	849.5202	849.5184	R	N	83	90
PSM	HLQLAIR	6144	sp|P16104|H2AX_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9082.4	107.6523	2	849.5202	849.5184	R	N	83	90
PSM	HLQLAIR	6145	sp|P16104|H2AX_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9025.4	106.1345	2	849.5204	849.5184	R	N	83	90
PSM	HLQLAIR	6146	sp|P16104|H2AX_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9044.4	106.6425	2	849.5204	849.5184	R	N	83	90
PSM	FVIATSTK	6147	sp|Q02878|RL6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8868.6	102.0082	2	865.4906	865.4909	K	I	193	201
PSM	QLIVGVNK	6148	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8933.2	103.6822	2	869.5332	869.5334	K	M	147	155
PSM	QLIVGVNK	6149	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8913.2	103.1592	2	869.5332	869.5334	K	M	147	155
PSM	GLDVEDVK	6150	sp|Q92841-3|DDX17_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9150.9	109.4259	2	873.4446	873.4444	R	F	402	410
PSM	QEISAAFK	6151	sp|P08758|ANXA5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9065.8	107.2104	2	892.4668	892.4654	R	T	51	59
PSM	SSLEDGCLSCGR	6152	sp|Q9UBC3-2|DNM3B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	7-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.8958.5	104.3555	3	1339.5487	1339.5497	K	K	409	421
PSM	TDAPLNIR	6153	sp|Q12931|TRAP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9098.4	108.067	2	898.4862	898.4872	K	S	333	341
PSM	TIAPALVSK	6154	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8972.6	104.7331	2	898.5500	898.5488	K	K	72	81
PSM	ANFENLAK	6155	sp|Q14247|SRC8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9173.6	110.0399	2	905.4600	905.4606	R	E	352	360
PSM	AGSYGVSIR	6156	sp|Q0VF96|CGNL1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8894.6	102.6782	2	908.4678	908.4716	K	V	37	46
PSM	VDQIIMAK	6157	sp|P50990-2|TCPQ_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8956.5	104.302	2	916.5048	916.5052	R	P	502	510
PSM	TTLTAAITK	6158	sp|P49411|EFTU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8981.4	104.9663	2	918.5390	918.5386	K	I	71	80
PSM	AISFVGSNK	6159	sp|Q02252-2|MMSA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9132.5	108.947	2	921.4918	921.4920	K	A	243	252
PSM	VPLSAYER	6160	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9029.7	106.2466	2	933.4902	933.4920	R	V	2385	2393
PSM	LCGDTSLNNMQR	6161	sp|O00410-3|IPO5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	2-UNIMOD:4	ms_run[1]:scan=1.1.9114.7	108.485	3	1407.6307	1407.6235	K	Q	283	295
PSM	LSIVPVRR	6162	sp|P15880|RS2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9171.6	109.9861	2	938.6006	938.6025	K	G	160	168
PSM	LSIVPVRR	6163	sp|P15880|RS2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9190.6	110.4912	2	938.6006	938.6025	K	G	160	168
PSM	VEEEEERNQILQNEK	6164	sp|P35580-3|MYH10_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8939.6	103.8486	4	1885.9021	1885.9017	R	K	952	967
PSM	VMTVSFHK	6165	sp|Q13547|HDAC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8954.7	104.2518	2	947.4882	947.4899	R	Y	193	201
PSM	SNLNSLDEQEGVK	6166	sp|O75223|GGCT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9158.6	109.6359	3	1431.6838	1431.6841	K	S	89	102
PSM	LGNFSYQK	6167	sp|Q96PZ0-2|PUS7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9175.8	110.0972	2	955.4756	955.4763	K	N	331	339
PSM	EFHLNESGDPSSK	6168	sp|Q01105|SET_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8860.5	101.7945	3	1445.6419	1445.6423	K	S	155	168
PSM	SCQFVAVR	6169	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	2-UNIMOD:4	ms_run[1]:scan=1.1.8874.9	102.1691	2	965.4746	965.4753	K	R	1376	1384
PSM	YCQHVLCETVR	6170	sp|Q6UW02-2|CP20A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	2-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=1.1.8997.7	105.3931	3	1463.6701	1463.6650	R	T	298	309
PSM	EQAEAEVASLNRR	6171	sp|P06753-2|TPM3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9149.8	109.3975	3	1471.7371	1471.7379	R	I	43	56
PSM	EGHPVTSEPSRPEPAVFK	6172	sp|Q16762|THTR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9183.6	110.3072	4	1962.9777	1962.9799	K	A	137	155
PSM	EGHPVTSEPSRPEPAVFK	6173	sp|Q16762|THTR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9186.8	110.3894	4	1962.9777	1962.9799	K	A	137	155
PSM	EDAVSFAEK	6174	sp|O43181|NDUS4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9024.7	106.1128	2	994.4598	994.4607	K	N	132	141
PSM	EHCVCVQGNYIK	6175	sp|Q05D32-2|CTSL2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	3-UNIMOD:4,5-UNIMOD:4	ms_run[1]:scan=1.1.8871.7	102.0879	3	1505.6824	1505.6755	R	D	305	317
PSM	EFTAQNLGK	6176	sp|O15372|EIF3H_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9000.8	105.4743	2	1006.5074	1006.5083	K	L	332	341
PSM	CLDAVVSTR	6177	sp|Q86VP6|CAND1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	1-UNIMOD:4	ms_run[1]:scan=1.1.8944.7	103.9841	2	1019.5056	1019.5070	K	H	356	365
PSM	ELSDLESAR	6178	sp|P27708|PYR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9135.9	109.0307	2	1018.4932	1018.4931	R	Q	1067	1076
PSM	NEIASVAYR	6179	sp|O15371-2|EIF3D_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9183.7	110.3088	2	1021.5172	1021.5192	K	Y	302	311
PSM	DLPEHAVLK	6180	sp|Q00839-2|HNRPU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8926.2	103.4967	3	1020.5620	1020.5604	K	M	608	617
PSM	AKTDAGGEDAILQTR	6181	sp|Q9NT62-2|ATG3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9128.6	108.8475	3	1544.7703	1544.7794	K	T	184	199
PSM	LQAEAFQAR	6182	sp|P02649|APOE_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8838.7	101.2213	2	1032.5346	1032.5352	R	L	270	279
PSM	LDGNQDLIR	6183	sp|P48735|IDHP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9154.7	109.5303	2	1042.5470	1042.5407	K	F	385	394
PSM	YLEDGGLER	6184	sp|P07099|HYEP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9178.8	110.1776	2	1050.4988	1050.4982	R	K	339	348
PSM	DLDNAGELGR	6185	sp|O95602|RPA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9112.8	108.4348	2	1058.5006	1058.4992	R	S	1376	1386
PSM	LLDVVHPAAK	6186	sp|Q99832-3|TCPH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9175.2	110.0872	3	1061.6257	1061.6233	K	T	24	34
PSM	ETLAVNYEK	6187	sp|Q16204|CCDC6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8994.8	105.3153	2	1065.5328	1065.5342	K	E	128	137
PSM	LPQPVQPDPVSHCK	6188	sp|P05556|ITB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	13-UNIMOD:4	ms_run[1]:scan=1.1.8926.11	103.5117	3	1600.7839	1600.8032	K	E	679	693
PSM	AEPVEVVAPR	6189	sp|P09874|PARP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9046.9	106.7043	2	1065.5812	1065.5818	K	G	487	497
PSM	KFYEQFSK	6190	sp|P07900-2|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9072.8	107.3948	2	1075.5322	1075.5338	K	N	558	566
PSM	SLGPSLATDKS	6191	sp|Q9H3N1|TMX1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8860.10	101.8028	2	1074.5532	1074.5557	R	-	270	281
PSM	EYGQIESVR	6192	sp|P42696|RBM34_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8852.7	101.5849	2	1079.5244	1079.5247	K	F	207	216
PSM	TLSDYNIQK	6193	sp|P62979|RS27A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9120.8	108.6425	2	1080.5428	1080.5451	R	E	55	64
PSM	FYDANYDGK	6194	sp|Q15555-3|MARE2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8956.10	104.3104	2	1091.4536	1091.4560	K	E	145	154
PSM	FAVLHGEAPR	6195	sp|P55884-2|EIF3B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8921.10	103.3793	2	1095.5786	1095.5825	K	I	577	587
PSM	GTEVQVDDIK	6196	sp|Q9Y230-2|RUVB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8832.8	101.0662	2	1102.5500	1102.5506	K	R	373	383
PSM	MVQFEENGR	6197	sp|P49368|TCPG_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8981.10	104.9763	2	1108.4994	1108.4971	K	K	182	191
PSM	FCQLVTSEK	6198	sp|Q15652|JHD2C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	2-UNIMOD:4	ms_run[1]:scan=1.1.9025.10	106.1445	2	1110.5340	1110.5379	K	T	1813	1822
PSM	VEYSEEELK	6199	sp|P12956-2|XRCC6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8963.9	104.4966	2	1124.5234	1124.5237	K	T	516	525
PSM	QQVLQEAYR	6200	sp|Q9HBK9|AS3MT_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8885.11	102.4555	2	1133.5818	1133.5829	K	V	165	174
PSM	VSYIGVCQSK	6201	sp|Q56VL3|OCAD2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	7-UNIMOD:4	ms_run[1]:scan=1.1.8971.6	104.7063	2	1139.5646	1139.5645	K	F	100	110
PSM	VLTVINQTQK	6202	sp|P42766|RL35_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8835.11	101.1496	2	1142.6642	1142.6659	R	E	57	67
PSM	VLCLSQSEGR	6203	sp|Q14690|RRP5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	3-UNIMOD:4	ms_run[1]:scan=1.1.8864.11	101.9115	2	1147.5610	1147.5656	R	V	692	702
PSM	SQEVAYTDIK	6204	sp|P49840|GSK3A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9105.5	108.2488	2	1152.5570	1152.5663	R	V	114	124
PSM	LILCDECNK	6205	sp|Q9UIG0-2|BAZ1B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	4-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=1.1.9119.10	108.6199	2	1163.5290	1163.5315	K	A	1195	1204
PSM	EQVYDAMGEK	6206	sp|P49321|NASP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8844.8	101.3796	2	1168.5062	1168.5070	R	E	145	155
PSM	LQIASDENYK	6207	sp|Q13813|SPTN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9091.9	107.8951	2	1179.5736	1179.5771	K	D	64	74
PSM	LNMTPEEAER	6208	sp|P60228|EIF3E_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8844.9	101.3813	2	1188.5440	1188.5444	K	W	360	370
PSM	AEFGPPGPGAGSR	6209	sp|Q9H4A4|AMPB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8946.10	104.0426	2	1198.5708	1198.5731	R	G	45	58
PSM	SLSDPCYYNK	6210	sp|Q14202|ZMYM3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	6-UNIMOD:4	ms_run[1]:scan=1.1.9180.10	110.2344	2	1245.5294	1245.5336	R	V	552	562
PSM	EIPSATQSPISK	6211	sp|Q9BQG0-2|MBB1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8980.10	104.9501	2	1256.6556	1256.6612	K	K	1156	1168
PSM	QLSLPQQEAQK	6212	sp|O95782|AP2A1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.9140.9	109.1599	2	1268.651047	1268.672465	K	I	881	892
PSM	YLAEVACGDDR	6213	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	7-UNIMOD:4	ms_run[1]:scan=1.1.9135.11	109.034	2	1267.5468	1267.5503	R	K	128	139
PSM	GVNTVFHCASPPPSSNNK	6214	sp|Q15738|NSDHL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	8-UNIMOD:4	ms_run[1]:scan=1.1.9051.10	106.8393	3	1911.8761	1911.8898	K	E	97	115
PSM	NLQEIQQAGER	6215	sp|Q8N1F7|NUP93_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8867.11	101.9902	2	1284.6386	1284.6422	R	L	32	43
PSM	ETLTNCTEPLK	6216	sp|Q8WX92|NELFB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	6-UNIMOD:4	ms_run[1]:scan=1.1.9077.11	107.5315	2	1304.6258	1304.6282	K	A	18	29
PSM	TPNETTSVLEPK	6217	sp|Q8TF01|PNISR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8980.11	104.9518	2	1314.6642	1314.6667	R	K	485	497
PSM	SEQSVAQLEEEK	6218	sp|Q07866-4|KLC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9162.11	109.7516	2	1375.6466	1375.6467	K	K	134	146
PSM	SSHETLNIVEEK	6219	sp|O43491-4|E41L2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8970.11	104.6878	2	1384.6894	1384.6834	K	K	612	624
PSM	YDPTIEDSYRK	6220	sp|P61224-2|RAP1B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9103.6	108.1991	3	1385.6440	1385.6463	K	Q	32	43
PSM	EQAEAEVASLNRR	6221	sp|P06753-2|TPM3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9129.11	108.8799	2	1471.7360	1471.7379	R	I	43	56
PSM	VCEPCYEQLNRK	6222	sp|O14964|HGS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	2-UNIMOD:4,5-UNIMOD:4	ms_run[1]:scan=1.1.9061.7	107.1018	3	1594.7221	1594.7232	R	A	211	223
PSM	VINQYQVVKPTAER	6223	sp|Q14694-2|UBP10_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9184.7	110.3352	3	1643.8966	1643.8995	K	T	820	834
PSM	SPAHLSLIR	6224	sp|O76094|SRP72_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9389.2	115.7598	3	992.5792	992.5767	K	E	443	452
PSM	MAVLNEQVK	6225	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9515.3	119.1416	3	1030.5517	1030.5481	R	E	618	627
PSM	NVPNLHVMK	6226	sp|P46783|RS10_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9268.3	112.5489	3	1050.5662	1050.5644	K	A	39	48
PSM	HLLIGVSSDR	6227	sp|P36542-2|ATPG_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9455.3	117.5277	3	1095.6205	1095.6037	K	G	91	101
PSM	RLLEFNQGK	6228	sp|P41250|GARS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9485.2	118.3342	3	1103.5990	1103.6087	K	L	310	319
PSM	WSLQSEAHR	6229	sp|Q16658|FSCN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9326.2	114.0879	3	1112.5402	1112.5363	R	R	101	110
PSM	GHNTNVGAIVFHPK	6230	sp|O43172-2|PRP4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9541.2	119.8323	4	1489.7785	1489.7790	R	S	270	284
PSM	LQLEIDQKK	6231	sp|Q9Y266|NUDC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9238.3	111.763	3	1113.6409	1113.6393	R	D	115	124
PSM	HFLQDSFHR	6232	sp|Q9H8Y1|VRTN_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9444.5	117.2337	3	1185.5671	1185.5679	K	G	318	327
PSM	AVDPEDDFQR	6233	sp|Q99848|EBP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9542.2	119.858	3	1190.5192	1190.5204	K	E	95	105
PSM	LKEEIEVMAK	6234	sp|O75844|FACE1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9482.3	118.2553	3	1188.6466	1188.6424	K	S	234	244
PSM	EVPAVPETLKK	6235	sp|P18124|RL7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9239.5	111.7929	3	1209.6988	1209.6969	K	K	10	21
PSM	EVPAVPETLKK	6236	sp|P18124|RL7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9220.4	111.2819	3	1209.6988	1209.6969	K	K	10	21
PSM	ALEALVAK	6237	sp|P14550|AK1A1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9494.4	118.5795	2	813.4970	813.4960	K	G	146	154
PSM	HIYYITGETK	6238	sp|P07900-2|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9225.6	111.4195	3	1223.6194	1223.6186	K	D	612	622
PSM	HIYYITGETK	6239	sp|P07900-2|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9244.3	111.9224	3	1223.6194	1223.6186	K	D	612	622
PSM	HLFAPLK	6240	sp|Q9UBC3-2|DNM3B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9471.3	117.959	2	824.4922	824.4908	R	E	821	828
PSM	HLFAPLK	6241	sp|Q9UBC3-2|DNM3B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9452.3	117.4465	2	824.4922	824.4908	R	E	821	828
PSM	AGAFDQLK	6242	sp|P61011|SRP54_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9353.3	114.7972	2	848.4394	848.4392	R	Q	142	150
PSM	AGAFDQLK	6243	sp|P61011|SRP54_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9372.5	115.3068	2	848.4394	848.4392	R	Q	142	150
PSM	AVLHVALR	6244	sp|P06744-2|G6PI_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9262.6	112.3976	2	877.5490	877.5498	R	N	136	144
PSM	ALIADSGLK	6245	sp|Q9P2R7-2|SUCB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9529.5	119.5216	2	886.5112	886.5124	K	I	396	405
PSM	TLEGVITR	6246	sp|Q92878-2|RAD50_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9458.6	117.6137	2	887.5070	887.5076	K	T	119	127
PSM	ADEGISFR	6247	sp|Q06830|PRDX1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9484.8	118.3173	2	893.4242	893.4243	K	G	121	129
PSM	ADEGISFR	6248	sp|Q06830|PRDX1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9446.3	117.2844	2	893.4242	893.4243	K	G	121	129
PSM	ADEGISFR	6249	sp|Q06830|PRDX1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9465.6	117.8024	2	893.4242	893.4243	K	G	121	129
PSM	EAQLYAAQAHLK	6250	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9391.3	115.8152	3	1341.7039	1341.7041	K	L	536	548
PSM	IGCIITAR	6251	sp|Q12904-2|AIMP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	3-UNIMOD:4	ms_run[1]:scan=1.1.9258.8	112.2971	2	902.4988	902.5008	R	K	183	191
PSM	TLHPAVHAGILAR	6252	sp|P31939-2|PUR9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9200.5	110.7537	3	1354.7827	1354.7833	K	N	66	79
PSM	ADLYLEGK	6253	sp|Q9NSE4|SYIM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9403.4	116.1404	2	907.4644	907.4651	R	D	618	626
PSM	IVVVTAGVR	6254	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9314.4	113.7763	2	912.5764	912.5757	K	Q	92	101
PSM	GYAVLGGER	6255	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9290.8	113.1371	2	920.4722	920.4716	R	G	469	478
PSM	AALEEFSR	6256	sp|Q92922|SMRC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9533.7	119.6323	2	921.4550	921.4556	K	V	717	725
PSM	FIEGISEK	6257	sp|Q9H0A0-2|NAT10_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9413.7	116.4128	2	921.4800	921.4807	K	T	195	203
PSM	VHQVTPQTHFIS	6258	sp|Q9GZP4-2|PITH1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9372.6	115.3085	3	1392.7138	1392.7150	R	-	199	211
PSM	SDTPLIYK	6259	sp|P41252|SYIC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9435.6	116.9926	2	935.4934	935.4964	R	A	403	411
PSM	APHLAYLR	6260	sp|Q9BWD1-2|THIC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9447.2	117.3097	3	939.5317	939.5290	K	T	154	162
PSM	APHLAYLR	6261	sp|Q9BWD1-2|THIC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9466.2	117.8226	3	939.5317	939.5290	K	T	154	162
PSM	TVSPALISR	6262	sp|Q86VP6|CAND1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9277.4	112.7856	2	942.5484	942.5498	K	F	374	383
PSM	IIALDGDTK	6263	sp|P29401-2|TKT_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9248.7	112.035	2	944.5182	944.5179	R	N	343	352
PSM	QPPIQSTAGAVPVR	6264	sp|P55081|MFAP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9485.5	118.3392	3	1419.7846	1419.7834	K	N	10	24
PSM	VEITYTPSDGTQK	6265	sp|O75874|IDHC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9471.8	117.9673	3	1437.6967	1437.6987	K	V	152	165
PSM	VEITYTPSDGTQK	6266	sp|O75874|IDHC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9463.8	117.7518	3	1437.6967	1437.6987	K	V	152	165
PSM	NFRNPLAK	6267	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9368.2	115.1946	3	958.5394	958.5348	R	-	427	435
PSM	GLTSVINQK	6268	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9310.9	113.6771	2	958.5444	958.5447	R	L	300	309
PSM	VIGSELVQK	6269	sp|P35998|PRS7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9272.8	112.6617	2	971.5634	971.5651	R	Y	240	249
PSM	SGLVPQQIK	6270	sp|Q00341|VIGLN_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9422.8	116.6494	2	968.5796	968.5655	R	V	17	26
PSM	NLETPLCK	6271	sp|P54819|KAD2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	7-UNIMOD:4	ms_run[1]:scan=1.1.9224.6	111.3926	2	973.4898	973.4902	K	N	86	94
PSM	YLSELAEQPERK	6272	sp|Q9H7Z6-2|KAT8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9420.11	116.6019	3	1461.7447	1461.7463	K	I	126	138
PSM	DVAYQYVK	6273	sp|Q04837|SSBP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9380.9	115.5284	2	984.4902	984.4916	R	K	96	104
PSM	SQPVYIQYSNHR	6274	sp|O95758-4|PTBP3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9369.7	115.2297	3	1490.7247	1490.7266	R	E	129	141
PSM	TFEISASDK	6275	sp|Q9UH65|SWP70_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9272.10	112.665	2	996.4722	996.4764	K	K	283	292
PSM	MTPSYEIR	6276	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9342.7	114.5161	2	995.4738	995.4746	K	A	17	25
PSM	ALCADLSPR	6277	sp|Q9NQW7-2|XPP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	3-UNIMOD:4	ms_run[1]:scan=1.1.9373.7	115.3368	2	1001.4946	1001.4964	K	E	277	286
PSM	IAQLICER	6278	sp|P33316-2|DUT_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	6-UNIMOD:4	ms_run[1]:scan=1.1.9483.5	118.2854	2	1001.5302	1001.5328	R	I	129	137
PSM	ERGLGGEVPGSHQGPDPYR	6279	sp|Q6UW68|TM205_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9411.7	116.3602	4	2006.9581	2006.9559	K	Q	123	142
PSM	EEMIHNLQ	6280	sp|O00232|PSD12_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9222.8	111.3422	2	1012.4652	1012.4648	K	-	449	457
PSM	GENIEDIPK	6281	sp|Q86WR0|CCD25_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9311.9	113.704	2	1013.5020	1013.5029	K	E	57	66
PSM	VLDLQADSR	6282	sp|Q9HD20-2|AT131_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9249.9	112.0646	2	1015.5370	1015.5298	R	L	254	263
PSM	VAEELVAAAR	6283	sp|P49593-2|PPM1F_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9492.4	118.5256	2	1027.5634	1027.5662	R	E	285	295
PSM	ELVASAGLDR	6284	sp|Q8TAF3|WDR48_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9384.7	115.633	2	1029.5408	1029.5455	K	Q	130	140
PSM	NLEECITR	6285	sp|Q9UN81|LORF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	5-UNIMOD:4	ms_run[1]:scan=1.1.9316.7	113.8345	2	1033.4818	1033.4862	K	I	72	80
PSM	GLSEDVSISK	6286	sp|Q15029-2|U5S1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9465.9	117.8074	2	1033.5278	1033.5291	K	F	907	917
PSM	GDECGLALGR	6287	sp|P54886-2|P5CS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	4-UNIMOD:4	ms_run[1]:scan=1.1.9235.7	111.6896	2	1046.4800	1046.4815	R	L	85	95
PSM	QAVTNPNNTFYATK	6288	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9536.6	119.7095	3	1567.7590	1567.7631	R	R	108	122
PSM	LQTPNTFPK	6289	sp|Q14978-2|NOLC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9517.7	119.202	2	1044.5588	1044.5604	K	R	615	624
PSM	FVDGVSTVAR	6290	sp|O95347|SMC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9321.7	113.9657	2	1049.5504	1049.5506	K	F	1161	1171
PSM	DHTFLYEK	6291	sp|Q9UKR5|ERG28_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9352.6	114.7761	2	1051.4880	1051.4975	R	L	29	37
PSM	AIRPQIDLK	6292	sp|P78527|PRKDC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9459.3	117.6356	3	1052.6362	1052.6342	K	R	255	264
PSM	LLQSQLQVK	6293	sp|Q96I25|SPF45_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9537.10	119.7421	2	1055.6320	1055.6339	K	K	25	34
PSM	VAASNIVQMK	6294	sp|P49721|PSB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9388.11	115.7478	2	1059.5724	1059.5746	R	D	20	30
PSM	MVQDGDFVR	6295	sp|Q96AY3|FKB10_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9479.9	118.1846	2	1065.4912	1065.4913	R	Y	170	179
PSM	ILGATIENSR	6296	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9275.7	112.7383	2	1072.5858	1072.5876	K	I	141	151
PSM	ILGATIENSR	6297	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9285.8	113.003	2	1072.5858	1072.5876	K	I	141	151
PSM	NTASQNSILEEGETK	6298	sp|Q15398-3|DLGP5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9366.7	115.1495	3	1619.7754	1619.7638	K	I	771	786
PSM	AVGDKLPECEAVCGK	6299	sp|P00738|HPT_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	9-UNIMOD:4,13-UNIMOD:4	ms_run[1]:scan=1.1.9391.4	115.8169	3	1631.7604	1631.7647	K	P	137	152
PSM	SCLGDTLEAK	6300	sp|O75420|GGYF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	2-UNIMOD:4	ms_run[1]:scan=1.1.9358.9	114.9392	2	1092.5118	1092.5121	R	E	943	953
PSM	IQEENVIPR	6301	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9459.9	117.6456	2	1096.5862	1096.5876	K	E	981	990
PSM	IQEENVIPR	6302	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9479.11	118.188	2	1096.5862	1096.5876	K	E	981	990
PSM	GVTQIDNDLK	6303	sp|P21283|VATC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9407.10	116.258	2	1101.5718	1101.5666	K	S	128	138
PSM	MIDVAEPGQR	6304	sp|Q14671-2|PUM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9328.8	114.1502	2	1114.5248	1114.5441	K	K	1104	1114
PSM	GGTILAPTVSAK	6305	sp|Q7L014|DDX46_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9545.10	119.9486	2	1113.6348	1113.6394	R	T	883	895
PSM	VELECETIK	6306	sp|O14777|NDC80_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	5-UNIMOD:4	ms_run[1]:scan=1.1.9485.9	118.3459	2	1119.5448	1119.5482	R	Q	338	347
PSM	DLEEAEEYK	6307	sp|O75347|TBCA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9321.8	113.9673	2	1124.4854	1124.4873	K	E	87	96
PSM	LSPQAVNSIAK	6308	sp|P30626-2|SORCN_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9266.10	112.5083	2	1126.6334	1126.6346	R	R	121	132
PSM	YATALYSAASK	6309	sp|P48047|ATPO_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9364.7	115.096	2	1144.5746	1144.5764	R	Q	41	52
PSM	WLEASEEER	6310	sp|Q14137|BOP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9447.10	117.323	2	1147.5134	1147.5145	R	Q	515	524
PSM	YGFEPTQEGK	6311	sp|Q8IXM3|RM41_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9228.9	111.5052	2	1154.5246	1154.5244	K	L	117	127
PSM	SLPNEEIVQK	6312	sp|P18583-3|SON_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9281.10	112.9008	2	1155.6118	1155.6135	R	I	55	65
PSM	QEIADIEEGR	6313	sp|P23378|GCSP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9517.8	119.2037	2	1158.5496	1158.5517	R	I	928	938
PSM	DSAYPEELSR	6314	sp|P07686|HEXB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9499.10	118.7238	2	1165.5226	1165.5251	K	V	426	436
PSM	GNDPNVNIVPK	6315	sp|Q9Y520-4|PRC2C_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9287.8	113.0564	2	1165.6030	1165.6091	K	D	69	80
PSM	EIQAPASADIR	6316	sp|O43818|U3IP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9325.10	114.0751	2	1169.6020	1169.6040	K	V	130	141
PSM	VNSIIIDNCK	6317	sp|P40123-2|CAP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	9-UNIMOD:4	ms_run[1]:scan=1.1.9469.9	117.915	2	1174.5968	1174.6016	K	K	306	316
PSM	IVQMTEAEVR	6318	sp|P62140|PP1B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9420.5	116.5919	3	1174.6006	1174.6016	K	G	26	36
PSM	EYQTQLIQR	6319	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9430.9	116.8628	2	1177.6066	1177.6091	R	V	603	612
PSM	AVDPEDDFQR	6320	sp|Q99848|EBP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9533.10	119.6373	2	1190.5164	1190.5204	K	E	95	105
PSM	VIATFTCSGEK	6321	sp|P49189|AL9A1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	7-UNIMOD:4	ms_run[1]:scan=1.1.9251.10	112.1185	2	1211.5824	1211.5856	R	E	39	50
PSM	ALVDGPCTQVR	6322	sp|P50914|RL14_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	7-UNIMOD:4	ms_run[1]:scan=1.1.9238.9	111.773	2	1214.6050	1214.6078	R	R	36	47
PSM	RAATLAQELEK	6323	sp|Q14683|SMC1A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9292.10	113.1941	2	1228.6750	1228.6775	K	F	385	396
PSM	LSDNPAWEGDK	6324	sp|Q9BY42|RTF2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9246.10	111.9871	2	1230.5508	1230.5517	K	G	93	104
PSM	WKPPQGTDSIK	6325	sp|Q9UHX1-2|PUF60_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9238.4	111.7647	3	1255.6564	1255.6561	K	M	33	44
PSM	ESWEMNSEEK	6326	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9236.10	111.7214	2	1267.4988	1267.5026	K	L	257	267
PSM	QSVENDIHGLR	6327	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9306.10	113.5712	2	1266.6250	1266.6317	R	K	176	187
PSM	VVTQNICQYR	6328	sp|Q8N163|CCAR2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	7-UNIMOD:4	ms_run[1]:scan=1.1.9276.10	112.7695	2	1279.6262	1279.6343	R	S	748	758
PSM	DIQEESTFSSR	6329	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9275.10	112.7433	2	1297.5760	1297.5786	K	K	67	78
PSM	EGDSFNTQCLK	6330	sp|Q8WVT3|TPC12_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	9-UNIMOD:4	ms_run[1]:scan=1.1.9467.10	117.8628	2	1297.5674	1297.5609	K	L	723	734
PSM	IRYESLTDPSK	6331	sp|P07900-2|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9339.5	114.4352	3	1307.6773	1307.6721	K	L	181	192
PSM	EQAEAEVASLNR	6332	sp|P06753-2|TPM3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9455.11	117.541	2	1315.6332	1315.6368	R	R	43	55
PSM	TCNTMNQFVNK	6333	sp|Q7L5N1|CSN6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	2-UNIMOD:4	ms_run[1]:scan=1.1.9417.10	116.5221	2	1355.5864	1355.5962	K	F	298	309
PSM	ATEDGTPYDPYK	6334	sp|P22059|OSBP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9398.11	116.0174	2	1355.5864	1355.5881	K	A	757	769
PSM	AYVDDTPAEQMK	6335	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9373.9	115.3401	2	1366.6050	1366.6075	K	A	289	301
PSM	RVEIMEEESEQ	6336	sp|P54578-2|UBP14_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9349.9	114.7019	2	1377.6064	1377.6082	R	-	449	460
PSM	RVEIMEEESEQ	6337	sp|P54578-2|UBP14_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9360.7	114.9892	2	1377.6064	1377.6082	R	-	449	460
PSM	NLSSDEATNPISR	6338	sp|Q7Z417|NUFP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9200.11	110.7637	2	1402.6662	1402.6688	K	V	110	123
PSM	YPLNCADPTSER	6339	sp|Q06124-2|PTN11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	5-UNIMOD:4	ms_run[1]:scan=1.1.9377.11	115.451	2	1421.6202	1421.6245	K	W	100	112
PSM	LMQQQQEVAGLSK	6340	sp|O15164-2|TIF1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9536.10	119.7161	2	1458.7456	1458.7500	K	Q	342	355
PSM	EHYPNGVCTVYGK	6341	sp|P47755|CAZA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	8-UNIMOD:4	ms_run[1]:scan=1.1.9210.11	111.0274	2	1522.6840	1522.6875	K	K	134	147
PSM	TGTITTFEHAHNMR	6342	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9279.4	112.8381	4	1614.7605	1614.7573	K	V	482	496
PSM	ALLVTASQCQQPAENK	6343	sp|Q01518-2|CAP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	9-UNIMOD:4	ms_run[1]:scan=1.1.9405.10	116.2043	3	1756.8733	1756.8778	R	L	84	100
PSM	YTTPEDATPEPGEDPR	6344	sp|Q5JWF2-2|GNAS1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9224.11	111.4009	2	1773.7668	1773.7693	R	V	947	963
PSM	TTSSANNPNLMYQDECDRR	6345	sp|Q92841-3|DDX17_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	16-UNIMOD:4	ms_run[1]:scan=1.1.9329.11	114.1814	3	2270.9611	2270.9644	R	L	492	511
PSM	ELEAELEDERK	6346	sp|P35580-3|MYH10_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9322.6	113.99	3	1359.6562	1359.6517	R	Q	1621	1632
PSM	LGHELQQAGLK	6347	sp|Q14980-2|NUMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8555.5	93.65421	3	1192.6603	1192.6564	R	T	1641	1652
PSM	KVEELQACVETAR	6348	sp|Q14980-2|NUMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	8-UNIMOD:4	ms_run[1]:scan=1.1.9231.9	111.5857	3	1531.7629	1531.7664	R	Q	651	664
PSM	DQNTVETLQR	6349	sp|Q01082-2|SPTB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8176.10	83.68436	2	1202.5864	1202.5891	R	M	1835	1845
PSM	VHTECCHGDLLECADDR	6350	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	5-UNIMOD:4,6-UNIMOD:4,13-UNIMOD:4	ms_run[1]:scan=1.1.9390.8	115.7967	4	2085.8289	2085.8303	K	A	265	282
PSM	KEEELQAALAR	6351	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9386.4	115.6822	3	1256.6728	1256.6724	K	L	1081	1092
PSM	RAATLAQELEK	6352	sp|Q14683|SMC1A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9312.4	113.7225	3	1228.6768	1228.6775	K	F	385	396
PSM	LQHLAESWGGK	6353	sp|Q7Z6Z7-2|HUWE1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9530.7	119.5519	3	1224.6235	1224.6251	R	E	163	174
PSM	HIIEDPCTLR	6354	sp|Q7Z6Z7-2|HUWE1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	7-UNIMOD:4	ms_run[1]:scan=1.1.9371.3	115.2767	3	1252.6309	1252.6234	R	H	1826	1836
PSM	GYAVLGGER	6355	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9309.7	113.6468	2	920.4722	920.4716	R	G	469	478
PSM	QAHTMDPQLR	6356	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7613.4	68.95631	3	1195.5802	1195.5768	K	L	71	81
PSM	VTAIHIDPATHR	6357	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8372.7	88.80047	3	1329.7165	1329.7153	R	Q	1052	1064
PSM	DAALATALGDKK	6358	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9293.11	113.2226	2	1172.6248	1172.6401	K	S	146	158
PSM	KFYEQFSK	6359	sp|P07900-2|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9103.3	108.1941	3	1075.5340	1075.5338	K	N	558	566
PSM	RLAPEYEAAATR	6360	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8392.7	89.33528	3	1346.6944	1346.6942	K	L	62	74
PSM	FNYSGSGGR	6361	sp|Q12906-7|ILF3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7570.7	67.8044	2	943.4124	943.4148	K	S	811	820
PSM	SIGTANRPMGAGEALR	6362	sp|Q12906-7|ILF3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9096.11	108.0273	2	1599.8080	1599.8151	K	R	258	274
PSM	AAILETAPK	6363	sp|Q9P2E9|RRBP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8312.7	87.20468	2	912.5302	912.5280	K	E	167	176
PSM	RALIQCAK	6364	sp|P18206|VINC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	6-UNIMOD:4	ms_run[1]:scan=1.1.7191.2	57.74015	3	958.5403	958.5382	K	D	1013	1021
PSM	NIEELQQQNQR	6365	sp|P12270|TPR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8357.6	88.3968	3	1398.7084	1398.6851	R	L	542	553
PSM	GGGQIIPTAR	6366	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8552.3	93.57	3	968.5441	968.5403	R	R	717	727
PSM	DLEEDHACIPIKK	6367	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	8-UNIMOD:4	ms_run[1]:scan=1.1.9498.7	118.6919	3	1566.7702	1566.7712	K	S	560	573
PSM	VDKLDASESLR	6368	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8459.3	91.10133	3	1231.6414	1231.6408	K	K	1610	1621
PSM	VRELISDNQYR	6369	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9116.5	108.5336	3	1391.7166	1391.7157	K	L	36	47
PSM	GGPGGELPR	6370	sp|Q04637-3|IF4G1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7663.7	70.30873	2	838.4300	838.4297	R	G	646	655
PSM	AQMVQEDLEK	6371	sp|P26038|MOES_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8765.9	99.2677	2	1189.5638	1189.5649	K	T	449	459
PSM	DSYGGPPR	6372	sp|P38159-2|RBMX_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7149.7	56.60338	2	847.3842	847.3824	R	R	175	183
PSM	SIRPGLSPYR	6373	sp|Q14697|GANAB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8831.2	101.0302	3	1144.6366	1144.6353	R	A	52	62
PSM	EKYEITEQR	6374	sp|Q02878|RL6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7672.10	70.54848	2	1194.5880	1194.5880	K	K	238	247
PSM	IQFKPDDGTTPER	6375	sp|Q96AE4-2|FUBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8849.6	101.5054	3	1502.7424	1502.7365	R	I	308	321
PSM	ERQQQVEAVELEAK	6376	sp|Q86UP2-4|KTN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9239.9	111.7995	3	1655.8498	1655.8478	K	E	1060	1074
PSM	AREQAEAEVASLNR	6377	sp|P06753-2|TPM3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9010.4	105.7338	3	1542.7711	1542.7750	R	R	41	55
PSM	VVGDVAYDEAK	6378	sp|P11586|C1TC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8623.4	95.43707	3	1164.5695	1164.5663	K	E	252	263
PSM	LTMQNLNDR	6379	sp|P08727|K1C19_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9446.10	117.2961	2	1103.5370	1103.5393	K	L	82	91
PSM	EGNPAEINVERDEK	6380	sp|Q9BXP5-2|SRRT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8393.10	89.36697	3	1598.7505	1598.7536	K	L	591	605
PSM	LTDCVVMRDPASK	6381	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	4-UNIMOD:4,7-UNIMOD:35	ms_run[1]:scan=1.1.7847.5	75.07198	3	1506.7183	1506.7171	K	R	35	48
PSM	RDVSLGTYGSR	6382	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8344.5	88.04932	3	1209.5971	1209.6102	K	A	933	944
PSM	VNGGLNLSR	6383	sp|O15355|PPM1G_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8534.5	93.08933	2	928.5092	928.5090	R	A	390	399
PSM	RVYLGALK	6384	sp|Q6P2Q9|PRP8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9014.2	105.837	3	918.5677	918.5651	K	Y	86	94
PSM	QMVETELK	6385	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8527.6	92.90493	2	976.4910	976.4899	R	L	87	95
PSM	EGLQNMEAR	6386	sp|P31948|STIP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8298.10	86.83578	2	1046.4790	1046.4815	K	L	110	119
PSM	RAFDSAVAK	6387	sp|Q16891-2|MIC60_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7285.2	60.19715	3	963.5236	963.5138	K	A	432	441
PSM	RGDTVATLSER	6388	sp|P22102|PUR2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7779.4	73.31412	3	1203.6232	1203.6208	K	V	965	976
PSM	RGDTVATLSER	6389	sp|P22102|PUR2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7799.6	73.83027	3	1203.6232	1203.6208	K	V	965	976
PSM	DYSSGFGGK	6390	sp|Q14247|SRC8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8448.4	90.80752	2	916.3920	916.3927	K	Y	153	162
PSM	KATDAEADVASLNR	6391	sp|P09493-3|TPM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9281.5	112.8924	3	1459.7269	1459.7267	K	R	77	91
PSM	KATDAEADVASLNR	6392	sp|P09493-3|TPM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9243.7	111.9024	3	1459.7269	1459.7267	K	R	77	91
PSM	GSGTAEVELKK	6393	sp|P14618-2|KPYM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7202.5	58.04568	3	1117.6015	1117.5979	K	G	126	137
PSM	LAQFIGNR	6394	sp|O00567|NOP56_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9501.4	118.7675	2	917.5068	917.5083	R	R	213	221
PSM	DHTLVQTIAR	6395	sp|Q14684|RRP1B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9447.5	117.3147	3	1152.6301	1152.6251	K	G	205	215
PSM	RQPEAVHLLDK	6396	sp|Q92621|NU205_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8778.2	99.60633	4	1304.7217	1304.7201	R	I	31	42
PSM	VVTQNICQYR	6397	sp|Q8N163|CCAR2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	7-UNIMOD:4	ms_run[1]:scan=1.1.9273.10	112.691	2	1279.6262	1279.6343	R	S	748	758
PSM	KLPEYNPR	6398	sp|Q9P258|RCC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7917.2	76.8911	3	1015.5460	1015.5450	K	T	513	521
PSM	AAHSEGNTTAGLDMR	6399	sp|P78371|TCPB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7917.10	76.90443	3	1529.6929	1529.6892	R	E	467	482
PSM	YKAEDEVQR	6400	sp|P0DMV8-2|HS71A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7045.4	53.77502	3	1136.5513	1136.5462	K	E	470	479
PSM	VEEISPNIR	6401	sp|Q9UHB9|SRP68_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9240.8	111.8245	2	1055.5598	1055.5611	R	Y	237	246
PSM	VKGDVDVSLPK	6402	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9310.3	113.6671	3	1155.6532	1155.6499	K	L	2131	2142
PSM	TAPGMGDQSGCYR	6403	sp|Q9BWF3|RBM4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	11-UNIMOD:4	ms_run[1]:scan=1.1.7928.7	77.19172	3	1398.5761	1398.5656	R	C	152	165
PSM	LQQTYAALNSK	6404	sp|P46940|IQGA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8769.11	99.3787	2	1235.6462	1235.6510	K	A	1506	1517
PSM	TTANAIYCPPK	6405	sp|O00231-2|PSD11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	8-UNIMOD:4	ms_run[1]:scan=1.1.8781.4	99.69033	3	1234.6099	1234.6016	R	L	195	206
PSM	YLAPSGPSGTLK	6406	sp|Q16658|FSCN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9394.9	115.9061	2	1189.6320	1189.6343	R	A	230	242
PSM	IEGDNENKLPR	6407	sp|P51114|FXR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7528.6	66.6724	3	1283.6518	1283.6469	R	E	318	329
PSM	HADIVTTTTHK	6408	sp|P34897-2|GLYM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.6945.6	51.149	3	1222.6351	1222.6306	K	T	260	271
PSM	HSEAATAQREEWK	6409	sp|Q14103-3|HNRPD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7354.5	61.99342	4	1541.7301	1541.7222	R	M	86	99
PSM	EQYQQQQQWGSR	6410	sp|Q14103-3|HNRPD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8605.11	94.96595	2	1564.6976	1564.7019	K	G	261	273
PSM	TAVCDIPPR	6411	sp|Q9BVA1|TBB2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	4-UNIMOD:4	ms_run[1]:scan=1.1.9007.8	105.6604	2	1027.4974	1027.5121	K	G	351	360
PSM	TAVCDIPPR	6412	sp|Q9BVA1|TBB2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	4-UNIMOD:4	ms_run[1]:scan=1.1.9029.9	106.2499	2	1027.4974	1027.5121	K	G	351	360
PSM	TAVCDIPPR	6413	sp|Q9BVA1|TBB2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	4-UNIMOD:4	ms_run[1]:scan=1.1.9158.8	109.6393	2	1027.5000	1027.5121	K	G	351	360
PSM	TAVCDIPPR	6414	sp|Q9BVA1|TBB2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	4-UNIMOD:4	ms_run[1]:scan=1.1.8281.8	86.3791	2	1027.5112	1027.5121	K	G	351	360
PSM	TAVCDIPPR	6415	sp|Q9BVA1|TBB2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	4-UNIMOD:4	ms_run[1]:scan=1.1.8946.9	104.0409	2	1027.5122	1027.5121	K	G	351	360
PSM	ITTGAQDDLRK	6416	sp|Q9Y4W6|AFG32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7257.7	59.48886	3	1216.6435	1216.6412	R	V	642	653
PSM	VVGSEFVQK	6417	sp|P43686|PRS6B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8902.8	102.8864	2	991.5336	991.5339	R	Y	230	239
PSM	HGSYEDAVHSGALND	6418	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9316.11	113.8412	2	1570.6592	1570.6648	K	-	542	557
PSM	FMGTELNGK	6419	sp|O43175|SERA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9505.6	118.8778	2	995.4740	995.4746	K	T	138	147
PSM	VTADVINAAEK	6420	sp|O43175|SERA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9122.2	108.6845	3	1129.5979	1129.5979	K	L	59	70
PSM	SSENPNEVFR	6421	sp|P45974-2|UBP5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8822.4	100.7947	3	1177.5529	1177.5363	R	F	453	463
PSM	QAVDVSPLR	6422	sp|P46782|RS5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9341.7	114.4901	2	983.5414	983.5400	R	R	137	146
PSM	QSLSHMLSAK	6423	sp|P53618|COPB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9339.3	114.4319	3	1100.5684	1100.5648	R	L	637	647
PSM	GHQFSCVCLHGDR	6424	sp|Q92499-3|DDX1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	6-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.8611.2	95.11143	4	1571.6773	1571.6722	K	K	409	422
PSM	QNCVTELASHPSR	6425	sp|Q32P28|P3H1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	3-UNIMOD:4	ms_run[1]:scan=1.1.8562.4	93.84103	3	1497.6907	1497.6994	K	E	280	293
PSM	LDYGQHVVAGTPGR	6426	sp|P38919|IF4A3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9342.6	114.5144	3	1468.7422	1468.7423	K	V	153	167
PSM	NCTYTQVQTR	6427	sp|P23193|TCEA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	2-UNIMOD:4	ms_run[1]:scan=1.1.7509.10	66.17065	2	1269.5782	1269.5772	K	S	270	280
PSM	SSYIAASTAKPPK	6428	sp|Q7Z2T5|TRM1L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7751.9	72.6048	3	1319.7103	1319.7085	K	E	214	227
PSM	LFGAGGGK	6429	sp|Q9H444|CHM4B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7862.2	75.45548	2	705.3824	705.3810	K	A	7	15
PSM	EANEILQR	6430	sp|P12268|IMDH2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8147.8	82.93072	2	971.5026	971.5036	K	S	196	204
PSM	AVLIAGQPGTGK	6431	sp|Q9Y230-2|RUVB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8658.3	96.37607	3	1110.6418	1110.6397	R	T	27	39
PSM	ICNQVLVCER	6432	sp|Q9P2R7-2|SUCB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	2-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.9394.10	115.9077	2	1289.6158	1289.6220	R	K	129	139
PSM	VCALLSCTSHK	6433	sp|P15121|ALDR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	2-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=1.1.8623.5	95.43874	3	1274.6134	1274.6111	R	D	298	309
PSM	ALHQYTLEPSEK	6434	sp|Q9UBF2|COPG2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8876.4	102.2124	3	1414.7086	1414.7092	K	P	561	573
PSM	GLGATTHPTAAVK	6435	sp|P52789|HXK2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7409.5	63.4733	3	1222.6687	1222.6670	K	M	50	63
PSM	TTHFVEGGDAGNREDQINR	6436	sp|P18124|RL7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8297.10	86.80932	3	2114.9683	2114.9730	K	L	224	243
PSM	NTTGSTIAEIR	6437	sp|Q9ULU4-19|PKCB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8945.10	104.0158	2	1161.5962	1161.5990	K	R	978	989
PSM	NNYHPVEDACWKPGQK	6438	sp|P18858-3|DNLI1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	10-UNIMOD:4	ms_run[1]:scan=1.1.9409.6	116.3051	4	1941.8821	1941.8792	K	V	240	256
PSM	LWDCETGK	6439	sp|Q13347|EIF3I_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	4-UNIMOD:4	ms_run[1]:scan=1.1.8710.7	97.78249	2	1007.4392	1007.4382	R	Q	78	86
PSM	SLDHQGINFK	6440	sp|Q96ST3|SIN3A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9215.3	111.1463	3	1157.5843	1157.5829	K	Q	728	738
PSM	ALEIYQTK	6441	sp|Q07866-4|KLC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9388.7	115.7411	2	964.5222	964.5229	R	L	365	373
PSM	QELSHALYQHDAACR	6442	sp|Q9UMS4|PRP19_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	14-UNIMOD:4	ms_run[1]:scan=1.1.8707.10	97.70737	3	1797.8179	1797.8216	R	V	101	116
PSM	HRELFLSR	6443	sp|O94776|MTA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8643.3	95.97298	3	1056.5818	1056.5828	R	Q	85	93
PSM	VREEILAK	6444	sp|Q9H0D6|XRN2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7515.3	66.31902	3	956.5663	956.5654	R	G	135	143
PSM	NKFDVDAADEK	6445	sp|Q9H0D6|XRN2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7952.6	77.81682	3	1250.5888	1250.5779	K	F	523	534
PSM	RPVHLDQAAFR	6446	sp|Q9H0D6|XRN2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8822.5	100.7964	3	1308.6970	1308.7051	R	T	806	817
PSM	VNELREELQR	6447	sp|Q9BUJ2-2|HNRL1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9192.3	110.539	3	1284.6751	1284.6786	K	R	8	18
PSM	LNQDQLDAVSK	6448	sp|Q14444-2|CAPR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9088.8	107.8158	2	1229.6200	1229.6252	R	Y	88	99
PSM	TPNTFAVCTEHR	6449	sp|Q12756-2|KIF1A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	8-UNIMOD:4	ms_run[1]:scan=1.1.8697.7	97.43228	3	1431.6565	1431.6565	K	G	1747	1759
PSM	EASFSPTDNK	6450	sp|Q9C0J8|WDR33_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7578.9	68.0235	2	1094.4918	1094.4880	R	F	207	217
PSM	GPHPSQGPIPFQQQK	6451	sp|Q9C0J8|WDR33_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9285.9	113.0046	3	1644.8329	1644.8373	R	T	892	907
PSM	ILGPQGNTIK	6452	sp|Q07666|KHDR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8540.2	93.24512	3	1039.6048	1039.6026	K	R	176	186
PSM	LPSGQYLQR	6453	sp|Q15031|SYLM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9370.8	115.2582	2	1060.5714	1060.5665	R	E	606	615
PSM	GAAACDLVQR	6454	sp|Q8IZ83|A16A1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	5-UNIMOD:4	ms_run[1]:scan=1.1.8160.9	83.26646	2	1059.4926	1059.5131	R	F	346	356
PSM	ALEHSALAINHK	6455	sp|Q9NRF8|PYRG2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7723.8	71.9005	3	1302.7033	1302.7044	K	L	320	332
PSM	GSDASGQLFHGR	6456	sp|P19174-2|PLCG1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8356.5	88.3685	3	1230.5767	1230.5742	R	A	1233	1245
PSM	YQEGGVESAFHK	6457	sp|P40121-2|CAPG_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9079.5	107.5744	3	1350.6223	1350.6204	K	T	116	128
PSM	VGNLTVVGK	6458	sp|P17174-2|AATC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8508.4	92.40168	2	885.5296	885.5284	R	E	247	256
PSM	INVSGLTTK	6459	sp|P17174-2|AATC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9475.8	118.0753	2	931.5320	931.5338	R	N	367	376
PSM	LSNNYYCTR	6460	sp|O95182|NDUA7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	7-UNIMOD:4	ms_run[1]:scan=1.1.8355.8	88.3468	2	1189.5172	1189.5186	K	D	49	58
PSM	VVGCSCVVVK	6461	sp|P25398|RS12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	4-UNIMOD:4,6-UNIMOD:4	ms_run[1]:scan=1.1.8306.11	87.05231	2	1105.5740	1105.5624	K	D	103	113
PSM	SVQTTLQTDEVK	6462	sp|O94905|ERLN2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9339.10	114.4436	2	1347.6858	1347.6882	R	N	61	73
PSM	AQQVAVQEQEIAR	6463	sp|O75955-2|FLOT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8942.7	103.9305	3	1468.7602	1468.7634	R	R	214	227
PSM	AHLTNQYMQR	6464	sp|Q13310-2|PABP4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7890.7	76.20448	3	1260.6073	1260.6033	K	V	376	386
PSM	SSAEVIAQAR	6465	sp|Q16555-2|DPYL2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7679.7	70.72491	2	1030.5388	1030.5407	K	K	223	233
PSM	RLQDVSGQLSSSK	6466	sp|Q15059|BRD3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8390.7	89.2821	3	1403.7373	1403.7368	K	K	671	684
PSM	AAAASVPNADGLK	6467	sp|A1X283|SPD2B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8755.7	98.9941	2	1183.6174	1183.6197	K	D	839	852
PSM	VQEMNYIQK	6468	sp|O60488-2|ACSL4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9108.8	108.3314	2	1151.5638	1151.5645	K	T	348	357
PSM	QFLSETEK	6469	sp|P09936|UCHL1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8434.11	90.443	2	980.4824	980.4815	K	M	116	124
PSM	VLEENQEHYHIVQK	6470	sp|P57740|NU107_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8498.5	92.13898	4	1764.8813	1764.8795	R	F	504	518
PSM	YVLEDGPEEDRK	6471	sp|Q15813-2|TBCE_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8707.7	97.70237	3	1448.6788	1448.6783	R	E	89	101
PSM	SAFSGGYYR	6472	sp|Q96DA6-2|TIM14_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9521.6	119.308	2	1006.4482	1006.4508	K	G	18	27
PSM	EFHLNESGDPSSK	6473	sp|Q01105|SET_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8795.7	100.0714	3	1445.6473	1445.6423	K	S	155	168
PSM	LCDSYEIRPGK	6474	sp|O43390-2|HNRPR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	2-UNIMOD:4	ms_run[1]:scan=1.1.9014.5	105.842	3	1336.6432	1336.6445	K	H	225	236
PSM	KDLENEIK	6475	sp|O76041|NEBL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7724.2	71.91687	3	987.5377	987.5236	K	G	414	422
PSM	ALQAQEIECR	6476	sp|Q8NBJ5|GT251_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	9-UNIMOD:4	ms_run[1]:scan=1.1.8700.4	97.50815	3	1216.5883	1216.5870	R	L	361	371
PSM	GLEEENAQLR	6477	sp|Q96AQ6-2|PBIP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8609.9	95.06952	2	1157.5660	1157.5676	K	G	276	286
PSM	QAESLSLTR	6478	sp|Q15154-2|PCM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8812.7	100.5299	2	1003.5266	1003.5298	R	E	367	376
PSM	KGDGAPVTTVPVPNR	6479	sp|Q8IVW6-4|ARI3B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8949.8	104.1196	3	1506.8125	1506.8155	R	L	388	403
PSM	HTDTDVLEACSK	6480	sp|Q8N3U4-2|STAG2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	10-UNIMOD:4	ms_run[1]:scan=1.1.8136.6	82.64668	3	1374.6121	1374.6086	K	T	623	635
PSM	DDDIEEGDLPEHK	6481	sp|Q14696|MESD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9222.7	111.3405	3	1510.6423	1510.6423	K	R	73	86
PSM	IYFTDSSSK	6482	sp|Q9HDC9|APMAP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9096.8	108.0223	2	1046.4912	1046.4920	K	W	212	221
PSM	PIDYYTETK	6483	sp|Q15738|NSDHL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9215.9	111.1563	2	1128.5394	1128.5339	K	I	168	177
PSM	RVGLSGAPADACSTAQK	6484	sp|Q8NFW8|NEUA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	12-UNIMOD:4	ms_run[1]:scan=1.1.7928.10	77.19672	3	1687.8337	1687.8312	K	A	383	400
PSM	AIEENNNFSK	6485	sp|P16949-2|STMN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7650.6	69.95705	3	1164.5455	1164.5411	K	M	86	96
PSM	TNEAQAIETAR	6486	sp|P61088|UBE2N_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8277.3	86.26395	3	1202.5912	1202.5891	K	A	131	142
PSM	TENCLSSCVDR	6487	sp|Q9Y5J9|TIM8B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	4-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.8208.11	84.50761	2	1339.5498	1339.5497	R	F	52	63
PSM	STSQTFIYK	6488	sp|O60341-2|KDM1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9275.7	112.7383	2	1073.5332	1073.5393	R	C	633	642
PSM	SDPYHATSGALSPAK	6489	sp|P17302|CXA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8621.7	95.38837	3	1500.7204	1500.7209	K	D	244	259
PSM	HILANFK	6490	sp|P13693-2|TCTP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8654.3	96.26873	2	841.4820	841.4810	K	N	90	97
PSM	HILANFK	6491	sp|P13693-2|TCTP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8635.3	95.75787	2	841.4824	841.4810	K	N	90	97
PSM	NFDQEGLVEHCK	6492	sp|Q9Y508-2|RN114_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	11-UNIMOD:4	ms_run[1]:scan=1.1.9491.10	118.5087	2	1474.6482	1474.6511	K	L	150	162
PSM	ALVHERDEAAYGELR	6493	sp|Q9UL46|PSME2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9457.5	117.5851	4	1727.8609	1727.8591	R	A	189	204
PSM	LEENHELFSK	6494	sp|Q9UEY8|ADDG_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9042.4	106.5889	3	1244.6038	1244.6037	K	S	608	618
PSM	WSTANPSTVAGR	6495	sp|O75122|CLAP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9180.10	110.2344	2	1245.6156	1245.6102	K	V	339	351
PSM	GVPHPEDDHSQVEGPESLR	6496	sp|Q6P996-5|PDXD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9523.7	119.3633	4	2083.9569	2083.9559	K	-	743	762
PSM	TKTEEDETSEDANCLALSGHDK	6497	sp|P51003|PAPOA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	14-UNIMOD:4	ms_run[1]:scan=1.1.9356.9	114.8861	4	2449.0501	2449.0551	K	T	664	686
PSM	SLVESVSSSPNK	6498	sp|Q9H2U2-2|IPYR2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8494.11	92.04455	2	1232.6064	1232.6248	R	E	324	336
PSM	MRPGVACSVSQAQK	6499	sp|P32969|RL9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	7-UNIMOD:4	ms_run[1]:scan=1.1.7531.7	66.75487	3	1517.7469	1517.7443	R	D	128	142
PSM	KVVVYLQK	6500	sp|P53634|CATC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8189.2	84.00855	3	975.6148	975.6117	K	L	63	71
PSM	HHAAYVNNLNVTEEK	6501	sp|P04179-2|SODM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8694.6	97.34952	4	1737.8153	1737.8434	K	Y	54	69
PSM	RLVTTGVLK	6502	sp|P07305|H10_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8502.3	92.2407	3	985.6306	985.6284	K	Q	74	83
PSM	ALPTSKPEGSLHSSPVGPSSSK	6503	sp|Q9UPT8|ZC3H4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8629.8	95.60482	4	2149.1041	2149.1015	R	G	895	917
PSM	DKEEIVICDR	6504	sp|Q9NRR5|UBQL4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	8-UNIMOD:4	ms_run[1]:scan=1.1.8941.2	103.8954	3	1275.6121	1275.6129	K	A	22	32
PSM	GTAVVNGEFK	6505	sp|P30048-2|PRDX3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8483.7	91.75146	2	1020.5172	1020.5240	K	D	56	66
PSM	GAEHITTYTFNTHK	6506	sp|Q7Z7K6-3|CENPV_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9326.3	114.0895	4	1618.7749	1618.7740	K	A	194	208
PSM	ILQEDPTNTAAR	6507	sp|Q15006|EMC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8048.5	80.34332	3	1327.6705	1327.6732	R	K	113	125
PSM	NAAALSQALR	6508	sp|Q8IZQ5|SELH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9519.2	119.2475	3	1013.5633	1013.5618	R	L	50	60
PSM	TSSLPNHSEPDHDTDAGLER	6509	sp|Q69YN4-3|VIR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8257.9	85.75017	4	2176.9685	2176.9621	K	T	577	597
PSM	LVDAICDK	6510	sp|P20337|RAB3B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	6-UNIMOD:4	ms_run[1]:scan=1.1.8319.8	87.39263	2	932.4534	932.4637	R	M	179	187
PSM	VGSDQCLLR	6511	sp|P78310|CXAR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	6-UNIMOD:4	ms_run[1]:scan=1.1.8781.9	99.69867	2	1046.5188	1046.5179	R	L	218	227
PSM	LHPELSGPGVAAK	6512	sp|Q6DD87|ZN787_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8730.5	98.31567	3	1274.6923	1274.6983	R	V	199	212
PSM	LAIQGPEDSPSR	6513	sp|Q15773|MLF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9159.9	109.6678	2	1268.6562	1268.6361	R	Q	230	242
PSM	KQEEETAQLK	6514	sp|Q5R372-8|RBG1L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7368.5	62.36798	3	1202.6068	1202.6142	R	E	195	205
PSM	GTVQALHATGAR	6515	sp|Q7Z4W1|DCXR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7340.6	61.61675	3	1180.6345	1180.6313	R	V	22	34
PSM	NSCNVGGGGGGFK	6516	sp|Q7L2J0|MEPCE_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	3-UNIMOD:4	ms_run[1]:scan=1.1.7379.9	62.66902	2	1209.5258	1209.5197	R	H	151	164
PSM	QEITEGELK	6517	sp|Q92766-2|RREB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7981.10	78.59475	2	1045.5442	1045.5291	K	A	616	625
PSM	QYEINATPK	6518	sp|Q8N3X1-2|FNBP4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8288.9	86.56793	2	1062.5366	1062.5345	K	G	593	602
PSM	VDDLPEDNQER	6519	sp|Q9BVC3|DCC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8053.9	80.48462	2	1328.5830	1328.5844	K	F	327	338
PSM	SQFSDKPVQDR	6520	sp|Q9BWS9-3|CHID1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7368.7	62.37132	3	1305.6334	1305.6313	K	G	38	49
PSM	EDVPEQGKDDVR	6521	sp|Q8N806|UBR7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7196.9	57.88823	3	1385.6395	1385.6423	K	E	238	250
PSM	TALTTTISSR	6522	sp|Q9BV20|MTNA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8693.9	97.32768	2	1049.5696	1049.5717	R	D	351	361
PSM	QLPTAAPDK	6523	sp|P56211-2|ARP19_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7465.8	64.9943	2	939.5110	939.5025	K	T	60	69
PSM	IQEVADELQK	6524	sp|P18085|ARF4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9290.3	113.1288	3	1171.6093	1171.6084	R	M	100	110
PSM	LKPLGEQER	6525	sp|P52888|THOP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7316.4	60.98837	3	1068.5974	1068.5927	K	A	302	311
PSM	SDKPNASDPSVPLK	6526	sp|Q9BQP7|MGME1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8012.7	79.38478	3	1453.7419	1453.7413	R	I	109	123
PSM	MLQPCGPPADKPEEN	6527	sp|Q9BWJ5|SF3B5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	5-UNIMOD:4	ms_run[1]:scan=1.1.8935.8	103.7453	3	1681.7440	1681.7440	K	-	72	87
PSM	VVLLHGPPGTGK	6528	sp|Q15645|PCH2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9231.2	111.5741	3	1173.6889	1173.6870	R	T	174	186
PSM	SKFDEMAK	6529	sp|O15347|HMGB3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7503.2	65.99953	3	954.4510	954.4480	K	A	58	66
PSM	LQETSSQSYVEEQK	6530	sp|Q8N9T8|KRI1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8345.11	88.08577	3	1654.7680	1654.7686	R	Q	145	159
PSM	LGAYYVTGK	6531	sp|Q96BR5|COA7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9430.7	116.8595	2	970.5168	970.5124	K	G	74	83
PSM	KGDDLLETNNPEPEK	6532	sp|Q96RS0|TGS1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9145.10	109.2933	3	1697.8135	1697.8108	K	C	558	573
PSM	LVTCTGYHQVR	6533	sp|Q6RFH5-2|WDR74_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	4-UNIMOD:4	ms_run[1]:scan=1.1.7742.6	72.3716	3	1332.6712	1332.6609	K	V	198	209
PSM	RIWSEYDPGAK	6534	sp|O60840-2|CAC1F_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7915.6	76.84495	3	1320.6349	1320.6462	K	G	1453	1464
PSM	EGSALSHVR	6535	sp|Q3MHD2-2|LSM12_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7153.9	56.71635	2	954.5072	954.4883	K	K	158	167
PSM	LRQEEPQSLQAAVR	6536	sp|P29590-11|PML_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9318.6	113.8855	3	1623.8671	1623.8692	R	T	359	373
PSM	DGAPVATNAFHSPR	6537	sp|Q96S52|PIGS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9349.5	114.6953	3	1438.6963	1438.6953	K	W	342	356
PSM	GDHVIGIVTAK	6538	sp|Q9NQT5-2|EXOS3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9018.4	105.947	3	1108.6249	1108.6241	K	S	114	125
PSM	HRNEVTVELR	6539	sp|O00505|IMA4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7818.7	74.33268	3	1251.6706	1251.6684	R	K	28	38
PSM	ELALGQDR	6540	sp|A6NHG4|DDTL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8301.7	86.91123	2	900.4672	900.4665	K	F	88	96
PSM	NKTEDLEATSEHFK	6541	sp|Q9BV40|VAMP8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9197.9	110.6812	3	1647.7762	1647.7740	R	T	46	60
PSM	IESGELDPER	6542	sp|P20338|RAB4A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8616.11	95.26058	2	1143.5376	1143.5408	K	M	178	188
PSM	TDVGAPFGPQGHR	6543	sp|O00512|BCL9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8959.7	104.3857	3	1337.6479	1337.6477	R	D	424	437
PSM	AFSQSSSLCIHQR	6544	sp|Q8N3J9|ZN664_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	9-UNIMOD:4	ms_run[1]:scan=1.1.9203.10	110.841	3	1519.7116	1519.7202	K	V	179	192
PSM	EVRPDTQYTGR	6545	sp|O43709-3|BUD23_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7454.5	64.69128	3	1320.6415	1320.6422	R	K	282	293
PSM	VLEVASGSGQHAAHFAR	6546	sp|Q96S19-2|MTL26_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8769.6	99.37037	4	1735.8701	1735.8754	R	A	31	48
PSM	LSSASLNIR	6547	sp|P22680|CP7A1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9177.7	110.1491	2	959.5286	959.5400	R	T	356	365
PSM	RFEAEPLPENTNR	6548	sp|Q9BTU6|P4K2A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.9195.8	110.6267	3	1571.7463	1571.7692	R	Q	276	289
PSM	VTHETSAHEGQTEAPSIDEK	6549	sp|P15374|UCHL3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.7432.11	64.10588	4	2164.9925	2164.9873	R	V	146	166
PSM	MAGSPLLWGPR	6550	sp|Q9UHG2|PCSK1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	1-UNIMOD:35	ms_run[1]:scan=1.1.8188.4	83.9863	3	1199.6308	1199.6121	-	A	1	12
PSM	CCAAADPHECYAK	6551	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19	1-UNIMOD:4,2-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.7474.10	65.24207	3	1552.577171	1551.590469	K	V	384	397
PSM	GEPAAAAAPEAGASPVEK	6552	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.8367.8	88.66798	3	1622.794871	1621.794765	K	E	88	106
PSM	YELISETGGSHDK	6553	sp|Q12906|ILF3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.8924.10	103.4574	2	1435.658847	1434.662688	K	R	541	554
PSM	RAEEQMLK	6554	sp|Q14152|EIF3A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.7171.5	57.20008	3	1004.516771	1003.512065	R	E	817	825
PSM	SKSEEAHAEDSVMDHHFR	6555	sp|Q8NC51|PAIRB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.9110.3	108.3747	5	2111.916118	2110.912665	K	K	328	346
PSM	NGRVEIIANDQGNR	6556	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.9070.9	107.344	3	1555.767971	1554.786266	K	I	47	61
PSM	ASNGDAWVEAHGK	6557	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.8571.7	94.08497	3	1341.597671	1340.610928	R	L	147	160
PSM	ASNGDAWVEAHGK	6558	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.8986.6	105.1006	3	1342.599371	1340.610928	R	L	147	160
PSM	VQLTPGQTEVK	6559	sp|Q5T4S7|UBR4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.8637.6	95.8165	2	1199.657047	1198.655752	K	I	3618	3629
PSM	MESYHKPDQQK	6560	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:1	ms_run[1]:scan=1.1.7525.7	66.59358	3	1431.6493	1431.6447	-	L	1	12
PSM	IIHTSVWAGQK	6561	sp|Q6P2Q9|PRP8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.9230.4	111.5505	3	1239.690371	1238.677157	K	R	1821	1832
PSM	LEVQAEEERK	6562	sp|Q9H307|PININ_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.7331.3	61.37892	3	1230.627371	1229.625181	K	Q	177	187
PSM	QKLEEDAEMK	6563	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:28	ms_run[1]:scan=1.1.8914.9	103.1967	2	1202.5503	1202.5484	K	S	215	225
PSM	GIPHLVTHDAR	6564	sp|P62701|RS4X_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.8187.7	83.96571	3	1217.642471	1214.652004	K	T	135	146
PSM	HYPVFENPK	6565	sp|P55265|DSRAD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.9007.9	105.662	2	1129.565447	1129.555644	R	Q	988	997
PSM	CGESGHLAK	6566	sp|P62633|CNBP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.7171.8	57.20508	2	940.4085	940.4067	R	D	57	66
PSM	LPEVQQATK	6567	sp|Q13428|TCOF_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.7788.8	73.552	2	1013.552647	1012.555310	K	A	1130	1139
PSM	HVEEFSPR	6568	sp|Q14566|MCM6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.7514.10	66.30402	2	1001.470047	999.477394	K	A	408	416
PSM	LPQTEQELK	6569	sp|Q9NTJ3|SMC4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.8094.10	81.58027	2	1085.583447	1084.576440	K	E	548	557
PSM	QAVEQQIQSHR	6570	sp|P33176|KINH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:28	ms_run[1]:scan=1.1.9061.10	107.1068	2	1305.6421	1305.6420	K	E	699	710
PSM	AAAAAWEEPSSGNGTAR	6571	sp|Q9P258|RCC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.9412.10	116.3919	3	1645.729271	1644.749212	K	A	6	23
PSM	CYNCGGLDHHAK	6572	sp|Q9H9Z2|LN28A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:385,1-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=1.1.8488.7	91.88115	3	1413.5552	1413.5549	R	E	139	151
PSM	IAEPSVCGR	6573	sp|P33991|MCM4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	19	7-UNIMOD:4	ms_run[1]:scan=1.1.8047.6	80.31799	2	987.4817	987.4802	R	C	322	331
PSM	AEERAEVSELK	6574	sp|P67936|TPM4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.7644.6	69.79552	3	1261.631771	1259.635745	R	C	143	154
PSM	VDNDENEHQLSLR	6575	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.8884.6	102.4214	3	1568.708171	1567.722663	K	T	33	46
PSM	DCQLLEHK	6576	sp|O15164|TIF1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19	2-UNIMOD:4	ms_run[1]:scan=1.1.8142.3	82.7946	3	1042.496171	1041.491330	R	E	245	253
PSM	ANGTTVHVGIHPSK	6577	sp|Q9UNX3|RL26L_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.7628.2	69.3576	4	1417.736894	1416.747361	K	V	90	104
PSM	VDSPTVTTTLK	6578	sp|Q07866|KLC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.9152.10	109.4814	2	1161.629647	1160.628869	K	N	458	469
PSM	MNNSGADEIGK	6579	sp|Q96EP5|DAZP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:1	ms_run[1]:scan=1.1.9208.11	110.9746	2	1176.5069	1176.5076	-	L	1	12
PSM	EGVHGGLINK	6580	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:27	ms_run[1]:scan=1.1.7439.2	64.28075	3	1004.5432	1004.5398	K	K	117	127
PSM	ALHQYTLEPSEK	6581	sp|Q9UBF2|COPG2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	19		ms_run[1]:scan=1.1.8877.10	102.2497	2	1415.7232	1414.7092	K	P	561	573
PSM	AAESGSDFQQR	6582	sp|Q96BP3|PPWD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:1	ms_run[1]:scan=1.1.8528.10	92.93795	2	1236.5348	1236.5366	M	R	2	13
PSM	SLVDYENANK	6583	sp|Q9UNH7|SNX6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.9352.7	114.7777	2	1152.545047	1151.545868	R	A	316	326
PSM	SETVICSSR	6584	sp|P50552|VASP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:1,6-UNIMOD:4	ms_run[1]:scan=1.1.8965.7	104.5467	2	1079.4903	1079.4912	M	A	2	11
PSM	TVGIVGNQPK	6585	sp|P05166|PCCB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.7721.9	71.84855	2	1012.562647	1011.571295	R	V	351	361
PSM	TSEVIEDEK	6586	sp|Q9BV86|NTM1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:1	ms_run[1]:scan=1.1.9329.6	114.173	2	1090.4987	1090.5025	M	Q	2	11
PSM	QEDEWDKPR	6587	sp|P13674-2|P4HA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:28	ms_run[1]:scan=1.1.9195.9	110.6284	2	1184.5035	1184.5093	K	I	328	337
PSM	EAPPMEKPEVVK	6588	sp|P62841|RS15_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.8344.8	88.05431	3	1352.701571	1352.700988	K	T	66	78
PSM	TRPDGNCFYR	6589	sp|Q96FW1|OTUB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19	7-UNIMOD:4	ms_run[1]:scan=1.1.8195.6	84.16815	3	1285.554971	1284.566954	K	A	85	95
PSM	QKPVQTFTEEK	6590	sp|Q9NYL9|TMOD3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:28	ms_run[1]:scan=1.1.9148.9	109.3723	2	1316.6569	1316.6607	K	V	102	113
PSM	TIMQLCHDR	6591	sp|P19388|RPAB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19	6-UNIMOD:4	ms_run[1]:scan=1.1.8696.5	97.402	3	1173.546371	1172.543048	K	G	16	25
PSM	LADINYEGR	6592	sp|P52948|NUP98_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	19		ms_run[1]:scan=1.1.9397.7	115.9838	2	1049.5302	1049.5132	R	L	843	852
PSM	EQGNIEEAVR	6593	sp|O15294|OGT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.8231.7	85.09293	2	1144.556047	1143.552016	R	L	339	349
PSM	LSEHTEDLPK	6594	sp|Q9H3P2|NELFA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.7709.5	71.5222	3	1168.590971	1167.577168	K	A	482	492
PSM	EIRPTYAGSK	6595	sp|O14519|CDKA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.7280.4	60.07152	3	1121.591771	1120.587673	K	S	76	86
PSM	GSAPPGPVPEGSIR	6596	sp|P78417|GSTO1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.9168.11	109.9136	2	1320.679847	1319.683364	K	I	12	26
PSM	LAQYEPPQEEK	6597	sp|Q99417|MYCBP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.8441.10	90.62928	2	1331.641047	1330.640496	K	R	90	101
PSM	QLVHSFTEGR	6598	sp|Q5ZPR3|CD276_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.8740.4	98.58369	3	1175.588171	1172.593821	K	D	292	302
PSM	SGSSGTPYLGSK	6599	sp|Q9BX40|LS14B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:1	ms_run[1]:scan=1.1.9268.9	112.5589	2	1181.5533	1181.5559	M	I	2	14
PSM	AGAVEQLR	6600	sp|P08240|SRPRA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	19		ms_run[1]:scan=1.1.7470.9	65.13188	2	842.4611	842.4605	R	T	459	467
PSM	EHFAQFGHVR	6601	sp|Q9GZT3|SLIRP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.8786.4	99.82481	3	1227.598871	1226.594490	K	R	37	47
PSM	RGDTYELQVR	6602	sp|Q9H0U3|MAGT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.8857.2	101.7091	3	1236.624371	1235.625849	K	G	150	160
PSM	VENACYALK	6603	sp|Q99598|TSNAX_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19	5-UNIMOD:4	ms_run[1]:scan=1.1.8443.9	90.68145	2	1066.494047	1066.511731	K	V	253	262
PSM	EGQLNGSSAAHSEIR	6604	sp|Q9BPY3|F118B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.7899.8	76.43739	3	1555.719371	1554.738647	R	G	333	348
PSM	RPANQFVPR	6605	sp|P67870|CSK2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.7773.6	73.16143	3	1084.607471	1083.593761	K	L	178	187
PSM	QRDSEIMQQK	6606	sp|P84101|SERF2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:28	ms_run[1]:scan=1.1.7851.10	75.1841	2	1244.5881	1244.5814	K	Q	38	48
PSM	EAAVMKEIK	6607	sp|P00519|ABL1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	19		ms_run[1]:scan=1.1.8039.9	80.10723	2	1017.5467	1017.5523	K	H	286	295
PSM	SQAEFEK	6608	sp|P07108|ACBP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:1	ms_run[1]:scan=1.1.8287.5	86.53445	2	879.3991	879.3969	M	A	2	9
PSM	GVVPDNHPYCVGAAR	6609	sp|Q9UJ83|HACL1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	19	10-UNIMOD:4	ms_run[1]:scan=1.1.9375.6	115.3887	3	1612.7672	1610.7622	K	S	252	267
PSM	QAMLQLYVLK	6610	sp|Q9ULQ0|STRP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	19	3-UNIMOD:35	ms_run[1]:scan=1.1.8042.4	80.17975	3	1221.6688	1221.6786	K	L	702	712
PSM	RSENEEFVEVGR	6611	sp|P10644|KAP0_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	19		ms_run[1]:scan=1.1.9270.8	112.6096	3	1449.6809	1449.6843	R	L	306	318
PSM	KDFVGLDTDSR	6612	sp|Q96Q05|TPPC9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	19		ms_run[1]:scan=1.1.7360.5	62.1545	3	1251.6242	1251.6092	K	H	185	196
PSM	DAAGLECKPR	6613	sp|Q9BXP5|SRRT_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19	7-UNIMOD:4	ms_run[1]:scan=1.1.7142.9	56.41488	2	1115.541047	1115.539343	K	P	406	416
PSM	PAPAVGEAEDK	6614	sp|P16989|YBOX3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.7184.8	57.55972	2	1082.526047	1082.524404	R	E	301	312
PSM	FTCSESQVNSR	6615	sp|P11717|MPRI_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19	3-UNIMOD:4	ms_run[1]:scan=1.1.7415.11	63.64557	2	1313.568247	1313.567014	R	P	1474	1485
PSM	VSGIGPSAAR	6616	sp|P06746|DPOLB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.7479.8	65.3741	2	915.491047	913.498130	R	K	103	113
PSM	TDRGGDSIGETPTPGASK	6617	sp|O75533|SF3B1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.7553.11	67.35291	3	1743.821171	1744.822771	R	R	316	334
PSM	AGFAGDDAPR	6618	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.7744.2	72.41115	3	976.446671	975.441009	K	A	21	31
PSM	KDSSDSGVR	6619	sp|Q9ULH0|KDIS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.7752.3	72.62027	2	951.447847	949.446488	K	S	1581	1590
PSM	GRDAFPVAGQK	6620	sp|P54725|RD23A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.7794.7	73.70723	2	1143.578247	1144.598906	K	L	37	48
PSM	TRPESICSVTPSTHDK	6621	sp|Q9HAU0|PKHA5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19	7-UNIMOD:4	ms_run[1]:scan=1.1.7806.6	74.0142	4	1812.867694	1813.862862	K	T	467	483
PSM	EATPVVHETEPESGSQPR	6622	sp|Q9Y520|PRC2C_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.7821.11	74.41807	3	1948.911671	1948.912649	K	P	639	657
PSM	KFVESECPEK	6623	sp|Q9NYC9|DYH9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19	7-UNIMOD:4	ms_run[1]:scan=1.1.7923.5	77.05683	3	1250.588771	1251.580539	K	E	3826	3836
PSM	ELAEAAAR	6624	sp|Q92806|KCNJ9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.7972.5	78.35088	2	828.430647	829.429381	R	L	337	345
PSM	AQEPSAAIPK	6625	sp|Q15459|SF3A1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.7979.10	78.54147	2	1009.516447	1010.539660	K	V	106	116
PSM	HLTYENVER	6626	sp|P62491|RB11A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.8042.10	80.18975	2	1158.567847	1159.562186	K	W	96	105
PSM	AKGETAYLPCK	6627	sp|P78310|CXAR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19	10-UNIMOD:4	ms_run[1]:scan=1.1.8073.10	81.02005	2	1238.605847	1236.617259	K	F	32	43
PSM	NGYDYGQCR	6628	sp|Q13242|SRSF9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19	8-UNIMOD:4	ms_run[1]:scan=1.1.8287.10	86.54279	2	1132.423047	1131.440357	R	L	73	82
PSM	PVIDNPNYK	6629	sp|P27824|CALX_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.8313.9	87.23455	2	1059.544247	1058.539660	R	G	372	381
PSM	GSFSGQAQPLR	6630	sp|Q92609|TBCD5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.8416.10	89.96223	2	1145.566647	1146.578171	R	T	729	740
PSM	PLTQEEIAQR	6631	sp|Q7Z2Z2|EFL1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.8497.8	92.11785	2	1183.617847	1183.619701	R	R	432	442
PSM	LSELAVEK	6632	sp|O75717|WDHD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.8571.6	94.0833	2	886.498047	887.496398	K	A	812	820
PSM	GNLGAGNGNLQGPR	6633	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.8615.11	95.2337	2	1324.645247	1323.664360	R	H	374	388
PSM	AVSHEDQFLR	6634	sp|O14672|ADA10_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.8681.3	96.9938	3	1202.595071	1200.588736	R	L	52	62
PSM	ELDSQLNEPR	6635	sp|P52948|NUP98_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.8707.10	97.70737	2	1198.571047	1199.578230	K	E	1285	1295
PSM	AGVAPLQVK	6636	sp|P21333|FLNA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.8734.4	98.4218	2	882.533447	881.533452	K	V	1478	1487
PSM	MALVADEQQR	6637	sp|Q99856|ARI3A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.8748.10	98.80985	2	1160.590847	1159.565557	K	L	463	473
PSM	APAPKPELIAAEK	6638	sp|Q9Y5K6|CD2AP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.8769.7	99.37203	3	1332.751571	1333.760552	K	K	347	360
PSM	IMGPNYTPGK	6639	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.8928.9	103.5613	2	1075.543247	1076.532466	R	K	429	439
PSM	DPNIVIAK	6640	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.8950.4	104.1397	2	870.493247	868.501818	K	M	426	434
PSM	PVSSAASVYAGAGGSGSR	6641	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.8957.11	104.3389	3	1579.759271	1579.759048	R	I	28	46
PSM	PGGYGYGYGR	6642	sp|P98179|RBM3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.8959.8	104.3874	2	1045.459647	1045.461744	R	S	122	132
PSM	AQEPESGLSEETQVK	6643	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.9086.9	107.7656	3	1629.776471	1630.768610	R	C	4091	4106
PSM	AADAEAEVASLNRR	6644	sp|P06753|TPM3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.9129.11	108.8799	2	1471.736047	1471.737919	K	I	79	93
PSM	QENGASVILR	6645	sp|P29692|EF1D_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.9287.6	113.0531	2	1086.565647	1085.582922	R	D	39	49
PSM	EATTDFTVDSR	6646	sp|O75369|FLNB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.9294.8	113.2446	2	1240.555847	1240.557161	R	P	1246	1257
PSM	EAQSLISAAIEPDKK	6647	sp|Q05519|SRS11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.9387.4	115.7091	4	1600.829294	1598.851552	R	E	228	243
PSM	LLEEENQESLR	6648	sp|P48681|NEST_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.9415.9	116.468	2	1358.665847	1358.667774	R	S	883	894
PSM	AADAEAEVASLNR	6649	sp|P06753|TPM3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.9455.11	117.541	2	1315.633247	1315.636808	K	R	79	92
PSM	YLEATGQLPVKK	6650	sp|Q96RP9|EFGM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.9477.5	118.1242	3	1344.738971	1345.760552	K	G	735	747
PSM	LLACIASR	6651	sp|P62241|RS8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19	4-UNIMOD:4	ms_run[1]:scan=1.1.9490.4	118.4718	2	902.502247	902.500772	K	P	171	179
PSM	IRLDTEEQLK	6652	sp|Q8TCS8|PNPT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.9494.5	118.5812	3	1242.653471	1243.677216	K	E	316	326
PSM	LLACIASR	6653	sp|P62241|RS8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19	4-UNIMOD:4	ms_run[1]:scan=1.1.9509.4	118.982	2	902.502247	902.500772	K	P	171	179
PSM	PLSHQPGPEAPALPK	6654	sp|P26640|SYVC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.9523.6	119.3616	3	1536.809471	1537.825277	R	T	215	230