MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	120129ry_604A1-46_JPST000086
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20191005\20191005035049650686^10.242.103.245^taba@jp\Psearch.ProteinPilotExecV5\120129ry_604A1-46_3_5.pilotFin.txt
MTD	software[1]	[MS, MS:1000663, ProteinPilot, 5.0.0.0, 4767]
MTD	software[1]-setting	FASTA=sprot_human_20181121.fasta
MTD	software[1]-setting	PARAGON_VERSION=5.0.0.0, 4767
MTD	software[1]-setting	UI_SAMPLE_TYPE=Identification
MTD	software[1]-setting	UI_CYS_ALKYLATION=Iodoacetamide
MTD	software[1]-setting	UI_DIGESTION=Trypsin + Lys C
MTD	software[1]-setting	UI_INSTRUMENT=TripleTOF 5600
MTD	software[1]-setting	UI_SEARCH_EFFORT=Thorough
MTD	software[1]-setting	UI_ID_FOCUS=Biological modifications
MTD	software[1]-setting	UI_MIN_UNUSED_PROTSCORE=0.0458
MTD	software[1]-setting	MSTOLERANCE=0.05
MTD	software[1]-setting	MSTOLERANCE_U=Daltons
MTD	software[1]-setting	MSMSTOLERANCE=0.1
MTD	software[1]-setting	MSMSTOLERANCE_U=Daltons
MTD	software[2]	[MS, MS:1001207, Mascot, 2.6.1]
MTD	software[2]-setting	DB=sprot_human_mix
MTD	software[2]-setting	DTAXONOMYB=All entries
MTD	software[2]-setting	CLE=Trypsin+Lys-C
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M)
MTD	software[2]-setting	CHARGE=2+ and 3+
MTD	software[2]-setting	TOL=20
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=0.1
MTD	software[2]-setting	ITOLU=Da
MTD	software[2]-setting	PEP_ISOTOPE_ERRORLE=0
MTD	software[2]-setting	PFA=1
MTD	software[2]-setting	MASS=Monoisotopic
MTD	software[2]-setting	INSTRUMENT=ESI-QUAD-TOF
MTD	software[3]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[3]-setting	DB=userFasta.sprot_human_mix_20181121
MTD	software[3]-setting	CLE=[R]|{P},[K]|{}
MTD	software[3]-setting	MODS=Carbamidomethyl (C)
MTD	software[3]-setting	IT_MODS=Oxidation (M)
MTD	software[3]-setting	TOL(-)=20
MTD	software[3]-setting	TOL(+)=20
MTD	software[3]-setting	TOLU=ppm
MTD	software[3]-setting	ITOL=0.1
MTD	software[3]-setting	ITOLU=Daltons
MTD	software[3]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[3]-setting	PFA=1
MTD	software[4]	[MS, MS:1002251, Comet, 2015.02 rev. 0]
MTD	software[4]-setting	Taxon=userFasta.sprot_human_mix_20181121
MTD	software[4]-setting	search_enzyme_number=2
MTD	software[4]-setting	FixMod=Carbamidomethyl (C)
MTD	software[4]-setting	VarMod=Oxidation (M)
MTD	software[4]-setting	max_variable_mods_in_peptide=5
MTD	software[4]-setting	allowed_missed_cleavage=1
MTD	software[4]-setting	peptide_mass_tolerance=20
MTD	software[4]-setting	peptide_mass_units=2
MTD	software[4]-setting	fragment_bin_tol=0.02
MTD	software[4]-setting	fragment_bin_offset=0.0
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[1]-site	M
MTD	variable_mod[1]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P68363|TBA1B_HUMAN	Tubulin alpha-1B chain OS=Homo sapiens OX=9606 GN=TUBA1B PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	55.0	null		0.11	55.0	2	2	2
PRT	sp|P46782|RS5_HUMAN	40S ribosomal protein S5 OS=Homo sapiens OX=9606 GN=RPS5 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	54.0	null		0.14	54.0	3	1	0
PRT	sp|P84243|H33_HUMAN	Histone H3.3 OS=Homo sapiens OX=9606 GN=H3F3A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	54.0	null	111-UNIMOD:4	0.24	54.0	39	1	0
PRT	sp|Q71DI3|H32_HUMAN	Histone H3.2 OS=Homo sapiens OX=9606 GN=HIST2H3A PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	52.0	null	111-UNIMOD:4	0.24	52.0	32	1	0
PRT	sp|P68431|H31_HUMAN	Histone H3.1 OS=Homo sapiens OX=9606 GN=HIST1H3A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	52.0	null	97-UNIMOD:4,111-UNIMOD:4	0.24	52.0	36	1	0
PRT	sp|P50454|SERPH_HUMAN	Serpin H1 OS=Homo sapiens OX=9606 GN=SERPINH1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	51.0	null		0.06	51.0	16	1	0
PRT	sp|Q6FI13|H2A2A_HUMAN	Histone H2A type 2-A OS=Homo sapiens OX=9606 GN=HIST2H2AA3 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	51.0	null		0.23	51.0	3	1	0
PRT	sp|P35221-2|CTNA1_HUMAN	Isoform 2 of Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	50.0	null		0.03	50.0	2	1	0
PRT	sp|P04844-2|RPN2_HUMAN	Isoform 2 of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Homo sapiens OX=9606 GN=RPN2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	50.0	null		0.05	50.0	2	1	0
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	49.0	null		0.03	49.0	31	3	0
PRT	sp|P05386|RLA1_HUMAN	60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	49.0	null	2-UNIMOD:1,9-UNIMOD:4	0.24	49.0	6	1	0
PRT	sp|P0C0S5|H2AZ_HUMAN	Histone H2A.Z OS=Homo sapiens OX=9606 GN=H2AFZ PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	48.0	null		0.23	48.0	1	1	1
PRT	sp|O43809|CPSF5_HUMAN	Cleavage and polyadenylation specificity factor subunit 5 OS=Homo sapiens OX=9606 GN=NUDT21 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	47.0	null		0.13	47.0	5	1	0
PRT	sp|P0C0S8|H2A1_HUMAN	Histone H2A type 1 OS=Homo sapiens OX=9606 GN=HIST1H2AG PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	47.0	null		0.23	47.0	1	1	1
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	46.0	null		0.08	46.0	11	2	0
PRT	sp|P11142|HSP7C_HUMAN	Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	46.0	null		0.05	46.0	1	1	1
PRT	sp|P08727|K1C19_HUMAN	Keratin, type I cytoskeletal 19 OS=Homo sapiens OX=9606 GN=KRT19 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	45.0	null		0.06	45.0	14	1	0
PRT	sp|P55060-3|XPO2_HUMAN	Isoform 3 of Exportin-2 OS=Homo sapiens OX=9606 GN=CSE1L	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	45.0	null		0.08	45.0	11	3	2
PRT	sp|P22314-2|UBA1_HUMAN	Isoform 2 of Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	45.0	null	866-UNIMOD:4	0.04	45.0	5	2	1
PRT	sp|P54819-2|KAD2_HUMAN	Isoform 2 of Adenylate kinase 2, mitochondrial OS=Homo sapiens OX=9606 GN=AK2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	45.0	null		0.11	45.0	3	1	0
PRT	sp|P31939-2|PUR9_HUMAN	Isoform 2 of Bifunctional purine biosynthesis protein PURH OS=Homo sapiens OX=9606 GN=ATIC	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	44.0	null	240-UNIMOD:4	0.05	44.0	4	1	0
PRT	sp|Q99714-2|HCD2_HUMAN	Isoform 2 of 3-hydroxyacyl-CoA dehydrogenase type-2 OS=Homo sapiens OX=9606 GN=HSD17B10	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	44.0	null		0.11	44.0	2	1	0
PRT	sp|P61981|1433G_HUMAN	14-3-3 protein gamma OS=Homo sapiens OX=9606 GN=YWHAG PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	44.0	null	97-UNIMOD:4	0.08	44.0	2	1	0
PRT	sp|P52292|IMA1_HUMAN	Importin subunit alpha-1 OS=Homo sapiens OX=9606 GN=KPNA2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	44.0	null	367-UNIMOD:28	0.04	44.0	1	1	1
PRT	sp|Q99832-2|TCPH_HUMAN	Isoform 2 of T-complex protein 1 subunit eta OS=Homo sapiens OX=9606 GN=CCT7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	43.0	null	307-UNIMOD:4	0.07	43.0	5	1	0
PRT	sp|P35579|MYH9_HUMAN	Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	43.0	null		0.01	43.0	1	1	1
PRT	sp|O76003|GLRX3_HUMAN	Glutaredoxin-3 OS=Homo sapiens OX=9606 GN=GLRX3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	43.0	null	2-UNIMOD:1	0.08	43.0	1	1	1
PRT	sp|Q08211|DHX9_HUMAN	ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001207, Mascot, ]	43.0	null		0.04	43.0	4	2	0
PRT	sp|P40227-2|TCPZ_HUMAN	Isoform 2 of T-complex protein 1 subunit zeta OS=Homo sapiens OX=9606 GN=CCT6A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	42.0	null		0.05	42.0	2	1	0
PRT	sp|P13804-2|ETFA_HUMAN	Isoform 2 of Electron transfer flavoprotein subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=ETFA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	41.0	null		0.07	41.0	1	1	1
PRT	sp|Q9NVM6|DJC17_HUMAN	DnaJ homolog subfamily C member 17 OS=Homo sapiens OX=9606 GN=DNAJC17 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	41.0	null		0.07	41.0	1	1	1
PRT	sp|P35580-2|MYH10_HUMAN	Isoform 2 of Myosin-10 OS=Homo sapiens OX=9606 GN=MYH10	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	41.0	null		0.01	41.0	2	1	0
PRT	sp|Q13838|DX39B_HUMAN	Spliceosome RNA helicase DDX39B OS=Homo sapiens OX=9606 GN=DDX39B PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	41.0	null	300-UNIMOD:385,300-UNIMOD:4	0.05	41.0	3	1	0
PRT	sp|Q07021|C1QBP_HUMAN	Complement component 1 Q subcomponent-binding protein, mitochondrial OS=Homo sapiens OX=9606 GN=C1QBP PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	40.0	null		0.10	40.0	10	1	0
PRT	sp|Q9UQ80-2|PA2G4_HUMAN	Isoform 2 of Proliferation-associated protein 2G4 OS=Homo sapiens OX=9606 GN=PA2G4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	40.0	null		0.09	40.0	1	1	1
PRT	sp|P07355-2|ANXA2_HUMAN	Isoform 2 of Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	40.0	null	280-UNIMOD:4	0.07	40.0	5	1	0
PRT	sp|Q15274|NADC_HUMAN	Nicotinate-nucleotide pyrophosphorylase [carboxylating] OS=Homo sapiens OX=9606 GN=QPRT PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	40.0	null	202-UNIMOD:4	0.14	40.0	3	1	0
PRT	sp|Q6P2Q9|PRP8_HUMAN	Pre-mRNA-processing-splicing factor 8 OS=Homo sapiens OX=9606 GN=PRPF8 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39.0	null		0.01	39.0	2	1	0
PRT	sp|P09874|PARP1_HUMAN	Poly [ADP-ribose] polymerase 1 OS=Homo sapiens OX=9606 GN=PARP1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39.0	null	908-UNIMOD:4	0.03	39.0	1	1	1
PRT	sp|Q9H2W6|RM46_HUMAN	39S ribosomal protein L46, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL46 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39.0	null		0.08	39.0	1	1	1
PRT	sp|O14976|GAK_HUMAN	Cyclin-G-associated kinase OS=Homo sapiens OX=9606 GN=GAK PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	39.0	null	2-UNIMOD:1	0.02	39.0	1	1	1
PRT	sp|Q10713|MPPA_HUMAN	Mitochondrial-processing peptidase subunit alpha OS=Homo sapiens OX=9606 GN=PMPCA PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38.0	null		0.03	38.0	1	1	1
PRT	sp|P31946-2|1433B_HUMAN	Isoform Short of 14-3-3 protein beta/alpha OS=Homo sapiens OX=9606 GN=YWHAB	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38.0	null	94-UNIMOD:4	0.08	38.0	2	1	0
PRT	sp|O75643-2|U520_HUMAN	Isoform 2 of U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens OX=9606 GN=SNRNP200	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38.0	null		0.03	38.0	1	1	1
PRT	sp|Q01970-2|PLCB3_HUMAN	Isoform 2 of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3 OS=Homo sapiens OX=9606 GN=PLCB3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38.0	null		0.02	38.0	1	1	1
PRT	sp|P78527-2|PRKDC_HUMAN	Isoform 2 of DNA-dependent protein kinase catalytic subunit OS=Homo sapiens OX=9606 GN=PRKDC	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38.0	null	931-UNIMOD:4	0.01	38.0	2	2	2
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38.0	null		0.04	38.0	1	1	1
PRT	sp|P62314|SMD1_HUMAN	Small nuclear ribonucleoprotein Sm D1 OS=Homo sapiens OX=9606 GN=SNRPD1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	38.0	null		0.18	38.0	6	1	0
PRT	sp|Q7Z3B4|NUP54_HUMAN	Nucleoporin p54 OS=Homo sapiens OX=9606 GN=NUP54 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	38.0	null	469-UNIMOD:28	0.04	38.0	1	1	1
PRT	sp|P42704|LPPRC_HUMAN	Leucine-rich PPR motif-containing protein, mitochondrial OS=Homo sapiens OX=9606 GN=LRPPRC PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	37.0	null	1277-UNIMOD:4,1277-UNIMOD:385	0.04	37.0	16	3	0
PRT	sp|Q9BUA3|SPNDC_HUMAN	Spindlin interactor and repressor of chromatin-binding protein OS=Homo sapiens OX=9606 GN=SPINDOC PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37.0	null		0.05	37.0	1	1	1
PRT	sp|P05783|K1C18_HUMAN	Keratin, type I cytoskeletal 18 OS=Homo sapiens OX=9606 GN=KRT18 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37.0	null		0.06	37.0	1	1	1
PRT	sp|P12532-2|KCRU_HUMAN	Isoform 2 of Creatine kinase U-type, mitochondrial OS=Homo sapiens OX=9606 GN=CKMT1A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37.0	null	427-UNIMOD:4	0.05	37.0	1	1	1
PRT	sp|O75533|SF3B1_HUMAN	Splicing factor 3B subunit 1 OS=Homo sapiens OX=9606 GN=SF3B1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37.0	null		0.02	37.0	3	1	0
PRT	sp|P06576|ATPB_HUMAN	ATP synthase subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1B PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37.0	null		0.03	37.0	3	1	0
PRT	sp|P29401-2|TKT_HUMAN	Isoform 2 of Transketolase OS=Homo sapiens OX=9606 GN=TKT	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37.0	null	274-UNIMOD:35	0.03	37.0	3	1	0
PRT	sp|O00507-2|USP9Y_HUMAN	Isoform Short of Probable ubiquitin carboxyl-terminal hydrolase FAF-Y OS=Homo sapiens OX=9606 GN=USP9Y	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37.0	null		0.01	37.0	1	1	1
PRT	sp|O14974-2|MYPT1_HUMAN	Isoform 2 of Protein phosphatase 1 regulatory subunit 12A OS=Homo sapiens OX=9606 GN=PPP1R12A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37.0	null		0.02	37.0	2	1	0
PRT	sp|P47756-2|CAPZB_HUMAN	Isoform 2 of F-actin-capping protein subunit beta OS=Homo sapiens OX=9606 GN=CAPZB	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36.0	null	36-UNIMOD:4	0.10	36.0	1	1	1
PRT	sp|P60842-2|IF4A1_HUMAN	Isoform 2 of Eukaryotic initiation factor 4A-I OS=Homo sapiens OX=9606 GN=EIF4A1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36.0	null	264-UNIMOD:4	0.12	36.0	3	2	1
PRT	sp|Q14974-2|IMB1_HUMAN	Isoform 2 of Importin subunit beta-1 OS=Homo sapiens OX=9606 GN=KPNB1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36.0	null	440-UNIMOD:4	0.03	36.0	7	2	1
PRT	sp|Q92616|GCN1_HUMAN	eIF-2-alpha kinase activator GCN1 OS=Homo sapiens OX=9606 GN=GCN1 PE=1 SV=6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001207, Mascot, ]	36.0	null		0.02	36.0	3	3	3
PRT	sp|Q9UHD8-5|SEPT9_HUMAN	Isoform 5 of Septin-9 OS=Homo sapiens OX=9606 GN=SEPT9	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	36.0	null	2-UNIMOD:1	0.04	36.0	2	1	0
PRT	sp|Q96EY1-2|DNJA3_HUMAN	Isoform 2 of DnaJ homolog subfamily A member 3, mitochondrial OS=Homo sapiens OX=9606 GN=DNAJA3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35.0	null		0.05	35.0	1	1	1
PRT	sp|Q15021|CND1_HUMAN	Condensin complex subunit 1 OS=Homo sapiens OX=9606 GN=NCAPD2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35.0	null	439-UNIMOD:4	0.01	35.0	1	1	1
PRT	sp|Q92922|SMRC1_HUMAN	SWI/SNF complex subunit SMARCC1 OS=Homo sapiens OX=9606 GN=SMARCC1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35.0	null		0.02	35.0	1	1	1
PRT	sp|O60684|IMA7_HUMAN	Importin subunit alpha-7 OS=Homo sapiens OX=9606 GN=KPNA6 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35.0	null	208-UNIMOD:4	0.04	35.0	2	1	0
PRT	sp|Q9H583|HEAT1_HUMAN	HEAT repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=HEATR1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35.0	null		0.01	35.0	1	1	1
PRT	sp|Q5T4S7-2|UBR4_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35.0	null		0.00	35.0	2	1	0
PRT	sp|P20700|LMNB1_HUMAN	Lamin-B1 OS=Homo sapiens OX=9606 GN=LMNB1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35.0	null		0.04	35.0	1	1	1
PRT	sp|O75251|NDUS7_HUMAN	NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFS7 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35.0	null	183-UNIMOD:4	0.13	35.0	1	1	1
PRT	sp|P30153|2AAA_HUMAN	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Homo sapiens OX=9606 GN=PPP2R1A PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	35.0	null	2-UNIMOD:1,399-UNIMOD:28	0.07	35.0	3	2	1
PRT	sp|P43246|MSH2_HUMAN	DNA mismatch repair protein Msh2 OS=Homo sapiens OX=9606 GN=MSH2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	35.0	null	176-UNIMOD:4	0.03	35.0	1	1	1
PRT	sp|P31946|1433B_HUMAN	14-3-3 protein beta/alpha OS=Homo sapiens OX=9606 GN=YWHAB PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	35.0	null	96-UNIMOD:4	0.08	35.0	2	1	0
PRT	sp|Q92621|NU205_HUMAN	Nuclear pore complex protein Nup205 OS=Homo sapiens OX=9606 GN=NUP205 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34.0	null	877-UNIMOD:4	0.01	34.0	2	1	0
PRT	sp|P52209-2|6PGD_HUMAN	Isoform 2 of 6-phosphogluconate dehydrogenase, decarboxylating OS=Homo sapiens OX=9606 GN=PGD	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34.0	null		0.04	34.0	1	1	1
PRT	sp|Q9UKN8|TF3C4_HUMAN	General transcription factor 3C polypeptide 4 OS=Homo sapiens OX=9606 GN=GTF3C4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34.0	null		0.02	34.0	1	1	1
PRT	sp|P23193-2|TCEA1_HUMAN	Isoform 2 of Transcription elongation factor A protein 1 OS=Homo sapiens OX=9606 GN=TCEA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34.0	null		0.10	34.0	2	1	0
PRT	sp|O00629|IMA3_HUMAN	Importin subunit alpha-3 OS=Homo sapiens OX=9606 GN=KPNA4 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34.0	null		0.09	34.0	2	2	2
PRT	sp|P15311|EZRI_HUMAN	Ezrin OS=Homo sapiens OX=9606 GN=EZR PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34.0	null		0.03	34.0	6	1	0
PRT	sp|O43823|AKAP8_HUMAN	A-kinase anchor protein 8 OS=Homo sapiens OX=9606 GN=AKAP8 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34.0	null		0.03	34.0	1	1	1
PRT	sp|Q5JTH9-2|RRP12_HUMAN	Isoform 2 of RRP12-like protein OS=Homo sapiens OX=9606 GN=RRP12	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34.0	null	663-UNIMOD:4	0.02	34.0	1	1	0
PRT	sp|Q9UI26|IPO11_HUMAN	Importin-11 OS=Homo sapiens OX=9606 GN=IPO11 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	34.0	null	621-UNIMOD:385,621-UNIMOD:4	0.02	34.0	1	1	0
PRT	sp|Q9NVP1|DDX18_HUMAN	ATP-dependent RNA helicase DDX18 OS=Homo sapiens OX=9606 GN=DDX18 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	34.0	null	597-UNIMOD:28	0.03	34.0	2	1	0
PRT	sp|Q7L1Q6-2|BZW1_HUMAN	Isoform 2 of Basic leucine zipper and W2 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=BZW1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33.0	null	35-UNIMOD:4	0.08	33.0	2	1	0
PRT	sp|Q9BXP5-2|SRRT_HUMAN	Isoform 2 of Serrate RNA effector molecule homolog OS=Homo sapiens OX=9606 GN=SRRT	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33.0	null		0.04	33.0	1	1	1
PRT	sp|O15042-2|SR140_HUMAN	Isoform 2 of U2 snRNP-associated SURP motif-containing protein OS=Homo sapiens OX=9606 GN=U2SURP	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33.0	null		0.02	33.0	1	1	1
PRT	sp|Q9Y2X3|NOP58_HUMAN	Nucleolar protein 58 OS=Homo sapiens OX=9606 GN=NOP58 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33.0	null		0.03	33.0	1	1	1
PRT	sp|Q9GZS3|WDR61_HUMAN	WD repeat-containing protein 61 OS=Homo sapiens OX=9606 GN=WDR61 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33.0	null		0.07	33.0	1	1	1
PRT	sp|O94874-2|UFL1_HUMAN	Isoform 2 of E3 UFM1-protein ligase 1 OS=Homo sapiens OX=9606 GN=UFL1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33.0	null		0.03	33.0	1	1	1
PRT	sp|P37802-2|TAGL2_HUMAN	Isoform 2 of Transgelin-2 OS=Homo sapiens OX=9606 GN=TAGLN2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33.0	null	59-UNIMOD:4	0.09	33.0	1	1	1
PRT	sp|Q96TC7-2|RMD3_HUMAN	Isoform 2 of Regulator of microtubule dynamics protein 3 OS=Homo sapiens OX=9606 GN=RMDN3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33.0	null		0.07	33.0	1	1	1
PRT	sp|Q9BSJ8-2|ESYT1_HUMAN	Isoform 2 of Extended synaptotagmin-1 OS=Homo sapiens OX=9606 GN=ESYT1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33.0	null		0.02	33.0	2	1	0
PRT	sp|O00148|DX39A_HUMAN	ATP-dependent RNA helicase DDX39A OS=Homo sapiens OX=9606 GN=DDX39A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	33.0	null	299-UNIMOD:385,299-UNIMOD:4	0.05	33.0	1	1	1
PRT	sp|Q6DKI1|RL7L_HUMAN	60S ribosomal protein L7-like 1 OS=Homo sapiens OX=9606 GN=RPL7L1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	33.0	null	184-UNIMOD:4	0.08	33.0	1	1	1
PRT	sp|Q5JTH9|RRP12_HUMAN	RRP12-like protein OS=Homo sapiens OX=9606 GN=RRP12 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	33.0	null	763-UNIMOD:4	0.02	33.0	1	1	0
PRT	sp|P13010|XRCC5_HUMAN	X-ray repair cross-complementing protein 5 OS=Homo sapiens OX=9606 GN=XRCC5 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001207, Mascot, ],[MS, MS:1001476, X!Tandem, ]	33.0	null	670-UNIMOD:28	0.14	33.0	5	4	3
PRT	sp|P11388-2|TOP2A_HUMAN	Isoform 2 of DNA topoisomerase 2-alpha OS=Homo sapiens OX=9606 GN=TOP2A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32.0	null	431-UNIMOD:4	0.01	32.0	1	1	1
PRT	sp|Q9H0A0-2|NAT10_HUMAN	Isoform 2 of RNA cytidine acetyltransferase OS=Homo sapiens OX=9606 GN=NAT10	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32.0	null		0.03	32.0	3	1	0
PRT	sp|Q9BXJ9-4|NAA15_HUMAN	Isoform 2 of N-alpha-acetyltransferase 15, NatA auxiliary subunit OS=Homo sapiens OX=9606 GN=NAA15	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32.0	null		0.06	32.0	1	1	1
PRT	sp|P60709|ACTB_HUMAN	Actin, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=ACTB PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32.0	null		0.08	32.0	1	1	1
PRT	sp|P55957-2|BID_HUMAN	Isoform 2 of BH3-interacting domain death agonist OS=Homo sapiens OX=9606 GN=BID	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32.0	null		0.07	32.0	2	1	0
PRT	sp|Q9C005|DPY30_HUMAN	Protein dpy-30 homolog OS=Homo sapiens OX=9606 GN=DPY30 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	32.0	null		0.37	32.0	6	2	1
PRT	sp|P63208-2|SKP1_HUMAN	Isoform 2 of S-phase kinase-associated protein 1 OS=Homo sapiens OX=9606 GN=SKP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32.0	null		0.13	32.0	2	1	0
PRT	sp|O75506|HSBP1_HUMAN	Heat shock factor-binding protein 1 OS=Homo sapiens OX=9606 GN=HSBP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32.0	null		0.26	32.0	2	1	0
PRT	sp|P52789|HXK2_HUMAN	Hexokinase-2 OS=Homo sapiens OX=9606 GN=HK2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32.0	null	133-UNIMOD:4	0.02	32.0	1	1	1
PRT	sp|P26599-2|PTBP1_HUMAN	Isoform 2 of Polypyrimidine tract-binding protein 1 OS=Homo sapiens OX=9606 GN=PTBP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32.0	null		0.04	32.0	1	1	1
PRT	sp|P54886-2|P5CS_HUMAN	Isoform Short of Delta-1-pyrroline-5-carboxylate synthase OS=Homo sapiens OX=9606 GN=ALDH18A1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|P07384|CAN1_HUMAN	Calpain-1 catalytic subunit OS=Homo sapiens OX=9606 GN=CAPN1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001207, Mascot, ]	32.0	null	677-UNIMOD:4,678-UNIMOD:4	0.03	32.0	2	1	0
PRT	sp|Q7Z4Q2|HEAT3_HUMAN	HEAT repeat-containing protein 3 OS=Homo sapiens OX=9606 GN=HEATR3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|P07900-2|HS90A_HUMAN	Isoform 2 of Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31.0	null		0.03	31.0	1	1	1
PRT	sp|Q5VYK3|ECM29_HUMAN	Proteasome adapter and scaffold protein ECM29 OS=Homo sapiens OX=9606 GN=ECPAS PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31.0	null		0.02	31.0	3	2	1
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|P20618|PSB1_HUMAN	Proteasome subunit beta type-1 OS=Homo sapiens OX=9606 GN=PSMB1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31.0	null		0.08	31.0	2	1	0
PRT	sp|Q8WUM4-2|PDC6I_HUMAN	Isoform 2 of Programmed cell death 6-interacting protein OS=Homo sapiens OX=9606 GN=PDCD6IP	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31.0	null		0.02	31.0	2	1	0
PRT	sp|Q9UI26-2|IPO11_HUMAN	Isoform 2 of Importin-11 OS=Homo sapiens OX=9606 GN=IPO11	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31.0	null	661-UNIMOD:4	0.02	31.0	1	1	0
PRT	sp|P31483-2|TIA1_HUMAN	Isoform Short of Nucleolysin TIA-1 isoform p40 OS=Homo sapiens OX=9606 GN=TIA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31.0	null	33-UNIMOD:4	0.05	31.0	2	1	0
PRT	sp|O00303|EIF3F_HUMAN	Eukaryotic translation initiation factor 3 subunit F OS=Homo sapiens OX=9606 GN=EIF3F PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31.0	null		0.06	31.0	1	1	1
PRT	sp|Q00610-2|CLH1_HUMAN	Isoform 2 of Clathrin heavy chain 1 OS=Homo sapiens OX=9606 GN=CLTC	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31.0	null		0.01	31.0	2	2	2
PRT	sp|P08621|RU17_HUMAN	U1 small nuclear ribonucleoprotein 70 kDa OS=Homo sapiens OX=9606 GN=SNRNP70 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	31.0	null	2-UNIMOD:1	0.04	31.0	1	1	1
PRT	sp|Q96AB3-2|ISOC2_HUMAN	Isoform 2 of Isochorismatase domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ISOC2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null		0.12	30.0	1	1	1
PRT	sp|Q04637-3|IF4G1_HUMAN	Isoform B of Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null	1344-UNIMOD:4	0.01	30.0	1	1	1
PRT	sp|P51114-2|FXR1_HUMAN	Isoform 2 of Fragile X mental retardation syndrome-related protein 1 OS=Homo sapiens OX=9606 GN=FXR1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null		0.03	30.0	2	1	0
PRT	sp|Q9UNM6-2|PSD13_HUMAN	Isoform 2 of 26S proteasome non-ATPase regulatory subunit 13 OS=Homo sapiens OX=9606 GN=PSMD13	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null		0.04	30.0	1	1	1
PRT	sp|Q92499-2|DDX1_HUMAN	Isoform 2 of ATP-dependent RNA helicase DDX1 OS=Homo sapiens OX=9606 GN=DDX1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null		0.03	30.0	4	1	0
PRT	sp|Q13200-2|PSMD2_HUMAN	Isoform 2 of 26S proteasome non-ATPase regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PSMD2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null		0.03	30.0	1	1	1
PRT	sp|Q9BQG0-2|MBB1A_HUMAN	Isoform 2 of Myb-binding protein 1A OS=Homo sapiens OX=9606 GN=MYBBP1A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|Q8N684-2|CPSF7_HUMAN	Isoform 2 of Cleavage and polyadenylation specificity factor subunit 7 OS=Homo sapiens OX=9606 GN=CPSF7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null		0.06	30.0	1	1	1
PRT	sp|P20290|BTF3_HUMAN	Transcription factor BTF3 OS=Homo sapiens OX=9606 GN=BTF3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	30.0	null	142-UNIMOD:28	0.11	30.0	1	1	1
PRT	sp|P78371|TCPB_HUMAN	T-complex protein 1 subunit beta OS=Homo sapiens OX=9606 GN=CCT2 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	30.0	null	502-UNIMOD:28	0.03	30.0	1	1	1
PRT	sp|P04406|G3P_HUMAN	Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30.0	null		0.09	30.0	2	1	0
PRT	sp|P58107|EPIPL_HUMAN	Epiplakin OS=Homo sapiens OX=9606 GN=EPPK1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null		0.03	29.0	1	1	1
PRT	sp|Q71U36-2|TBA1A_HUMAN	Isoform 2 of Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null		0.07	29.0	1	1	1
PRT	sp|P55957|BID_HUMAN	BH3-interacting domain death agonist OS=Homo sapiens OX=9606 GN=BID PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1000663, ProteinPilot, ]	29.0	null		0.08	29.0	1	1	0
PRT	sp|Q9P289-3|STK26_HUMAN	Isoform 3 of Serine/threonine-protein kinase 26 OS=Homo sapiens OX=9606 GN=STK26	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null	77-UNIMOD:4	0.09	29.0	1	1	1
PRT	sp|Q99497|PARK7_HUMAN	Protein/nucleic acid deglycase DJ-1 OS=Homo sapiens OX=9606 GN=PARK7 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null		0.11	29.0	2	1	0
PRT	sp|Q14697-2|GANAB_HUMAN	Isoform 2 of Neutral alpha-glucosidase AB OS=Homo sapiens OX=9606 GN=GANAB	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|P22695|QCR2_HUMAN	Cytochrome b-c1 complex subunit 2, mitochondrial OS=Homo sapiens OX=9606 GN=UQCRC2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null		0.09	29.0	2	1	0
PRT	sp|Q562R1|ACTBL_HUMAN	Beta-actin-like protein 2 OS=Homo sapiens OX=9606 GN=ACTBL2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null	124-UNIMOD:35,133-UNIMOD:35	0.08	29.0	1	1	1
PRT	sp|Q92499|DDX1_HUMAN	ATP-dependent RNA helicase DDX1 OS=Homo sapiens OX=9606 GN=DDX1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29.0	null		0.02	29.0	1	1	0
PRT	sp|P61970|NTF2_HUMAN	Nuclear transport factor 2 OS=Homo sapiens OX=9606 GN=NUTF2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	29.0	null	2-UNIMOD:1	0.20	29.0	1	1	1
PRT	sp|Q9P1F3|ABRAL_HUMAN	Costars family protein ABRACL OS=Homo sapiens OX=9606 GN=ABRACL PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	29.0	null	39-UNIMOD:385,39-UNIMOD:4	0.17	29.0	3	1	0
PRT	sp|Q6IS14|IF5AL_HUMAN	Eukaryotic translation initiation factor 5A-1-like OS=Homo sapiens OX=9606 GN=EIF5AL1 PE=2 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null	129-UNIMOD:4	0.16	28.0	1	1	1
PRT	sp|Q12769|NU160_HUMAN	Nuclear pore complex protein Nup160 OS=Homo sapiens OX=9606 GN=NUP160 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|P14923|PLAK_HUMAN	Junction plakoglobin OS=Homo sapiens OX=9606 GN=JUP PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|Q9H900-2|ZWILC_HUMAN	Isoform 2 of Protein zwilch homolog OS=Homo sapiens OX=9606 GN=ZWILCH	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|Q9H4A6|GOLP3_HUMAN	Golgi phosphoprotein 3 OS=Homo sapiens OX=9606 GN=GOLPH3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null		0.06	28.0	1	1	1
PRT	sp|P00338-3|LDHA_HUMAN	Isoform 3 of L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null		0.06	28.0	1	1	1
PRT	sp|Q15942|ZYX_HUMAN	Zyxin OS=Homo sapiens OX=9606 GN=ZYX PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null		0.04	28.0	1	1	1
PRT	sp|Q9Y490|TLN1_HUMAN	Talin-1 OS=Homo sapiens OX=9606 GN=TLN1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null	2243-UNIMOD:4	0.01	28.0	1	1	1
PRT	sp|Q8NF37|PCAT1_HUMAN	Lysophosphatidylcholine acyltransferase 1 OS=Homo sapiens OX=9606 GN=LPCAT1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null		0.04	28.0	2	1	0
PRT	sp|Q9Y224|RTRAF_HUMAN	RNA transcription, translation and transport factor protein OS=Homo sapiens OX=9606 GN=RTRAF PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	28.0	null	77-UNIMOD:28	0.06	28.0	1	1	1
PRT	sp|Q9Y496|KIF3A_HUMAN	Kinesin-like protein KIF3A OS=Homo sapiens OX=9606 GN=KIF3A PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|O43156|TTI1_HUMAN	TELO2-interacting protein 1 homolog OS=Homo sapiens OX=9606 GN=TTI1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|O60716-10|CTND1_HUMAN	Isoform 2AB of Catenin delta-1 OS=Homo sapiens OX=9606 GN=CTNND1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|Q14671|PUM1_HUMAN	Pumilio homolog 1 OS=Homo sapiens OX=9606 GN=PUM1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	27.0	null	977-UNIMOD:385,977-UNIMOD:4,980-UNIMOD:4	0.02	27.0	1	1	1
PRT	sp|O43818|U3IP2_HUMAN	U3 small nucleolar RNA-interacting protein 2 OS=Homo sapiens OX=9606 GN=RRP9 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	27.0	null	411-UNIMOD:28,416-UNIMOD:4	0.04	27.0	1	1	1
PRT	sp|Q9H936|GHC1_HUMAN	Mitochondrial glutamate carrier 1 OS=Homo sapiens OX=9606 GN=SLC25A22 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27.0	null		0.07	27.0	1	1	1
PRT	sp|P54652|HSP72_HUMAN	Heat shock-related 70 kDa protein 2 OS=Homo sapiens OX=9606 GN=HSPA2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27.0	null		0.05	27.0	1	1	1
PRT	sp|Q9C0K3|ARP3C_HUMAN	Actin-related protein 3C OS=Homo sapiens OX=9606 GN=ACTR3C PE=2 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.06	26.0	2	1	0
PRT	sp|Q9HCJ6|VAT1L_HUMAN	Synaptic vesicle membrane protein VAT-1 homolog-like OS=Homo sapiens OX=9606 GN=VAT1L PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|P06493-2|CDK1_HUMAN	Isoform 2 of Cyclin-dependent kinase 1 OS=Homo sapiens OX=9606 GN=CDK1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.09	26.0	1	1	1
PRT	sp|Q8NFV4|ABHDB_HUMAN	Protein ABHD11 OS=Homo sapiens OX=9606 GN=ABHD11 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26.0	null		0.07	26.0	1	1	0
PRT	sp|Q9BZX2-2|UCK2_HUMAN	Isoform 2 of Uridine-cytidine kinase 2 OS=Homo sapiens OX=9606 GN=UCK2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.23	25.0	1	1	1
PRT	sp|Q9UIA9|XPO7_HUMAN	Exportin-7 OS=Homo sapiens OX=9606 GN=XPO7 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null	194-UNIMOD:4	0.02	25.0	1	1	1
PRT	sp|P06733-2|ENOA_HUMAN	Isoform MBP-1 of Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null	296-UNIMOD:4	0.13	25.0	2	2	2
PRT	sp|Q9UBT2-2|SAE2_HUMAN	Isoform 2 of SUMO-activating enzyme subunit 2 OS=Homo sapiens OX=9606 GN=UBA2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.05	25.0	1	1	1
PRT	sp|P09960-2|LKHA4_HUMAN	Isoform 2 of Leukotriene A-4 hydrolase OS=Homo sapiens OX=9606 GN=LTA4H	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null	200-UNIMOD:4	0.04	25.0	1	1	1
PRT	sp|P10768|ESTD_HUMAN	S-formylglutathione hydrolase OS=Homo sapiens OX=9606 GN=ESD PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25.0	null	45-UNIMOD:385,45-UNIMOD:4,56-UNIMOD:4	0.07	25.0	1	1	1
PRT	sp|Q15631|TSN_HUMAN	Translin OS=Homo sapiens OX=9606 GN=TSN PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25.0	null		0.10	25.0	1	1	1
PRT	sp|Q14204|DYHC1_HUMAN	Cytoplasmic dynein 1 heavy chain 1 OS=Homo sapiens OX=9606 GN=DYNC1H1 PE=1 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.01	24.0	2	1	0
PRT	sp|A6NHR9-2|SMHD1_HUMAN	Isoform 2 of Structural maintenance of chromosomes flexible hinge domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SMCHD1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|O14662-2|STX16_HUMAN	Isoform A of Syntaxin-16 OS=Homo sapiens OX=9606 GN=STX16	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.07	24.0	1	1	1
PRT	sp|Q9UBD5-2|ORC3_HUMAN	Isoform 2 of Origin recognition complex subunit 3 OS=Homo sapiens OX=9606 GN=ORC3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q16836-2|HCDH_HUMAN	Isoform 2 of Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=HADH	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.08	24.0	1	1	1
PRT	sp|Q8WUX9-2|CHMP7_HUMAN	Isoform 2 of Charged multivesicular body protein 7 OS=Homo sapiens OX=9606 GN=CHMP7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.10	24.0	1	1	1
PRT	sp|Q13724-2|MOGS_HUMAN	Isoform 2 of Mannosyl-oligosaccharide glucosidase OS=Homo sapiens OX=9606 GN=MOGS	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|Q8NFV4-2|ABHDB_HUMAN	Isoform 2 of Protein ABHD11 OS=Homo sapiens OX=9606 GN=ABHD11	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.22	23.0	1	1	0
PRT	sp|P78527|PRKDC_HUMAN	DNA-dependent protein kinase catalytic subunit OS=Homo sapiens OX=9606 GN=PRKDC PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23.0	null	2807-UNIMOD:28	0.00	23.0	2	1	0
PRT	sp|P52434|RPAB3_HUMAN	DNA-directed RNA polymerases I, II, and III subunit RPABC3 OS=Homo sapiens OX=9606 GN=POLR2H PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23.0	null	2-UNIMOD:1	0.09	23.0	1	1	1
PRT	sp|Q8TD26|CHD6_HUMAN	Chromodomain-helicase-DNA-binding protein 6 OS=Homo sapiens OX=9606 GN=CHD6 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23.0	null	811-UNIMOD:385,811-UNIMOD:4	0.00	23.0	2	1	0
PRT	sp|Q6KC79|NIPBL_HUMAN	Nipped-B-like protein OS=Homo sapiens OX=9606 GN=NIPBL PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23.0	null	1450-UNIMOD:28	0.00	23.0	1	1	1
PRT	sp|Q9NU22|MDN1_HUMAN	Midasin OS=Homo sapiens OX=9606 GN=MDN1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23.0	null	42-UNIMOD:28,43-UNIMOD:4	0.00	23.0	1	1	1
PRT	sp|P61916|NPC2_HUMAN	NPC intracellular cholesterol transporter 2 OS=Homo sapiens OX=9606 GN=NPC2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null	140-UNIMOD:4	0.12	22.0	1	1	1
PRT	sp|P57740|NU107_HUMAN	Nuclear pore complex protein Nup107 OS=Homo sapiens OX=9606 GN=NUP107 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22.0	null	265-UNIMOD:28	0.02	22.0	1	1	1
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|Q9P2I0|CPSF2_HUMAN	Cleavage and polyadenylation specificity factor subunit 2 OS=Homo sapiens OX=9606 GN=CPSF2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|P49643|PRI2_HUMAN	DNA primase large subunit OS=Homo sapiens OX=9606 GN=PRIM2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|O14980|XPO1_HUMAN	Exportin-1 OS=Homo sapiens OX=9606 GN=XPO1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null	327-UNIMOD:4	0.03	20.0	1	1	1
PRT	sp|P48643|TCPE_HUMAN	T-complex protein 1 subunit epsilon OS=Homo sapiens OX=9606 GN=CCT5 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20.0	null	184-UNIMOD:28	0.04	20.0	1	1	1
PRT	sp|P36776-2|LONM_HUMAN	Isoform 2 of Lon protease homolog, mitochondrial OS=Homo sapiens OX=9606 GN=LONP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null	794-UNIMOD:4	0.03	19.0	1	1	1
PRT	sp|Q9Y678|COPG1_HUMAN	Coatomer subunit gamma-1 OS=Homo sapiens OX=9606 GN=COPG1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18.0	null		0.02	18.0	1	1	1
PRT	sp|P17987|TCPA_HUMAN	T-complex protein 1 subunit alpha OS=Homo sapiens OX=9606 GN=TCP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18.0	null		0.04	18.0	1	1	1
PRT	sp|P62841|RS15_HUMAN	40S ribosomal protein S15 OS=Homo sapiens OX=9606 GN=RPS15 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18.0	null		0.16	18.0	1	1	1
PRT	sp|P54578-2|UBP14_HUMAN	Isoform 2 of Ubiquitin carboxyl-terminal hydrolase 14 OS=Homo sapiens OX=9606 GN=USP14	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18.0	null		0.05	18.0	1	1	1
PRT	sp|Q14137|BOP1_HUMAN	Ribosome biogenesis protein BOP1 OS=Homo sapiens OX=9606 GN=BOP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	18.0	null	469-UNIMOD:4	0.04	18.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	NLDIERPTYTNLNRLISQIVSSITASLR	1	sp|P68363|TBA1B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	55		ms_run[1]:scan=1.1.4718.8	41.25828	4	3186.6769	3186.7360	R	F	216	244
PSM	HAFEIIHLLTGENPLQVLVNAIINSGPR	2	sp|P46782|RS5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	54		ms_run[1]:scan=1.1.4733.2	41.6523	5	3064.6441	3064.6822	K	E	95	123
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	3	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	54	27-UNIMOD:4	ms_run[1]:scan=1.1.2393.2	22.5602	5	3436.6426	3436.6973	R	R	85	117
PSM	HAFEIIHLLTGENPLQVLVNAIINSGPR	4	sp|P46782|RS5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	53		ms_run[1]:scan=1.1.4767.2	42.02325	4	3064.6281	3064.6822	K	E	95	123
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	5	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	52	27-UNIMOD:4	ms_run[1]:scan=1.1.2405.2	22.81538	5	3436.6426	3436.6973	R	R	85	117
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	6	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	52	27-UNIMOD:4	ms_run[1]:scan=1.1.2404.2	22.78987	5	3436.6426	3436.6973	R	R	85	117
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	7	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	52	27-UNIMOD:4	ms_run[1]:scan=1.1.4121.2	35.80738	5	3512.6341	3512.6956	R	R	85	117
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	8	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	52	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.525.2	5.49425	5	3585.6321	3585.6942	R	R	85	117
PSM	DQAVENILVSPVVVASSLGLVSLGGK	9	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	51		ms_run[1]:scan=1.1.606.3	6.980617	3	2550.3778	2550.4269	K	A	61	87
PSM	VGAGAPVYMAAVLEYLTAEILELAGNAAR	10	sp|Q6FI13|H2A2A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	51		ms_run[1]:scan=1.1.4739.2	41.74797	4	2932.4849	2932.5368	R	D	44	73
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	11	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	51	27-UNIMOD:4	ms_run[1]:scan=1.1.2392.4	22.54292	5	3436.6426	3436.6973	R	R	85	117
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	12	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	51	27-UNIMOD:4	ms_run[1]:scan=1.1.2401.2	22.73287	5	3436.6426	3436.6973	R	R	85	117
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	13	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	51	27-UNIMOD:4	ms_run[1]:scan=1.1.4119.2	35.76418	5	3512.6341	3512.6956	R	R	85	117
PSM	VGAGAPVYMAAVLEYLTAEILELAGNAAR	14	sp|Q6FI13|H2A2A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	50		ms_run[1]:scan=1.1.4738.3	41.73127	4	2932.4849	2932.5368	R	D	44	73
PSM	VLTDAVDDITSIDDFLAVSENHILEDVNK	15	sp|P35221-2|CTNA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	50		ms_run[1]:scan=1.1.2555.2	24.39732	4	3199.5157	3199.5772	R	C	497	526
PSM	ASLDRPFTNLESAFYSIVGLSSLGAQVPDAK	16	sp|P04844-2|RPN2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	50		ms_run[1]:scan=1.1.696.3	8.4177	4	3252.6045	3252.6666	K	K	39	70
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	17	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	50	27-UNIMOD:4	ms_run[1]:scan=1.1.2435.2	23.42378	5	3436.6426	3436.6973	R	R	85	117
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	18	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	50	27-UNIMOD:4	ms_run[1]:scan=1.1.2391.2	22.5173	5	3436.6426	3436.6973	R	R	85	117
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	19	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	50	27-UNIMOD:4	ms_run[1]:scan=1.1.2415.2	22.97223	5	3436.6426	3436.6973	R	R	85	117
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	20	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	50	27-UNIMOD:4	ms_run[1]:scan=1.1.2390.3	22.49165	5	3436.6426	3436.6973	R	R	85	117
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	21	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	50	27-UNIMOD:4	ms_run[1]:scan=1.1.2414.2	22.94665	5	3436.6426	3436.6973	R	R	85	117
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	22	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	50	27-UNIMOD:4	ms_run[1]:scan=1.1.2394.2	22.5941	5	3436.6426	3436.6973	R	R	85	117
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	23	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	50	27-UNIMOD:4	ms_run[1]:scan=1.1.2411.2	22.8895	5	3436.6426	3436.6973	R	R	85	117
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	24	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	50	27-UNIMOD:4	ms_run[1]:scan=1.1.4122.2	35.84633	5	3512.6341	3512.6956	R	R	85	117
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	25	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	50	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.554.2	6.1208	5	3585.6326	3585.6942	R	R	85	117
PSM	DQAVENILVSPVVVASSLGLVSLGGK	26	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	50		ms_run[1]:scan=1.1.601.3	6.851634	4	2551.394094	2550.426869	K	A	61	87
PSM	DQAVENILVSPVVVASSLGLVSLGGK	27	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	49		ms_run[1]:scan=1.1.643.3	7.533134	4	2550.3921	2550.4269	K	A	61	87
PSM	TLLEGSGLESIISIIHSSLAEPR	28	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	49		ms_run[1]:scan=1.1.544.2	5.900733	3	2421.2650	2421.3115	R	V	2483	2506
PSM	DQAVENILVSPVVVASSLGLVSLGGK	29	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	49		ms_run[1]:scan=1.1.572.2	6.456867	3	2550.3778	2550.4269	K	A	61	87
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	30	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	49	27-UNIMOD:4	ms_run[1]:scan=1.1.2421.2	23.07793	5	3436.6426	3436.6973	R	R	85	117
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	31	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	49	27-UNIMOD:4	ms_run[1]:scan=1.1.2422.2	23.11207	5	3436.6426	3436.6973	R	R	85	117
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	32	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	49	27-UNIMOD:4	ms_run[1]:scan=1.1.4117.2	35.73277	5	3512.6341	3512.6956	R	R	85	117
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	33	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	49	27-UNIMOD:4	ms_run[1]:scan=1.1.4113.2	35.63025	5	3512.6341	3512.6956	R	R	85	117
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	34	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	49	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.522.2	5.416467	5	3585.6321	3585.6942	R	R	85	117
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	35	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	49	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.542.2	5.856833	5	3585.6326	3585.6942	R	R	85	117
PSM	ASVSELACIYSALILHDDEVTVTEDK	36	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	49	1-UNIMOD:1,8-UNIMOD:4	ms_run[1]:scan=1.1.551.2	6.051233	4	2919.3582	2919.4052	M	I	2	28
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	37	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	49	27-UNIMOD:4	ms_run[1]:scan=1.1.4129.2	36.03432	5	3513.635118	3512.695593	R	R	85	117
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	38	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	49	27-UNIMOD:4	ms_run[1]:scan=1.1.4128.2	36.00873	5	3513.635118	3512.695593	R	R	85	117
PSM	DQAVENILVSPVVVASSLGLVSLGGK	39	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	49		ms_run[1]:scan=1.1.599.3	6.800117	4	2551.394494	2550.426869	K	A	61	87
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	40	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	49	27-UNIMOD:4	ms_run[1]:scan=1.1.4136.2	36.21298	5	3513.635118	3512.695593	R	R	85	117
PSM	DQAVENILVSPVVVASSLGLVSLGGK	41	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	48		ms_run[1]:scan=1.1.641.2	7.4967	4	2550.3921	2550.4269	K	A	61	87
PSM	DQAVENILVSPVVVASSLGLVSLGGK	42	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	48		ms_run[1]:scan=1.1.644.2	7.565717	4	2550.3917	2550.4269	K	A	61	87
PSM	DQAVENILVSPVVVASSLGLVSLGGK	43	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	48		ms_run[1]:scan=1.1.615.3	7.173967	4	2550.3921	2550.4269	K	A	61	87
PSM	VGATAAVYSAAILEYLTAEVLELAGNASK	44	sp|P0C0S5|H2AZ_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	48		ms_run[1]:scan=1.1.4724.4	41.41645	4	2894.4765	2894.5276	R	D	47	76
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	45	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	48	27-UNIMOD:4	ms_run[1]:scan=1.1.2399.2	22.67342	5	3436.6426	3436.6973	R	R	85	117
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	46	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	48	27-UNIMOD:4	ms_run[1]:scan=1.1.2406.2	22.84087	5	3436.6426	3436.6973	R	R	85	117
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	47	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	48	27-UNIMOD:4	ms_run[1]:scan=1.1.2400.2	22.70747	5	3436.6426	3436.6973	R	R	85	117
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	48	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	48	27-UNIMOD:4	ms_run[1]:scan=1.1.2384.2	22.33743	5	3436.6426	3436.6973	R	R	85	117
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	49	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	48	27-UNIMOD:4	ms_run[1]:scan=1.1.2387.2	22.4144	5	3436.6426	3436.6973	R	R	85	117
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	50	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	48	27-UNIMOD:4	ms_run[1]:scan=1.1.2388.2	22.44012	5	3436.6426	3436.6973	R	R	85	117
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	51	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	48	27-UNIMOD:4	ms_run[1]:scan=1.1.2389.2	22.46592	5	3436.6426	3436.6973	R	R	85	117
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	52	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	48	27-UNIMOD:4	ms_run[1]:scan=1.1.2419.2	23.0549	5	3436.6426	3436.6973	R	R	85	117
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	53	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	48	27-UNIMOD:4	ms_run[1]:scan=1.1.2418.2	23.02905	5	3436.6426	3436.6973	R	R	85	117
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	54	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	48	27-UNIMOD:4	ms_run[1]:scan=1.1.4124.2	35.90615	5	3512.6341	3512.6956	R	R	85	117
PSM	LVAAPLFELYDNAPGYGPIISSLPQLLSR	55	sp|O43809|CPSF5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	47		ms_run[1]:scan=1.1.1830.2	18.03687	4	3113.6221	3113.6801	K	F	193	222
PSM	LVAAPLFELYDNAPGYGPIISSLPQLLSR	56	sp|O43809|CPSF5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	47		ms_run[1]:scan=1.1.1922.2	19.05192	4	3113.6217	3113.6801	K	F	193	222
PSM	VGAGAPVYLAAVLEYLTAEILELAGNAAR	57	sp|P0C0S8|H2A1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	47		ms_run[1]:scan=1.1.4757.2	41.95061	4	2914.5221	2914.5804	R	D	44	73
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	58	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	47	27-UNIMOD:4	ms_run[1]:scan=1.1.2425.3	23.16905	5	3436.6426	3436.6973	R	R	85	117
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	59	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	47	27-UNIMOD:4	ms_run[1]:scan=1.1.2428.2	23.23727	5	3436.6426	3436.6973	R	R	85	117
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	60	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	47	27-UNIMOD:4	ms_run[1]:scan=1.1.2383.2	22.3115	5	3436.6426	3436.6973	R	R	85	117
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	61	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	47	27-UNIMOD:4	ms_run[1]:scan=1.1.2395.2	22.61133	5	3436.6426	3436.6973	R	R	85	117
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	62	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	47	27-UNIMOD:4	ms_run[1]:scan=1.1.2431.2	23.322	5	3436.6426	3436.6973	R	R	85	117
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	63	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	47	27-UNIMOD:4	ms_run[1]:scan=1.1.2426.2	23.19453	5	3436.6426	3436.6973	R	R	85	117
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	64	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	47	27-UNIMOD:4	ms_run[1]:scan=1.1.4114.2	35.65587	5	3512.6341	3512.6956	R	R	85	117
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	65	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	47	27-UNIMOD:4	ms_run[1]:scan=1.1.4115.2	35.68152	5	3512.6341	3512.6956	R	R	85	117
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	66	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	47	27-UNIMOD:4	ms_run[1]:scan=1.1.4120.2	35.79002	5	3512.6341	3512.6956	R	R	85	117
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	67	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	47	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.516.2	5.260867	5	3585.6321	3585.6942	R	R	85	117
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	68	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	47	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.513.2	5.174284	5	3585.6321	3585.6942	R	R	85	117
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	69	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	47	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.523.2	5.4423	5	3585.6321	3585.6942	R	R	85	117
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	70	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	47	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.519.2	5.338783	5	3585.6321	3585.6942	R	R	85	117
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	71	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	47	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.520.2	5.364666	5	3585.6321	3585.6942	R	R	85	117
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	72	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	47	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.514.2	5.209033	5	3585.6321	3585.6942	R	R	85	117
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	73	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	47	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.526.2	5.5201	5	3585.6321	3585.6942	R	R	85	117
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	74	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	47	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.517.2	5.28675	5	3585.6321	3585.6942	R	R	85	117
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	75	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	47	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.543.2	5.88315	5	3585.6326	3585.6942	R	R	85	117
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	76	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	47	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.533.2	5.701117	5	3585.6326	3585.6942	R	R	85	117
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	77	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	47	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.536.2	5.75925	5	3585.6326	3585.6942	R	R	85	117
PSM	DQAVENILVSPVVVASSLGLVSLGGK	78	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	47		ms_run[1]:scan=1.1.602.3	6.877417	4	2551.394094	2550.426869	K	A	61	87
PSM	DQAVENILVSPVVVASSLGLVSLGGK	79	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	47		ms_run[1]:scan=1.1.604.2	6.928933	4	2551.394094	2550.426869	K	A	61	87
PSM	DQAVENILVSPVVVASSLGLVSLGGK	80	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	47		ms_run[1]:scan=1.1.596.2	6.722317	4	2551.394494	2550.426869	K	A	61	87
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	81	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	47	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.527.2	5.54585	5	3587.635118	3585.694213	R	R	85	117
PSM	TALLDAAGVASLLTTAEVVVTEIPK	82	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	46		ms_run[1]:scan=1.1.4726.3	41.4689	4	2481.3601	2481.3942	R	E	527	552
PSM	SENVQDLLLLDVTPLSLGIETAGGVMTVLIK	83	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	46		ms_run[1]:scan=1.1.4726.7	41.47557	4	3237.7169	3237.7782	K	R	385	416
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	84	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	46	27-UNIMOD:4	ms_run[1]:scan=1.1.4112.2	35.60467	5	3512.6341	3512.6956	R	R	85	117
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	85	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	46	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.524.3	5.468433	5	3585.6321	3585.6942	R	R	85	117
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	86	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	46	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.539.2	5.789567	5	3585.6326	3585.6942	R	R	85	117
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	87	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	46	27-UNIMOD:4	ms_run[1]:scan=1.1.4127.2	35.97478	5	3513.635118	3512.695593	R	R	85	117
PSM	DQAVENILVSPVVVASSLGLVSLGGK	88	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	46		ms_run[1]:scan=1.1.605.2	6.954667	4	2551.394094	2550.426869	K	A	61	87
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	89	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	46	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.532.5	5.675317	5	3587.635118	3585.694213	R	R	85	117
PSM	FGAQLAHIQALISGIEAQLGDVR	90	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	45		ms_run[1]:scan=1.1.601.2	6.8433	4	2406.2737	2406.3019	R	A	331	354
PSM	HGITQANELVNLTEFFVNHILPDLK	91	sp|P55060-3|XPO2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	45		ms_run[1]:scan=1.1.4715.3	41.1665	4	2861.4609	2861.5076	K	S	446	471
PSM	LVAAPLFELYDNAPGYGPIISSLPQLLSR	92	sp|O43809|CPSF5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	45		ms_run[1]:scan=1.1.1997.2	19.63875	4	3113.6217	3113.6801	K	F	193	222
PSM	NGFLNLALPFFGFSEPLAAPR	93	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	45		ms_run[1]:scan=1.1.1568.3	16.0575	3	2277.1510	2277.1946	K	H	884	905
PSM	TALLDAAGVASLLTTAEVVVTEIPK	94	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	45		ms_run[1]:scan=1.1.4750.2	41.8546	3	2481.3508	2481.3942	R	E	527	552
PSM	GIHSAIDASQTPDVVFASILAAFSK	95	sp|P54819-2|KAD2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	45		ms_run[1]:scan=1.1.680.2	8.023216	3	2544.2728	2544.3224	R	A	205	230
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	96	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	45	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.515.2	5.226733	5	3585.6321	3585.6942	R	R	85	117
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	97	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	45	27-UNIMOD:4	ms_run[1]:scan=1.1.4133.2	36.13645	5	3513.635118	3512.695593	R	R	85	117
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	98	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	45	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.530.2	5.623617	5	3587.635118	3585.694213	R	R	85	117
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	99	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	45	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.531.4	5.649433	5	3587.635118	3585.694213	R	R	85	117
PSM	DQAVENILVSPVVVASSLGLVSLGGK	100	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	44		ms_run[1]:scan=1.1.646.2	7.585484	4	2550.3917	2550.4269	K	A	61	87
PSM	LPITVLNGAPGFINLCDALNAWQLVK	101	sp|P31939-2|PUR9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	44	16-UNIMOD:4	ms_run[1]:scan=1.1.1568.2	16.04917	4	2836.4829	2836.5309	K	E	225	251
PSM	LGDPAEYAHLVQAIIENPFLNGEVIR	102	sp|Q99714-2|HCD2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	44		ms_run[1]:scan=1.1.1576.2	16.146	4	2877.4537	2877.5025	R	L	218	244
PSM	LGDPAEYAHLVQAIIENPFLNGEVIR	103	sp|Q99714-2|HCD2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	44		ms_run[1]:scan=1.1.1522.2	15.64155	4	2877.4537	2877.5025	R	L	218	244
PSM	ELEAVCQDVLSLLDNYLIK	104	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	44	6-UNIMOD:4	ms_run[1]:scan=1.1.4397.2	38.45715	3	2234.1091	2234.1504	K	N	92	111
PSM	TALLDAAGVASLLTTAEVVVTEIPK	105	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	44		ms_run[1]:scan=1.1.4727.3	41.49563	4	2481.3601	2481.3942	R	E	527	552
PSM	TALLDAAGVASLLTTAEVVVTEIPK	106	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	44		ms_run[1]:scan=1.1.4728.2	41.52035	4	2481.3601	2481.3942	R	E	527	552
PSM	VGAGAPVYMAAVLEYLTAEILELAGNAAR	107	sp|Q6FI13|H2A2A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	44		ms_run[1]:scan=1.1.4740.3	41.77475	4	2932.4849	2932.5368	R	D	44	73
PSM	LVAAPLFELYDNAPGYGPIISSLPQLLSR	108	sp|O43809|CPSF5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	44		ms_run[1]:scan=1.1.1858.2	18.53922	4	3113.6221	3113.6801	K	F	193	222
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	109	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	44	27-UNIMOD:4	ms_run[1]:scan=1.1.2436.2	23.4492	5	3436.6426	3436.6973	R	R	85	117
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	110	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	44	27-UNIMOD:4	ms_run[1]:scan=1.1.2433.2	23.37285	5	3436.6426	3436.6973	R	R	85	117
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	111	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	44	27-UNIMOD:4	ms_run[1]:scan=1.1.2386.2	22.38037	5	3436.6426	3436.6973	R	R	85	117
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	112	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	44	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.518.2	5.312817	5	3585.6321	3585.6942	R	R	85	117
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	113	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	44	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.555.3	6.155	5	3585.6326	3585.6942	R	R	85	117
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	114	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	44	27-UNIMOD:4	ms_run[1]:scan=1.1.4131.2	36.08548	5	3513.635118	3512.695593	R	R	85	117
PSM	DQAVENILVSPVVVASSLGLVSLGGK	115	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	44		ms_run[1]:scan=1.1.600.2	6.825883	4	2551.394094	2550.426869	K	A	61	87
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	116	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	44	27-UNIMOD:4	ms_run[1]:scan=1.1.4130.2	36.05993	5	3513.635118	3512.695593	R	R	85	117
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	117	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	44	27-UNIMOD:4	ms_run[1]:scan=1.1.4125.2	35.93184	5	3513.635118	3512.695593	R	R	85	117
PSM	QDQIQQVVNHGLVPFLVSVLSK	118	sp|P52292|IMA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	44	1-UNIMOD:28	ms_run[1]:scan=1.1.4717.8	41.23012	3	2430.2792	2430.3262	R	A	367	389
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	119	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	44	27-UNIMOD:4	ms_run[1]:scan=1.1.4126.2	35.94912	4	3511.668094	3512.695593	R	R	85	117
PSM	FGAQLAHIQALISGIEAQLGDVR	120	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	43		ms_run[1]:scan=1.1.606.2	6.972283	4	2406.2737	2406.3019	R	A	331	354
PSM	TLLEGSGLESIISIIHSSLAEPR	121	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	43		ms_run[1]:scan=1.1.552.2	6.06545	4	2421.2837	2421.3115	R	V	2483	2506
PSM	ALGLGVEQLPVVFEDVVLHQATILPK	122	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	43		ms_run[1]:scan=1.1.673.2	7.892933	4	2784.5373	2784.5790	R	T	902	928
PSM	ALGLGVEQLPVVFEDVVLHQATILPK	123	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	43		ms_run[1]:scan=1.1.629.2	7.35775	4	2784.5373	2784.5790	R	T	902	928
PSM	INALTAASEAACLIVSVDETIK	124	sp|Q99832-2|TCPH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	43	12-UNIMOD:4	ms_run[1]:scan=1.1.1325.2	14.07285	3	2288.1508	2288.1933	R	N	296	318
PSM	GIHSAIDASQTPDVVFASILAAFSK	125	sp|P54819-2|KAD2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	43		ms_run[1]:scan=1.1.641.4	7.50835	3	2544.2728	2544.3224	R	A	205	230
PSM	DLGEELEALKTELEDTLDSTAAQQELR	126	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	43		ms_run[1]:scan=1.1.3083.2	28.52045	4	3016.4153	3016.4724	R	S	1136	1163
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	127	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	43	27-UNIMOD:4	ms_run[1]:scan=1.1.2385.2	22.36297	5	3436.6426	3436.6973	R	R	85	117
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	128	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	43	27-UNIMOD:4	ms_run[1]:scan=1.1.2427.2	23.22007	5	3436.6426	3436.6973	R	R	85	117
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	129	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	43	27-UNIMOD:4	ms_run[1]:scan=1.1.4111.2	35.57913	5	3512.6341	3512.6956	R	R	85	117
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	130	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	43	27-UNIMOD:4	ms_run[1]:scan=1.1.4132.2	36.11097	5	3513.635118	3512.695593	R	R	85	117
PSM	AAGAAEAAVAAVEEVGSAGQFEELLR	131	sp|O76003|GLRX3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	43	1-UNIMOD:1	ms_run[1]:scan=1.1.4715.6	41.1715	3	2558.2232	2557.2652	M	L	2	28
PSM	VNLSQDLEHQLQNIIQELNLEILPPPEDPSVPVALNIGK	132	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	43		ms_run[1]:scan=1.1.4717.10	41.23345	5	4325.315618	4326.311118	K	L	276	315
PSM	DQAVENILVSPVVVASSLGLVSLGGK	133	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	42		ms_run[1]:scan=1.1.688.3	8.20325	4	2550.3917	2550.4269	K	A	61	87
PSM	ALGLGVEQLPVVFEDVVLHQATILPK	134	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	42		ms_run[1]:scan=1.1.686.3	8.158466	4	2784.5369	2784.5790	R	T	902	928
PSM	ALMLQGVDLLADAVAVTMGPK	135	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	42		ms_run[1]:scan=1.1.2687.2	25.4446	3	2112.0973	2112.1323	R	G	38	59
PSM	ALMLQGVDLLADAVAVTMGPK	136	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	42		ms_run[1]:scan=1.1.2626.2	24.94158	3	2112.0973	2112.1323	R	G	38	59
PSM	VHAELADVLTEAVVDSILAIK	137	sp|P40227-2|TCPZ_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	42		ms_run[1]:scan=1.1.4718.2	41.24828	4	2205.2041	2205.2256	K	K	115	136
PSM	TLLEGSGLESIISIIHSSLAEPR	138	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	42		ms_run[1]:scan=1.1.571.2	6.43115	3	2421.2647	2421.3115	R	V	2483	2506
PSM	FLESVEGNQNYPLLLLTLLEK	139	sp|P55060-3|XPO2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	42		ms_run[1]:scan=1.1.690.3	8.261517	3	2432.2747	2432.3202	K	S	32	53
PSM	TALLDAAGVASLLTTAEVVVTEIPK	140	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	42		ms_run[1]:scan=1.1.4724.3	41.41478	4	2481.3601	2481.3942	R	E	527	552
PSM	TALLDAAGVASLLTTAEVVVTEIPK	141	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	42		ms_run[1]:scan=1.1.4725.2	41.44017	4	2481.3601	2481.3942	R	E	527	552
PSM	ASLDRPFTNLESAFYSIVGLSSLGAQVPDAK	142	sp|P04844-2|RPN2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	42		ms_run[1]:scan=1.1.673.3	7.901267	4	3252.6045	3252.6666	K	K	39	70
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	143	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	42	27-UNIMOD:4	ms_run[1]:scan=1.1.2424.2	23.14332	5	3436.6426	3436.6973	R	R	85	117
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	144	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	42	27-UNIMOD:4	ms_run[1]:scan=1.1.2430.2	23.29655	5	3436.6426	3436.6973	R	R	85	117
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	145	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	42	27-UNIMOD:4	ms_run[1]:scan=1.1.2434.2	23.39832	5	3436.6426	3436.6973	R	R	85	117
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	146	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	42	27-UNIMOD:4	ms_run[1]:scan=1.1.4109.2	35.5277	5	3512.6341	3512.6956	R	R	85	117
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	147	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	42	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.521.2	5.378917	5	3585.6321	3585.6942	R	R	85	117
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	148	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	42	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.561.3	6.270916	5	3585.6326	3585.6942	R	R	85	117
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	149	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	42	27-UNIMOD:4	ms_run[1]:scan=1.1.4135.2	36.18747	5	3513.635118	3512.695593	R	R	85	117
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	150	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	42	27-UNIMOD:4	ms_run[1]:scan=1.1.4134.2	36.16198	5	3513.635118	3512.695593	R	R	85	117
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	151	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	42	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.528.2	5.56005	5	3587.635118	3585.694213	R	R	85	117
PSM	TLLEGSGLESIISIIHSSLAEPR	152	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	41		ms_run[1]:scan=1.1.555.2	6.146667	4	2421.2837	2421.3115	R	V	2483	2506
PSM	FLESVEGNQNYPLLLLTLLEK	153	sp|P55060-3|XPO2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	41		ms_run[1]:scan=1.1.678.2	7.97095	4	2432.2905	2432.3202	K	S	32	53
PSM	DQAVENILVSPVVVASSLGLVSLGGK	154	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	41		ms_run[1]:scan=1.1.689.2	8.2274	4	2550.3917	2550.4269	K	A	61	87
PSM	ALGLGVEQLPVVFEDVVLHQATILPK	155	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	41		ms_run[1]:scan=1.1.690.2	8.253183	4	2784.5369	2784.5790	R	T	902	928
PSM	DPEAPIFQVADYGIVADLFK	156	sp|P13804-2|ETFA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	41		ms_run[1]:scan=1.1.427.2	4.333517	3	2207.0743	2207.1150	K	V	253	273
PSM	AAELFHQLSQALEVLTDAAAR	157	sp|Q9NVM6|DJC17_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	41		ms_run[1]:scan=1.1.622.2	7.275533	3	2253.1375	2253.1753	R	A	49	70
PSM	FFEGPVTGIFSGYVNSMLQEYAK	158	sp|P55060-3|XPO2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	41		ms_run[1]:scan=1.1.296.3	3.1465	3	2583.1861	2583.2356	K	N	396	419
PSM	DLSEELEALKTELEDTLDTTAAQQELR	159	sp|P35580-2|MYH10_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	41		ms_run[1]:scan=1.1.2729.2	25.96768	4	3060.4397	3060.4986	R	T	1159	1186
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	160	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	41	27-UNIMOD:4	ms_run[1]:scan=1.1.2432.2	23.34737	5	3436.6426	3436.6973	R	R	85	117
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	161	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	41	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.557.2	6.206567	5	3585.6326	3585.6942	R	R	85	117
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	162	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	41	27-UNIMOD:4	ms_run[1]:scan=1.1.4138.2	36.264	5	3513.635118	3512.695593	R	R	85	117
PSM	CIALAQLLVEQNFPAIAIHR	163	sp|Q13838|DX39B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	41	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.2691.2	25.50752	3	2259.1742	2259.2192	R	G	300	320
PSM	CIALAQLLVEQNFPAIAIHR	164	sp|Q13838|DX39B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	41	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.2731.2	26.00778	3	2259.1742	2259.2192	R	G	300	320
PSM	FGAQLAHIQALISGIEAQLGDVR	165	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	40		ms_run[1]:scan=1.1.603.2	6.903133	4	2406.2737	2406.3019	R	A	331	354
PSM	TLLEGSGLESIISIIHSSLAEPR	166	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	40		ms_run[1]:scan=1.1.562.2	6.2967	4	2421.2837	2421.3115	R	V	2483	2506
PSM	ALGLGVEQLPVVFEDVVLHQATILPK	167	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	40		ms_run[1]:scan=1.1.643.4	7.5398	4	2784.5373	2784.5790	R	T	902	928
PSM	DTNYTLNTDSLDWALYDHLMDFLADR	168	sp|Q07021|C1QBP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	40		ms_run[1]:scan=1.1.4707.2	40.94183	4	3117.3461	3117.4026	K	G	221	247
PSM	IDLGVHVDGFIANVAHTFVVDVAQGTQVTGR	169	sp|Q9UQ80-2|PA2G4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	40		ms_run[1]:scan=1.1.1426.2	14.82472	4	3234.6161	3234.6786	K	K	54	85
PSM	TALLDAAGVASLLTTAEVVVTEIPK	170	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	40		ms_run[1]:scan=1.1.4754.2	41.89545	3	2481.3460	2481.3942	R	E	527	552
PSM	GDLENAFLNLVQCIQNKPLYFADR	171	sp|P07355-2|ANXA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	40	13-UNIMOD:4	ms_run[1]:scan=1.1.234.2	2.2348	4	2837.3709	2837.4170	K	L	268	292
PSM	VLTDAVDDITSIDDFLAVSENHILEDVNK	172	sp|P35221-2|CTNA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	40		ms_run[1]:scan=1.1.2488.2	23.89642	4	3199.5157	3199.5772	R	C	497	526
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	173	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	40	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.549.3	5.992784	5	3585.6326	3585.6942	R	R	85	117
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	174	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	40	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.550.3	6.015316	5	3585.6326	3585.6942	R	R	85	117
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	175	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	40	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.560.2	6.244333	5	3585.6326	3585.6942	R	R	85	117
PSM	VEVECSSLQEAVQAAEAGADLVLLDNFKPEELHPTATVLK	176	sp|Q15274|NADC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	40	5-UNIMOD:4	ms_run[1]:scan=1.1.253.2	2.46885	5	4320.0971	4320.1835	K	A	198	238
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	177	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	40	27-UNIMOD:4	ms_run[1]:scan=1.1.4137.2	36.23847	5	3513.635118	3512.695593	R	R	85	117
PSM	FGAQLAHIQALISGIEAQLGDVR	178	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39		ms_run[1]:scan=1.1.599.2	6.791783	4	2406.2737	2406.3019	R	A	331	354
PSM	ALGLGVEQLPVVFEDVVLHQATILPK	179	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39		ms_run[1]:scan=1.1.689.3	8.235733	4	2784.5369	2784.5790	R	T	902	928
PSM	VHAELADVLTEAVVDSILAIK	180	sp|P40227-2|TCPZ_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39		ms_run[1]:scan=1.1.4718.6	41.25495	3	2205.1867	2205.2256	K	K	115	136
PSM	DTNYTLNTDSLDWALYDHLMDFLADR	181	sp|Q07021|C1QBP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39		ms_run[1]:scan=1.1.4712.5	41.08368	4	3117.3461	3117.4026	K	G	221	247
PSM	TDMIQALGGVEGILEHTLFK	182	sp|Q6P2Q9|PRP8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39		ms_run[1]:scan=1.1.3913.2	34.25153	3	2171.0911	2171.1296	R	G	1472	1492
PSM	NGFLNLALPFFGFSEPLAAPR	183	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39		ms_run[1]:scan=1.1.1621.2	16.55788	3	2277.1510	2277.1946	K	H	884	905
PSM	LPITVLNGAPGFINLCDALNAWQLVK	184	sp|P31939-2|PUR9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39	16-UNIMOD:4	ms_run[1]:scan=1.1.1577.2	16.1637	4	2836.4829	2836.5309	K	E	225	251
PSM	LPITVLNGAPGFINLCDALNAWQLVK	185	sp|P31939-2|PUR9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39	16-UNIMOD:4	ms_run[1]:scan=1.1.1550.2	15.86927	4	2836.4829	2836.5309	K	E	225	251
PSM	DLSEELEALKTELEDTLDTTAAQQELR	186	sp|P35580-2|MYH10_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39		ms_run[1]:scan=1.1.2688.2	25.462	4	3060.4397	3060.4986	R	T	1159	1186
PSM	SANYCHTSQGDPIGLILLGEVALGNMYELK	187	sp|P09874|PARP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39	5-UNIMOD:4	ms_run[1]:scan=1.1.2057.2	20.03868	4	3262.5377	3262.6002	K	H	904	934
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	188	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39	27-UNIMOD:4	ms_run[1]:scan=1.1.4110.2	35.55357	5	3512.6341	3512.6956	R	R	85	117
PSM	PLTPLQEEMASLLQQIEIER	189	sp|Q9H2W6|RM46_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39		ms_run[1]:scan=1.1.312.2	3.363983	3	2337.1798	2337.2249	K	S	62	82
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	190	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	39	27-UNIMOD:4	ms_run[1]:scan=1.1.4139.2	36.28948	5	3513.635118	3512.695593	R	R	85	117
PSM	ASVSELACIYSALILHDDEVTVTEDK	191	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	39	1-UNIMOD:1,8-UNIMOD:4	ms_run[1]:scan=1.1.546.3	5.93425	4	2919.3582	2919.4052	M	I	2	28
PSM	SLLQSALDFLAGPGSLGGASGR	192	sp|O14976|GAK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	39	1-UNIMOD:1	ms_run[1]:scan=1.1.4725.4	41.4435	3	2115.0582	2115.0952	M	D	2	24
PSM	FGAQLAHIQALISGIEAQLGDVR	193	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38		ms_run[1]:scan=1.1.614.2	7.136567	4	2406.2737	2406.3019	R	A	331	354
PSM	FGAQLAHIQALISGIEAQLGDVR	194	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38		ms_run[1]:scan=1.1.602.2	6.869083	4	2406.2737	2406.3019	R	A	331	354
PSM	ALGLGVEQLPVVFEDVVLHQATILPK	195	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38		ms_run[1]:scan=1.1.638.2	7.45075	4	2784.5373	2784.5790	R	T	902	928
PSM	ALGLGVEQLPVVFEDVVLHQATILPK	196	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38		ms_run[1]:scan=1.1.693.2	8.3386	4	2784.5369	2784.5790	R	T	902	928
PSM	GLDTVVALLADVVLQPR	197	sp|Q10713|MPPA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38		ms_run[1]:scan=1.1.4724.2	41.41312	3	1778.0089	1778.0302	K	L	159	176
PSM	ALMLQGVDLLADAVAVTMGPK	198	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38		ms_run[1]:scan=1.1.2557.2	24.4292	3	2112.0973	2112.1323	R	G	38	59
PSM	IEAELQDICNDVLELLDK	199	sp|P31946-2|1433B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38	9-UNIMOD:4	ms_run[1]:scan=1.1.846.2	10.30622	3	2129.0215	2129.0562	K	Y	86	104
PSM	IEAELQDICNDVLELLDK	200	sp|P31946-2|1433B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38	9-UNIMOD:4	ms_run[1]:scan=1.1.751.3	9.299883	3	2129.0218	2129.0562	K	Y	86	104
PSM	ETYEVLLSFIQAALGDQPR	201	sp|O75643-2|U520_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38		ms_run[1]:scan=1.1.4694.2	40.70035	3	2149.0678	2149.1055	R	D	111	130
PSM	DDLIASILSEVAPTPLDELR	202	sp|Q01970-2|PLCB3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38		ms_run[1]:scan=1.1.2302.2	21.75087	3	2166.1042	2166.1420	R	G	872	892
PSM	TDMIQALGGVEGILEHTLFK	203	sp|Q6P2Q9|PRP8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38		ms_run[1]:scan=1.1.3834.2	33.74777	3	2171.0911	2171.1296	R	G	1472	1492
PSM	LQSVQALTEIQEFISFISK	204	sp|P78527-2|PRKDC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38		ms_run[1]:scan=1.1.4718.5	41.25328	3	2180.1301	2180.1729	K	Q	3129	3148
PSM	DLVVLLFETALLSSGFSLEDPQTHSNR	205	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38		ms_run[1]:scan=1.1.4722.6	41.36553	4	2987.4709	2987.5240	K	I	653	680
PSM	YFILPDSLPLDTLLVDVEPK	206	sp|P62314|SMD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38		ms_run[1]:scan=1.1.652.2	7.664633	3	2286.2011	2286.2399	R	V	67	87
PSM	GDLENAFLNLVQCIQNKPLYFADR	207	sp|P07355-2|ANXA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38	13-UNIMOD:4	ms_run[1]:scan=1.1.189.2	1.680583	4	2837.3709	2837.4170	K	L	268	292
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	208	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	38	27-UNIMOD:4	ms_run[1]:scan=1.1.4142.2	36.34608	5	3513.635118	3512.695593	R	R	85	117
PSM	CIALAQLLVEQNFPAIAIHR	209	sp|Q13838|DX39B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	38	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.2792.2	26.51015	3	2259.1742	2259.2192	R	G	300	320
PSM	QQQEGLSHLISIIKDDLEDIK	210	sp|Q7Z3B4|NUP54_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	38	1-UNIMOD:28	ms_run[1]:scan=1.1.1224.2	13.26105	3	2404.2022	2404.2482	K	L	469	490
PSM	FGAQLAHIQALISGIEAQLGDVR	211	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37		ms_run[1]:scan=1.1.611.2	7.0702	4	2406.2737	2406.3019	R	A	331	354
PSM	FGAQLAHIQALISGIEAQLGDVR	212	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37		ms_run[1]:scan=1.1.598.2	6.7659	4	2406.2737	2406.3019	R	A	331	354
PSM	FGAQLAHIQALISGIEAQLGDVR	213	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37		ms_run[1]:scan=1.1.607.2	6.998083	4	2406.2737	2406.3019	R	A	331	354
PSM	LANQFAIYKPVTDFFLQLVDAGK	214	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37		ms_run[1]:scan=1.1.1831.2	18.07088	4	2597.3529	2597.3894	R	V	1244	1267
PSM	SNILEAWSEGVALLQDVR	215	sp|Q9BUA3|SPNDC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37		ms_run[1]:scan=1.1.263.3	2.610317	3	1999.0099	1999.0374	K	A	126	144
PSM	YALQMEQLNGILLHLESELAQTR	216	sp|P05783|K1C18_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37		ms_run[1]:scan=1.1.561.2	6.262583	4	2669.3429	2669.3846	R	A	331	354
PSM	ALGLGVEQLPVVFEDVVLHQATILPK	217	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37		ms_run[1]:scan=1.1.688.4	8.209917	4	2784.5369	2784.5790	R	T	902	928
PSM	LVAAPLFELYDNAPGYGPIISSLPQLLSR	218	sp|O43809|CPSF5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37		ms_run[1]:scan=1.1.1769.2	17.53258	4	3113.6221	3113.6801	K	F	193	222
PSM	DTNYTLNTDSLDWALYDHLMDFLADR	219	sp|Q07021|C1QBP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37		ms_run[1]:scan=1.1.4711.5	41.05513	4	3117.3461	3117.4026	K	G	221	247
PSM	DTNYTLNTDSLDWALYDHLMDFLADR	220	sp|Q07021|C1QBP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37		ms_run[1]:scan=1.1.4706.2	40.91747	4	3117.3461	3117.4026	K	G	221	247
PSM	SEVELVQLVIDGVNYLIDCER	221	sp|P12532-2|KCRU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37	19-UNIMOD:4	ms_run[1]:scan=1.1.4728.7	41.52868	3	2462.1898	2462.2363	K	R	409	430
PSM	AFAVVASALGIPSLLPFLK	222	sp|O75533|SF3B1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37		ms_run[1]:scan=1.1.190.2	1.706767	3	1913.1142	1913.1390	R	A	631	650
PSM	DQEGQDVLLFIDNIFR	223	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37		ms_run[1]:scan=1.1.4061.2	35.20402	3	1920.9337	1920.9581	R	F	295	311
PSM	NMAEQIIQEIYSQIQSK	224	sp|P29401-2|TKT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37		ms_run[1]:scan=1.1.66.2	0.5881667	3	2021.9818	2022.0091	K	K	273	290
PSM	EQHDALEFFNSLVDSLDEALK	225	sp|O00507-2|USP9Y_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37		ms_run[1]:scan=1.1.4717.7	41.22845	3	2419.1089	2419.1543	R	A	1684	1705
PSM	VGQTAFDVADEDILGYLEELQK	226	sp|O14974-2|MYPT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37		ms_run[1]:scan=1.1.280.3	2.930533	3	2452.1524	2452.2009	K	K	264	286
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	227	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.546.2	5.92925	5	3585.6326	3585.6942	R	R	85	117
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	228	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	37	27-UNIMOD:4	ms_run[1]:scan=1.1.4146.2	36.38978	5	3513.635118	3512.695593	R	R	85	117
PSM	FGAQLAHIQALISGIEAQLGDVR	229	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=1.1.593.2	6.664583	3	2407.257671	2406.301943	R	A	331	354
PSM	FGAQLAHIQALISGIEAQLGDVR	230	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36		ms_run[1]:scan=1.1.615.2	7.165633	4	2406.2737	2406.3019	R	A	331	354
PSM	TLLEGSGLESIISIIHSSLAEPR	231	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36		ms_run[1]:scan=1.1.556.2	6.169083	4	2421.2837	2421.3115	R	V	2483	2506
PSM	NLSDLIDLVPSLCEDLLSSVDQPLK	232	sp|P47756-2|CAPZB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36	13-UNIMOD:4	ms_run[1]:scan=1.1.4718.3	41.24995	4	2782.3861	2782.4310	K	I	24	49
PSM	ALGLGVEQLPVVFEDVVLHQATILPK	233	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36		ms_run[1]:scan=1.1.687.3	8.174167	4	2784.5369	2784.5790	R	T	902	928
PSM	DTNYTLNTDSLDWALYDHLMDFLADR	234	sp|Q07021|C1QBP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36		ms_run[1]:scan=1.1.4709.2	40.99718	4	3117.3461	3117.4026	K	G	221	247
PSM	DTNYTLNTDSLDWALYDHLMDFLADR	235	sp|Q07021|C1QBP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36		ms_run[1]:scan=1.1.4708.4	40.9747	4	3117.3461	3117.4026	K	G	221	247
PSM	TATFAISILQQIELDLK	236	sp|P60842-2|IF4A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36		ms_run[1]:scan=1.1.1342.2	14.2168	3	1903.0396	1903.0666	K	A	83	100
PSM	INALTAASEAACLIVSVDETIK	237	sp|Q99832-2|TCPH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36	12-UNIMOD:4	ms_run[1]:scan=1.1.1455.2	15.07863	3	2288.1517	2288.1933	R	N	296	318
PSM	IQFNDLQSLLCATLQNVLRK	238	sp|Q14974-2|IMB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36	11-UNIMOD:4	ms_run[1]:scan=1.1.2625.2	24.91535	4	2373.2509	2373.2838	R	V	430	450
PSM	IQFNDLQSLLCATLQNVLRK	239	sp|Q14974-2|IMB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36	11-UNIMOD:4	ms_run[1]:scan=1.1.2616.2	24.84225	4	2373.2509	2373.2838	R	V	430	450
PSM	IQFNDLQSLLCATLQNVLRK	240	sp|Q14974-2|IMB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36	11-UNIMOD:4	ms_run[1]:scan=1.1.2614.2	24.80273	3	2373.2368	2373.2838	R	V	430	450
PSM	VGQTAFDVADEDILGYLEELQK	241	sp|O14974-2|MYPT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36		ms_run[1]:scan=1.1.317.2	3.434467	3	2452.1524	2452.2009	K	K	264	286
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	242	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36	27-UNIMOD:4	ms_run[1]:scan=1.1.2438.2	23.50008	5	3436.6426	3436.6973	R	R	85	117
PSM	NPEILAIAPVLLDALTDPSR	243	sp|Q92616|GCN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=1.1.966.2	11.27378	3	2118.143471	2117.173220	R	K	1571	1591
PSM	LANQFAIYKPVTDFFLQLVDAGK	244	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=1.1.1839.2	18.25622	4	2598.354494	2597.389361	R	V	1244	1267
PSM	SDPAVNAQLDGIISDFEALK	245	sp|Q9UHD8-5|SEPT9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	36	1-UNIMOD:1	ms_run[1]:scan=1.1.666.2	7.838117	3	2144.0292	2144.0632	M	R	2	22
PSM	IQFNDLQSLLCATLQNVLRK	246	sp|Q14974-2|IMB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35	11-UNIMOD:4	ms_run[1]:scan=1.1.2633.2	25.0415	4	2373.2509	2373.2838	R	V	430	450
PSM	FGAQLAHIQALISGIEAQLGDVR	247	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35		ms_run[1]:scan=1.1.653.2	7.69855	4	2406.2737	2406.3019	R	A	331	354
PSM	FGAQLAHIQALISGIEAQLGDVR	248	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35		ms_run[1]:scan=1.1.609.2	7.038116	4	2406.2737	2406.3019	R	A	331	354
PSM	FLESVEGNQNYPLLLLTLLEK	249	sp|P55060-3|XPO2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35		ms_run[1]:scan=1.1.683.2	8.080684	4	2432.2905	2432.3202	K	S	32	53
PSM	FLESVEGNQNYPLLLLTLLEK	250	sp|P55060-3|XPO2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35		ms_run[1]:scan=1.1.685.3	8.126	4	2432.2905	2432.3202	K	S	32	53
PSM	TALLDAAGVASLLTTAEVVVTEIPK	251	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35		ms_run[1]:scan=1.1.4729.2	41.54643	4	2481.3601	2481.3942	R	E	527	552
PSM	ALGLGVEQLPVVFEDVVLHQATILPK	252	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35		ms_run[1]:scan=1.1.685.4	8.132667	4	2784.5369	2784.5790	R	T	902	928
PSM	ALGLGVEQLPVVFEDVVLHQATILPK	253	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35		ms_run[1]:scan=1.1.630.2	7.383367	4	2784.5373	2784.5790	R	T	902	928
PSM	DGADIHSDLFISIAQALLGGTAR	254	sp|Q96EY1-2|DNJA3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35		ms_run[1]:scan=1.1.3263.2	29.8992	3	2340.1633	2340.2074	R	A	342	365
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	255	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.507.2	5.085717	4	3585.6233	3585.6942	R	R	85	117
PSM	AFAVVASALGIPSLLPFLK	256	sp|O75533|SF3B1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35		ms_run[1]:scan=1.1.233.2	2.208983	3	1913.1142	1913.1390	R	A	631	650
PSM	NAIQLLASFLANNPFSCK	257	sp|Q15021|CND1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35	17-UNIMOD:4	ms_run[1]:scan=1.1.4720.3	41.30558	3	2006.9947	2007.0248	K	L	423	441
PSM	NMAEQIIQEIYSQIQSK	258	sp|P29401-2|TKT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35		ms_run[1]:scan=1.1.5.2	0.0837	3	2021.9818	2022.0091	K	K	273	290
PSM	TLAGLVVQLLQFQEDAFGK	259	sp|Q92922|SMRC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35		ms_run[1]:scan=1.1.4719.4	41.27943	3	2076.0946	2076.1255	K	H	76	95
PSM	DYVLNCSILNPLLTLLTK	260	sp|O60684|IMA7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35	6-UNIMOD:4	ms_run[1]:scan=1.1.3393.2	30.82903	3	2089.1137	2089.1493	R	S	203	221
PSM	NTSELVSSEVYLLSALAALQK	261	sp|Q9H583|HEAT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35		ms_run[1]:scan=1.1.168.2	1.443667	3	2235.1597	2235.1998	K	V	1746	1767
PSM	YFILPDSLPLDTLLVDVEPK	262	sp|P62314|SMD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35		ms_run[1]:scan=1.1.614.3	7.141567	3	2286.2005	2286.2399	R	V	67	87
PSM	INALTAASEAACLIVSVDETIK	263	sp|Q99832-2|TCPH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35	12-UNIMOD:4	ms_run[1]:scan=1.1.1258.3	13.56725	3	2288.1508	2288.1933	R	N	296	318
PSM	LEQVSSDEGIGTLAENLLEALR	264	sp|Q5T4S7-2|UBR4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35		ms_run[1]:scan=1.1.652.3	7.672966	3	2356.1689	2356.2121	K	E	4751	4773
PSM	SLEGDLEDLKDQIAQLEASLAAAK	265	sp|P20700|LMNB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35		ms_run[1]:scan=1.1.2392.3	22.53625	4	2527.2613	2527.3017	K	K	158	182
PSM	IVPVDIYIPGCPPTAEALLYGILQLQR	266	sp|O75251|NDUS7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35	11-UNIMOD:4	ms_run[1]:scan=1.1.3482.2	31.43458	4	3008.5837	3008.6409	R	K	173	200
PSM	VEVECSSLQEAVQAAEAGADLVLLDNFKPEELHPTATVLK	267	sp|Q15274|NADC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35	5-UNIMOD:4	ms_run[1]:scan=1.1.282.2	2.982033	5	4320.0971	4320.1835	K	A	198	238
PSM	LANQFAIYKPVTDFFLQLVDAGK	268	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=1.1.1841.2	18.3074	4	2598.354494	2597.389361	R	V	1244	1267
PSM	AAADGDDSLYPIAVLIDELR	269	sp|P30153|2AAA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	35	1-UNIMOD:1	ms_run[1]:scan=1.1.4721.3	41.33322	3	2158.0422	2158.0792	M	N	2	22
PSM	LGLCEFPDNDQFSNLEALLIQIGPK	270	sp|P43246|MSH2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	35	4-UNIMOD:4	ms_run[1]:scan=1.1.348.2	3.705833	3	2831.463971	2830.421132	K	E	173	198
PSM	YFILPDSLPLDTLLVDVEPK	271	sp|P62314|SMD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=1.1.554.3	6.129133	3	2288.205671	2286.239903	R	V	67	87
PSM	IEAELQDICNDVLELLDK	272	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	35	9-UNIMOD:4	ms_run[1]:scan=1.1.792.2	9.801766	3	2131.024571	2129.056202	K	Y	88	106
PSM	IEAELQDICNDVLELLDK	273	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	35	9-UNIMOD:4	ms_run[1]:scan=1.1.901.2	10.81777	3	2130.020171	2129.056202	K	Y	88	106
PSM	ESQLALIVCPLEQLLQGINPR	274	sp|Q92621|NU205_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34	9-UNIMOD:4	ms_run[1]:scan=1.1.4568.2	39.73108	4	2390.2665	2390.2991	R	T	869	890
PSM	FGAQLAHIQALISGIEAQLGDVR	275	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.594.2	6.679033	4	2406.2737	2406.3019	R	A	331	354
PSM	TELDSFLIEITANILK	276	sp|P52209-2|6PGD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.4719.3	41.27777	3	1818.9751	1818.9978	K	F	213	229
PSM	FLESVEGNQNYPLLLLTLLEK	277	sp|P55060-3|XPO2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.686.2	8.150133	4	2432.2905	2432.3202	K	S	32	53
PSM	ALGLGVEQLPVVFEDVVLHQATILPK	278	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.692.3	8.312984	4	2784.5369	2784.5790	R	T	902	928
PSM	TFEEAAAQLLESSVQNLFK	279	sp|Q9UKN8|TF3C4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.4717.4	41.22345	3	2124.0418	2124.0739	K	Q	517	536
PSM	IQFNDLQSLLCATLQNVLR	280	sp|Q14974-2|IMB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34	11-UNIMOD:4	ms_run[1]:scan=1.1.4716.4	41.19652	3	2245.1491	2245.1889	R	K	430	449
PSM	TGDDYIAIGADEEELGSQIEEAIYQEIR	281	sp|P23193-2|TCEA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.1510.2	15.52975	4	3126.3893	3126.4516	R	N	133	161
PSM	DAQVVQVVLDGLSNILK	282	sp|O00629|IMA3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.4719.2	41.2761	3	1809.9982	1810.0200	K	M	424	441
PSM	DQEGQDVLLFIDNIFR	283	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.4116.2	35.70715	3	1920.9337	1920.9581	R	F	295	311
PSM	CGAIAEQTPILLLFLLR	284	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34	1-UNIMOD:4	ms_run[1]:scan=1.1.3169.2	29.19613	3	1927.0657	1927.0965	R	N	1277	1294
PSM	FYPEDVAEELIQDITQK	285	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.556.3	6.174083	3	2036.9629	2036.9942	K	L	84	101
PSM	ETPEEVAADVLAEVITAAVR	286	sp|O43823|AKAP8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.4726.5	41.47223	3	2082.0535	2082.0844	K	A	568	588
PSM	LSVLDLVVALAPCADEAAISK	287	sp|Q5JTH9-2|RRP12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34	13-UNIMOD:4	ms_run[1]:scan=1.1.305.2	3.280517	3	2154.1249	2154.1606	R	L	651	672
PSM	YFILPDSLPLDTLLVDVEPK	288	sp|P62314|SMD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.687.4	8.179167	3	2286.1996	2286.2399	R	V	67	87
PSM	INALTAASEAACLIVSVDETIK	289	sp|Q99832-2|TCPH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34	12-UNIMOD:4	ms_run[1]:scan=1.1.1388.2	14.57397	3	2288.1508	2288.1933	R	N	296	318
PSM	LEQVSSDEGIGTLAENLLEALR	290	sp|Q5T4S7-2|UBR4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.687.5	8.184167	3	2356.1689	2356.2121	K	E	4751	4773
PSM	IQFNDLQSLLCATLQNVLRK	291	sp|Q14974-2|IMB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34	11-UNIMOD:4	ms_run[1]:scan=1.1.2628.2	24.9727	4	2373.2509	2373.2838	R	V	430	450
PSM	FLESVEGNQNYPLLLLTLLEK	292	sp|P55060-3|XPO2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.657.2	7.742833	3	2432.2747	2432.3202	K	S	32	53
PSM	LANQFAIYKPVTDFFLQLVDAGK	293	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=1.1.1849.2	18.45377	4	2598.350894	2597.389361	R	V	1244	1267
PSM	AAADGDDSLYPIAVLIDELR	294	sp|P30153|2AAA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	34	1-UNIMOD:1	ms_run[1]:scan=1.1.4720.5	41.30892	3	2158.0422	2158.0792	M	N	2	22
PSM	QLSQSLLPAIVELAEDAK	295	sp|P30153|2AAA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	34	1-UNIMOD:28	ms_run[1]:scan=1.1.1967.2	19.4003	3	1906.9962	1907.0242	R	W	399	417
PSM	ASVSELACIYSALILHDDEVTVTEDK	296	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	34	1-UNIMOD:1,8-UNIMOD:4	ms_run[1]:scan=1.1.548.2	5.973183	4	2919.3582	2919.4052	M	I	2	28
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	297	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	34	27-UNIMOD:4	ms_run[1]:scan=1.1.4140.2	36.31493	5	3513.635118	3512.695593	R	R	85	117
PSM	CAILTTLIHLVQGLGADSK	298	sp|Q9UI26|IPO11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	34	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.4730.4	41.57567	3	1992.0442	1992.0712	R	N	621	640
PSM	QIFNVNNLNLPQVALSFGFK	299	sp|Q9NVP1|DDX18_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	34	1-UNIMOD:28	ms_run[1]:scan=1.1.2437.2	23.47467	3	2245.1482	2245.1892	K	V	597	617
PSM	FLESVEGNQNYPLLLLTLLEK	300	sp|P55060-3|XPO2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.675.2	7.933033	4	2432.2905	2432.3202	K	S	32	53
PSM	LANQFAIYKPVTDFFLQLVDAGK	301	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.1826.2	18.00128	4	2597.3529	2597.3894	R	V	1244	1267
PSM	ALGLGVEQLPVVFEDVVLHQATILPK	302	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.691.3	8.28725	4	2784.5369	2784.5790	R	T	902	928
PSM	FDPTQFQDCIIQGLTETGTDLEAVAK	303	sp|Q7L1Q6-2|BZW1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33	9-UNIMOD:4	ms_run[1]:scan=1.1.876.2	10.56813	4	2896.3273	2896.3801	R	F	27	53
PSM	FDPTQFQDCIIQGLTETGTDLEAVAK	304	sp|Q7L1Q6-2|BZW1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33	9-UNIMOD:4	ms_run[1]:scan=1.1.871.2	10.49845	4	2896.3293	2896.3801	R	F	27	53
PSM	NITDYLIEEVSAEEEELLGSSGGAPPEEPPK	305	sp|Q9BXP5-2|SRRT_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.597.2	6.748466	4	3298.4989	3298.5616	K	E	560	591
PSM	LQNIFLGLVNIIEEK	306	sp|O15042-2|SR140_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.20.2	0.2665333	3	1741.9798	1741.9978	K	E	670	685
PSM	VDTMIVQAISLLDDLDK	307	sp|Q9Y2X3|NOP58_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.2392.2	22.53125	3	1887.9583	1887.9863	K	E	158	175
PSM	TATFAISILQQIELDLK	308	sp|P60842-2|IF4A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.1427.2	14.85072	3	1903.0396	1903.0666	K	A	83	100
PSM	FYPEDVAEELIQDITQK	309	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.511.3	5.150667	3	2036.9626	2036.9942	K	L	84	101
PSM	FYPEDVAEELIQDITQK	310	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.458.2	4.645683	3	2036.9626	2036.9942	K	L	84	101
PSM	YLASGAIDGIINIFDIATGK	311	sp|Q9GZS3|WDR61_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.3013.2	27.98295	3	2051.0596	2051.0939	K	L	162	182
PSM	DYVLNCSILNPLLTLLTK	312	sp|O60684|IMA7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33	6-UNIMOD:4	ms_run[1]:scan=1.1.3318.2	30.32505	3	2089.1137	2089.1493	R	S	203	221
PSM	HIQDAPEEFISELAEYLIK	313	sp|O94874-2|UFL1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.3951.2	34.49295	3	2244.0898	2244.1314	K	P	424	443
PSM	QYDADLEQILIQWITTQCR	314	sp|P37802-2|TAGL2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33	18-UNIMOD:4	ms_run[1]:scan=1.1.801.2	9.89575	3	2393.1223	2393.1685	K	K	42	61
PSM	TATALLESPLSATVEDALQSFLK	315	sp|Q96TC7-2|RMD3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.4720.7	41.31225	3	2404.2328	2404.2737	K	A	257	280
PSM	LLTAPELILDQWFQLSSSGPNSR	316	sp|Q9BSJ8-2|ESYT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.1713.2	17.18723	3	2571.2824	2571.3333	R	L	574	597
PSM	GDLENAFLNLVQCIQNKPLYFADR	317	sp|P07355-2|ANXA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33	13-UNIMOD:4	ms_run[1]:scan=1.1.236.2	2.2862	4	2837.3709	2837.4170	K	L	268	292
PSM	TGDDYIAIGADEEELGSQIEEAIYQEIR	318	sp|P23193-2|TCEA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.1504.3	15.47445	4	3126.3893	3126.4516	R	N	133	161
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	319	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.510.2	5.115633	5	3585.6321	3585.6942	R	R	85	117
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	320	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.556.4	6.18075	5	3585.6326	3585.6942	R	R	85	117
PSM	LANQFAIYKPVTDFFLQLVDAGK	321	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=1.1.1838.2	18.2306	4	2598.354494	2597.389361	R	V	1244	1267
PSM	LANQFAIYKPVTDFFLQLVDAGK	322	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=1.1.1816.2	17.90188	4	2598.352894	2597.389361	R	V	1244	1267
PSM	SDPAVNAQLDGIISDFEALK	323	sp|Q9UHD8-5|SEPT9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	33	1-UNIMOD:1	ms_run[1]:scan=1.1.628.2	7.3316	3	2144.0292	2144.0632	M	R	2	22
PSM	QIFNVNNLNLPQVALSFGFK	324	sp|Q9NVP1|DDX18_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	33	1-UNIMOD:28	ms_run[1]:scan=1.1.2496.2	23.98308	3	2245.1482	2245.1892	K	V	597	617
PSM	CMALAQLLVEQNFPAIAIHR	325	sp|O00148|DX39A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	33	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1511.2	15.55613	3	2277.1502	2277.1752	R	G	299	319
PSM	FGVICLEDLIHEIAFPGK	326	sp|Q6DKI1|RL7L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	33	5-UNIMOD:4	ms_run[1]:scan=1.1.1335.2	14.15472	3	2058.036371	2057.065585	K	H	180	198
PSM	LSVLDLVVALAPCADEAAISK	327	sp|Q5JTH9|RRP12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	33	13-UNIMOD:4	ms_run[1]:scan=1.1.271.2	2.777083	3	2156.129171	2154.160607	R	L	751	772
PSM	DDEAAAVALSSLIHALDDLDMVAIVR	328	sp|P13010|XRCC5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=1.1.4724.7	41.42145	3	2723.334671	2722.384746	R	Y	369	395
PSM	AAIGCGIVESILNWVK	329	sp|P11388-2|TOP2A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32	5-UNIMOD:4	ms_run[1]:scan=1.1.1.2	0.02375	2	1728.8904	1728.9233	K	F	427	443
PSM	FLESVEGNQNYPLLLLTLLEK	330	sp|P55060-3|XPO2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.679.2	7.989117	4	2432.2905	2432.3202	K	S	32	53
PSM	ALGLGVEQLPVVFEDVVLHQATILPK	331	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.621.2	7.249717	4	2784.5373	2784.5790	R	T	902	928
PSM	VLETPQEIHTVSSEAVSLLEEVITPR	332	sp|Q9H0A0-2|NAT10_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.1868.3	18.62825	4	2875.4689	2875.5179	K	K	591	617
PSM	IGQPSIALEYINTAIESTPTLIELFLVK	333	sp|Q9BXJ9-4|NAA15_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.4730.6	41.579	4	3072.6397	3072.6998	K	A	387	415
PSM	DTNYTLNTDSLDWALYDHLMDFLADR	334	sp|Q07021|C1QBP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.4704.3	40.86413	4	3117.3461	3117.4026	K	G	221	247
PSM	MTQIMFETFNTPAMYVAIQAVLSLYASGR	335	sp|P60709|ACTB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.4723.6	41.3928	4	3252.5505	3252.6021	K	T	119	148
PSM	DLATALEQLLQAYPR	336	sp|P55957-2|BID_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.709.3	8.593833	3	1700.8909	1700.9097	R	D	172	187
PSM	ERPPNPIEFLASYLLK	337	sp|Q9C005|DPY30_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.254.2	2.4953	3	1886.0047	1886.0301	K	N	75	91
PSM	VDQGTLFELILAANYLDIK	338	sp|P63208-2|SKP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.1295.2	13.83203	3	2135.1139	2135.1514	K	G	95	114
PSM	TVQDLTSVVQTLLQQMQDK	339	sp|O75506|HSBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.695.4	8.392	3	2174.0866	2174.1253	K	F	8	27
PSM	GSGTQLFDHIAECLANFMDK	340	sp|P52789|HXK2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32	13-UNIMOD:4	ms_run[1]:scan=1.1.123.2	1.036617	3	2252.9776	2253.0194	R	L	121	141
PSM	IIVENLFYPVTLDVLHQIFSK	341	sp|P26599-2|PTBP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.4715.2	41.16483	4	2487.3433	2487.3777	R	F	186	207
PSM	TDLLIVLSDVEGLFDSPPGSDDAK	342	sp|P54886-2|P5CS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.4718.10	41.26162	3	2502.1936	2502.2377	K	L	257	281
PSM	GDLENAFLNLVQCIQNKPLYFADR	343	sp|P07355-2|ANXA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32	13-UNIMOD:4	ms_run[1]:scan=1.1.235.3	2.260583	4	2837.3709	2837.4170	K	L	268	292
PSM	GDLENAFLNLVQCIQNKPLYFADR	344	sp|P07355-2|ANXA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32	13-UNIMOD:4	ms_run[1]:scan=1.1.237.2	2.31195	4	2837.3709	2837.4170	K	L	268	292
PSM	LANQFAIYKPVTDFFLQLVDAGK	345	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.1811.2	17.85203	4	2598.352894	2597.389361	R	V	1244	1267
PSM	ASVSELACIYSALILHDDEVTVTEDK	346	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	32	1-UNIMOD:1,8-UNIMOD:4	ms_run[1]:scan=1.1.549.4	5.99945	4	2919.3582	2919.4052	M	I	2	28
PSM	YSEPDLAVDFDNFVCCLVR	347	sp|P07384|CAN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	32	15-UNIMOD:4,16-UNIMOD:4	ms_run[1]:scan=1.1.347.2	3.679233	3	2318.993771	2318.034755	R	L	663	682
PSM	YFILPDSLPLDTLLVDVEPK	348	sp|P62314|SMD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.591.3	6.626333	3	2288.205671	2286.239903	R	V	67	87
PSM	DPSLVVAGEALDALFDVFADGK	349	sp|Q7Z4Q2|HEAT3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.4727.7	41.5023	3	2247.149471	2248.126330	K	E	594	616
PSM	NGFLNLALPFFGFSEPLAAPR	350	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.1565.2	16.02032	4	2277.1673	2277.1946	K	H	884	905
PSM	DLVILLYETALLSSGFSLEDPQTHANR	351	sp|P07900-2|HS90A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.4716.5	41.19818	4	3001.4945	3001.5396	K	I	783	810
PSM	VNDVVPWVLDVILNK	352	sp|Q5VYK3|ECM29_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.235.2	2.25225	3	1721.9533	1721.9716	K	H	935	950
PSM	TVLDLAVVLFETATLR	353	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.4722.3	41.36053	3	1759.9861	1760.0084	K	S	709	725
PSM	AMTTGAIAAMLSTILYSR	354	sp|P20618|PSB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.480.2	4.860717	3	1869.9418	1869.9692	K	R	110	128
PSM	AMTTGAIAAMLSTILYSR	355	sp|P20618|PSB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.428.2	4.359983	3	1869.9418	1869.9692	K	R	110	128
PSM	ERPPNPIEFLASYLLK	356	sp|Q9C005|DPY30_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.169.2	1.47815	3	1886.0041	1886.0301	K	N	75	91
PSM	NLATAYDNFVELVANLK	357	sp|Q8WUM4-2|PDC6I_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.511.2	5.142334	3	1893.9592	1893.9836	K	E	660	677
PSM	NLATAYDNFVELVANLK	358	sp|Q8WUM4-2|PDC6I_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.532.3	5.665317	3	1893.9592	1893.9836	K	E	660	677
PSM	DQEGQDVLLFIDNIFR	359	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.3983.2	34.70138	3	1920.9337	1920.9581	R	F	295	311
PSM	VAACELLHSMVMFMLGK	360	sp|P78527-2|PRKDC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31	4-UNIMOD:4	ms_run[1]:scan=1.1.2377.2	22.2365	3	1935.9172	1935.9443	K	A	928	945
PSM	CAILTTLIHLVQGLGADSK	361	sp|Q9UI26-2|IPO11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31	1-UNIMOD:4	ms_run[1]:scan=1.1.1834.3	18.1478	3	2009.0662	2009.0979	R	N	661	680
PSM	DVTEALILQLFSQIGPCK	362	sp|P31483-2|TIA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31	17-UNIMOD:4	ms_run[1]:scan=1.1.2396.2	22.64517	3	2031.0361	2031.0711	R	N	17	35
PSM	IQDALSTVLQYAEDVLSGK	363	sp|O00303|EIF3F_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.4720.4	41.30725	3	2049.0316	2049.0630	R	V	279	298
PSM	DTELAEELLQWFLQEEK	364	sp|Q00610-2|CLH1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.4692.2	40.65937	3	2119.9954	2120.0313	K	R	1546	1563
PSM	IQFNDLQSLLCATLQNVLRK	365	sp|Q14974-2|IMB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31	11-UNIMOD:4	ms_run[1]:scan=1.1.2543.2	24.30632	3	2373.2368	2373.2838	R	V	430	450
PSM	ALGLGVEQLPVVFEDVVLHQATILPK	366	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.698.3	8.449233	4	2785.538094	2784.578953	R	T	902	928
PSM	LANQFAIYKPVTDFFLQLVDAGK	367	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.1840.2	18.28187	4	2598.354494	2597.389361	R	V	1244	1267
PSM	LANQFAIYKPVTDFFLQLVDAGK	368	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.1848.2	18.42765	4	2598.350894	2597.389361	R	V	1244	1267
PSM	CGAIAEQTPILLLFLLR	369	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	31	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.4730.3	41.574	3	1910.0422	1910.0692	R	N	1277	1294
PSM	TQFLPPNLLALFAPR	370	sp|P08621|RU17_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	31	1-UNIMOD:1	ms_run[1]:scan=1.1.4722.2	41.35887	3	1738.9582	1738.9762	M	D	2	17
PSM	QSGAFLSTSEGLILQLVGDAVHPQFK	371	sp|Q96AB3-2|ISOC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.3587.2	32.17297	4	2741.3945	2741.4388	R	E	169	195
PSM	VLETPQEIHTVSSEAVSLLEEVITPR	372	sp|Q9H0A0-2|NAT10_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.1929.2	19.13353	4	2875.4689	2875.5179	K	K	591	617
PSM	AASLLLEILGLLCK	373	sp|Q04637-3|IF4G1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30	13-UNIMOD:4	ms_run[1]:scan=1.1.4722.7	41.3672	2	1512.8684	1512.8949	K	S	1332	1346
PSM	DTNYTLNTDSLDWALYDHLMDFLADR	374	sp|Q07021|C1QBP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.4713.4	41.11058	4	3117.3461	3117.4026	K	G	221	247
PSM	GFLEFVEDFIQVPR	375	sp|P51114-2|FXR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.2811.2	26.64298	3	1694.8501	1694.8668	R	N	277	291
PSM	VNPLSLVEIILHVVR	376	sp|Q9UNM6-2|PSD13_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.4721.2	41.33155	3	1700.0128	1700.0349	R	Q	73	88
PSM	TGAFSIPVIQIVYETLK	377	sp|Q92499-2|DDX1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.1244.2	13.4625	3	1878.0232	1878.0502	K	D	53	70
PSM	TGAFSIPVIQIVYETLK	378	sp|Q92499-2|DDX1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.1444.2	14.97278	3	1878.0238	1878.0502	K	D	53	70
PSM	ERPPNPIEFLASYLLK	379	sp|Q9C005|DPY30_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.209.2	1.98095	3	1886.0047	1886.0301	K	N	75	91
PSM	GEAIEAILAALEVVSEPFR	380	sp|Q13200-2|PSMD2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.4728.4	41.52368	3	2013.0556	2013.0782	K	S	411	430
PSM	NIVSLLLSMLGHDEDNTR	381	sp|Q92616|GCN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.2574.2	24.55047	3	2025.9814	2026.0153	K	I	2426	2444
PSM	FYPEDVAEELIQDITQK	382	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.532.4	5.670317	3	2036.9629	2036.9942	K	L	84	101
PSM	EAVSSAFFSLLQTLSTQFK	383	sp|Q9BQG0-2|MBB1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.4717.3	41.22178	3	2103.0550	2103.0888	R	Q	511	530
PSM	ELEAVCQDVLSLLDNYLIK	384	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30	6-UNIMOD:4	ms_run[1]:scan=1.1.4465.2	38.96135	3	2234.1091	2234.1504	K	N	92	111
PSM	ESQLALIVCPLEQLLQGINPR	385	sp|Q92621|NU205_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30	9-UNIMOD:4	ms_run[1]:scan=1.1.4526.2	39.42333	3	2390.2528	2390.2991	R	T	869	890
PSM	AVSGASAGDYSDAIETLLTAIAVIK	386	sp|Q8N684-2|CPSF7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.4721.8	41.34155	3	2435.2351	2435.2795	K	Q	346	371
PSM	ALGLGVEQLPVVFEDVVLHQATILPK	387	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.695.3	8.385333	4	2785.538094	2784.578953	R	T	902	928
PSM	LANQFAIYKPVTDFFLQLVDAGK	388	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.1837.2	18.19662	4	2598.354494	2597.389361	R	V	1244	1267
PSM	ASVSELACIYSALILHDDEVTVTEDK	389	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	30	1-UNIMOD:1,8-UNIMOD:4	ms_run[1]:scan=1.1.550.4	6.020317	4	2919.3582	2919.4052	M	I	2	28
PSM	QLTEMLPSILNQLGADSLTSLR	390	sp|P20290|BTF3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	30	1-UNIMOD:28	ms_run[1]:scan=1.1.4721.7	41.33988	3	2382.1992	2382.2462	K	R	142	164
PSM	QVLLSAAEAAEVILR	391	sp|P78371|TCPB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	30	1-UNIMOD:28	ms_run[1]:scan=1.1.479.2	4.834233	2	1564.8532	1564.8822	R	V	502	517
PSM	VDIVAINDPFIDLNYMVYMFQYDSTHGK	392	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.4715.11	41.17983	3	3308.498171	3307.556974	K	F	28	56
PSM	GFLEFVEDFIQVPR	393	sp|P51114-2|FXR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.2746.2	26.12867	3	1694.8501	1694.8668	R	N	277	291
PSM	INALTAASEAACLIVSVDETIK	394	sp|Q99832-2|TCPH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29	12-UNIMOD:4	ms_run[1]:scan=1.1.1299.2	13.87588	4	2288.1641	2288.1933	R	N	296	318
PSM	AGTLTVEELGATLTSLLAQAQAQAR	395	sp|P58107|EPIPL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.3574.2	32.05743	4	2512.3109	2512.3497	R	A	2477	2502
PSM	GIHSAIDASQTPDVVFASILAAFSK	396	sp|P54819-2|KAD2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.643.2	7.528133	4	2544.2877	2544.3224	R	A	205	230
PSM	LANQFAIYKPVTDFFLQLVDAGK	397	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.1832.3	18.09652	4	2597.3529	2597.3894	R	V	1244	1267
PSM	ALGLGVEQLPVVFEDVVLHQATILPK	398	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.694.3	8.366467	4	2784.5369	2784.5790	R	T	902	928
PSM	ALGLGVEQLPVVFEDVVLHQATILPK	399	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.641.3	7.5017	4	2784.5373	2784.5790	R	T	902	928
PSM	DYVISLGVVKPLLSFISPSIPITFLR	400	sp|O00629|IMA3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.4716.3	41.19485	4	2873.6205	2873.6670	R	N	193	219
PSM	NLDIERPTYTNLNRLIGQIVSSITASLR	401	sp|Q71U36-2|TBA1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.4721.6	41.33821	4	3156.6653	3156.7255	R	F	181	209
PSM	DLATALEQLLQAYPR	402	sp|P55957|BID_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1000663, ProteinPilot, ]	29		ms_run[1]:scan=1.1.722.2	8.751166	2	1700.9192470956602	1700.9097349421202	R	D	126	141
PSM	IIDLEEAEDEIEDIQQEITVLSQCDSSYVTK	403	sp|Q9P289-3|STK26_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29	24-UNIMOD:4	ms_run[1]:scan=1.1.4716.11	41.20818	4	3611.6281	3611.6924	K	Y	54	85
PSM	TGAFSIPVIQIVYETLK	404	sp|Q92499-2|DDX1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.1504.2	15.46612	3	1878.0220	1878.0502	K	D	53	70
PSM	GPGTSFEFALAIVEALNGK	405	sp|Q99497|PARK7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.2307.2	21.79965	3	1919.9710	1919.9993	R	E	157	176
PSM	NMAEQIIQEIYSQIQSK	406	sp|P29401-2|TKT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29	2-UNIMOD:35	ms_run[1]:scan=1.1.8.2	0.1269333	3	2037.9733	2038.0041	K	K	273	290
PSM	FYPEDVAEELIQDITQK	407	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.594.4	6.6907	3	2036.9629	2036.9942	K	L	84	101
PSM	YFILPDSLPLDTLLVDVEPK	408	sp|P62314|SMD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.715.2	8.689	3	2286.1996	2286.2399	R	V	67	87
PSM	DLGIFWLNAAETWVDISSNTAGK	409	sp|Q14697-2|GANAB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.4725.8	41.45016	3	2507.1856	2507.2332	R	T	332	355
PSM	EQNGDSLVHAAFVAESAVAGSAEANAFSVLQHVLGAGPHVK	410	sp|P22695|QCR2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.4714.5	41.14083	5	4083.9591	4084.0403	R	R	260	301
PSM	MTQIMFEAFNTPAMYVAIQAVLSLYASGR	411	sp|Q562R1|ACTBL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29	5-UNIMOD:35,14-UNIMOD:35	ms_run[1]:scan=1.1.4723.6	41.3928	4	3254.5737	3254.5814	K	T	120	149
PSM	TGAFSIPVIQIVYETLK	412	sp|Q92499|DDX1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.1561.2	15.9758	3	1879.027271	1878.050252	K	D	53	70
PSM	GDKPIWEQIGSSFIQHYYQLFDNDR	413	sp|P61970|NTF2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	29	1-UNIMOD:1	ms_run[1]:scan=1.1.4713.3	41.10892	4	3097.4042	3097.4562	M	T	2	27
PSM	CANLFEALVGTLK	414	sp|Q9P1F3|ABRAL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	29	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.3141.2	28.98675	2	1417.7032	1417.7272	K	A	39	52
PSM	VDIVAINDPFIDLNYMVYMFQYDSTHGK	415	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.4713.5	41.11225	4	3308.517694	3307.556974	K	F	28	56
PSM	ERPPNPIEFLASYLLK	416	sp|Q9C005|DPY30_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.115.2	0.9666333	3	1886.0014	1886.0301	K	N	75	91
PSM	YDCGEEILITVLSAMTEEAAVAIK	417	sp|Q6IS14|IF5AL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28	3-UNIMOD:4	ms_run[1]:scan=1.1.4726.4	41.47057	4	2625.2569	2625.2917	K	A	127	151
PSM	FVSSPQTIVELFFQEVAR	418	sp|Q12769|NU160_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.4716.2	41.19318	3	2096.0587	2096.0943	R	K	815	833
PSM	LNTIPLFVQLLYSSVENIQR	419	sp|P14923|PLAK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.4721.5	41.33655	3	2346.2524	2346.2947	R	V	583	603
PSM	DLATALEQLLQAYPR	420	sp|P55957-2|BID_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.744.2	9.150967	3	1700.8909	1700.9097	R	D	172	187
PSM	SAVELVQEFLNDLNK	421	sp|Q9H900-2|ZWILC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.166.2	1.41945	3	1717.8700	1717.8886	K	L	180	195
PSM	ANTNEVLWAVVAAFTK	422	sp|Q9H4A6|GOLP3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.19.2	0.2408	3	1732.8943	1732.9148	K	-	283	299
PSM	TGAFSIPVIQIVYETLK	423	sp|Q92499-2|DDX1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.1310.2	13.962	3	1878.0232	1878.0502	K	D	53	70
PSM	GYTSWAIGLSVADLAESIMK	424	sp|P00338-3|LDHA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.2778.2	26.40655	3	2111.0257	2111.0609	K	N	275	295
PSM	VSSIDLEIDSLSSLLDDMTK	425	sp|Q15942|ZYX_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.2746.3	26.137	3	2180.0386	2180.0770	K	N	141	161
PSM	ECANGYLELLDHVLLTLQK	426	sp|Q9Y490|TLN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28	2-UNIMOD:4	ms_run[1]:scan=1.1.324.2	3.4976	3	2228.1118	2228.1511	R	P	2242	2261
PSM	DIPIWGTLIQYIRPVFVSR	427	sp|Q8NF37|PCAT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.2898.2	27.19822	3	2272.2307	2272.2732	R	S	159	178
PSM	YSEPDLAVDFDNFVCCLVR	428	sp|P07384|CAN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28	15-UNIMOD:4,16-UNIMOD:4	ms_run[1]:scan=1.1.298.2	3.178217	3	2317.9924	2318.0348	R	L	663	682
PSM	QEAIDWLLGLAVR	429	sp|Q9Y224|RTRAF_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:28	ms_run[1]:scan=1.1.3765.2	33.294	2	1465.7652	1465.7922	R	L	77	90
PSM	TLLEGSGLESIISIIHSSLAEPR	430	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.550.2	6.011983	4	2421.2837	2421.3115	R	V	2483	2506
PSM	FLESVEGNQNYPLLLLTLLEK	431	sp|P55060-3|XPO2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.687.2	8.170834	4	2432.2905	2432.3202	K	S	32	53
PSM	DTNYTLNTDSLDWALYDHLMDFLADR	432	sp|Q07021|C1QBP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.4714.4	41.13917	4	3117.3461	3117.4026	K	G	221	247
PSM	VNDVVPWVLDVILNK	433	sp|Q5VYK3|ECM29_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.192.2	1.7383	3	1721.9533	1721.9716	K	H	935	950
PSM	INLSLSTLGNVISALVDGK	434	sp|Q9Y496|KIF3A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.4708.2	40.96803	3	1913.0551	1913.0833	K	S	273	292
PSM	STTTAEDIEQFLLNYLK	435	sp|O43156|TTI1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.805.2	9.939484	3	1984.9714	1984.9993	K	E	802	819
PSM	DVTEALILQLFSQIGPCK	436	sp|P31483-2|TIA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	17-UNIMOD:4	ms_run[1]:scan=1.1.2425.2	23.16072	3	2031.0361	2031.0711	R	N	17	35
PSM	FYPEDVAEELIQDITQK	437	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.399.2	4.121567	3	2036.9626	2036.9942	K	L	84	101
PSM	VDQGTLFELILAANYLDIK	438	sp|P63208-2|SKP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.1229.2	13.33097	3	2135.1139	2135.1514	K	G	95	114
PSM	TVQDLTSVVQTLLQQMQDK	439	sp|O75506|HSBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.733.3	8.896	3	2174.0866	2174.1253	K	F	8	27
PSM	DTELAEELLQWFLQEEKR	440	sp|Q00610-2|CLH1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.607.3	7.006417	3	2276.0929	2276.1324	K	E	1546	1564
PSM	DMDLTEVITGTLWNLSSHDSIK	441	sp|O60716-10|CTND1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.1091.2	12.20423	3	2474.1517	2474.1999	R	M	411	433
PSM	ALGLGVEQLPVVFEDVVLHQATILPK	442	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.701.2	8.518	4	2785.538094	2784.578953	R	T	902	928
PSM	CIECVQPQSLQFIIDAFK	443	sp|Q14671|PUM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:385,1-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=1.1.2399.3	22.68175	3	2178.0062	2178.0482	K	G	977	995
PSM	QLDLLCDIPLVGFINSLK	444	sp|O43818|U3IP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:28,6-UNIMOD:4	ms_run[1]:scan=1.1.4727.5	41.49897	3	2040.0602	2040.0962	R	F	411	429
PSM	CANLFEALVGTLK	445	sp|Q9P1F3|ABRAL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.3080.2	28.48345	2	1417.7032	1417.7272	K	A	39	52
PSM	CANLFEALVGTLK	446	sp|Q9P1F3|ABRAL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.3205.2	29.49157	2	1417.7032	1417.7272	K	A	39	52
PSM	DVPFSVVYFPLFANLNQLGR	447	sp|Q9H936|GHC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.1856.2	18.516	3	2295.163271	2295.205189	R	P	197	217
PSM	SENVQDLLLLDVTPLSLGIETAGGVMTPLIK	448	sp|P54652|HSP72_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.4726.7	41.47557	4	3238.714894	3235.762533	K	R	388	419
PSM	LDTLCDLYETLTITQAVIFINTR	449	sp|P60842-2|IF4A1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	5-UNIMOD:4	ms_run[1]:scan=1.1.4722.5	41.36386	4	2712.3709	2712.4044	K	R	260	283
PSM	DITYFIQQLLR	450	sp|Q9C0K3|ARP3C_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.470.2	4.759567	2	1408.7476	1408.7714	R	E	70	81
PSM	VIAGFSLLNLLFK	451	sp|Q9HCJ6|VAT1L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.1136.2	12.58398	2	1433.8408	1433.8646	K	Q	312	325
PSM	VLETPQEIHTVSSEAVSLLEEVITPR	452	sp|Q9H0A0-2|NAT10_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.1833.3	18.12225	4	2875.4689	2875.5179	K	K	591	617
PSM	YSTPVDIWSIGTIFAELATK	453	sp|P06493-2|CDK1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.4720.6	41.31059	3	2211.1141	2211.1463	R	K	124	144
PSM	DTNYTLNTDSLDWALYDHLMDFLADR	454	sp|Q07021|C1QBP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.4710.9	41.03377	4	3117.3461	3117.4026	K	G	221	247
PSM	ERPPNPIEFLASYLLK	455	sp|Q9C005|DPY30_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.283.2	3.007683	3	1887.006671	1886.030185	K	N	75	91
PSM	LLDGEAALPAVVFLHGLFGSK	456	sp|Q8NFV4|ABHDB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.746.3	9.21075	3	2154.154871	2153.188477	R	T	59	80
PSM	GADNLVAINLIVQHIQDILNGGPSK	457	sp|Q9BZX2-2|UCK2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.4701.2	40.7805	4	2598.3761	2598.4129	R	R	61	86
PSM	DLVEAVAHILGIR	458	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.2058.2	20.06428	3	1404.8014	1404.8089	R	D	2126	2139
PSM	ELQLEYLLGAFESLGK	459	sp|Q5VYK3|ECM29_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.1832.2	18.08818	3	1808.9338	1808.9560	K	A	1686	1702
PSM	DSSLFDIFTLSCNLLK	460	sp|Q9UIA9|XPO7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	12-UNIMOD:4	ms_run[1]:scan=1.1.1535.2	15.7592	3	1871.9077	1871.9339	R	Q	183	199
PSM	AFAVVASALGIPSLLPFLK	461	sp|O75533|SF3B1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.139.2	1.194367	3	1913.1142	1913.1390	R	A	631	650
PSM	GPGTSFEFALAIVEALNGK	462	sp|Q99497|PARK7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.2236.2	21.3003	3	1919.9713	1919.9993	R	E	157	176
PSM	QLNHFWEIVVQDGITLITK	463	sp|P13010|XRCC5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.2163.2	20.78815	3	2253.1744	2253.2158	K	E	670	689
PSM	IIPAIATTTAAVVGLVCLELYK	464	sp|P22314-2|UBA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	17-UNIMOD:4	ms_run[1]:scan=1.1.4719.6	41.28277	3	2315.2720	2315.3174	K	V	850	872
PSM	SGETEDTFIADLVVGLCTGQIK	465	sp|P06733-2|ENOA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	17-UNIMOD:4	ms_run[1]:scan=1.1.4711.6	41.0568	3	2352.1162	2352.1519	R	T	280	302
PSM	LQADDFLQDYTLLINILHSEDLGK	466	sp|Q9UBT2-2|SAE2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.2238.2	21.33175	4	2773.3733	2773.4174	R	D	421	445
PSM	LPITVLNGAPGFINLCDALNAWQLVK	467	sp|P31939-2|PUR9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	16-UNIMOD:4	ms_run[1]:scan=1.1.1599.2	16.35722	4	2836.4829	2836.5309	K	E	225	251
PSM	VPIPCYLIALVVGALESR	468	sp|P09960-2|LKHA4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	5-UNIMOD:4	ms_run[1]:scan=1.1.4728.3	41.52202	3	1969.0891	1969.1070	K	Q	196	214
PSM	CPALYWLSGLTCTEQNFISK	469	sp|P10768|ESTD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:385,1-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.4728.6	41.52702	3	2370.0612	2370.1022	K	S	45	65
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	470	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	27-UNIMOD:4	ms_run[1]:scan=1.1.4151.2	36.46985	4	3511.668094	3512.695593	R	R	85	117
PSM	GFHLDVEDYLSGVLILASELSR	471	sp|Q15631|TSN_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.4723.5	41.39113	3	2431.280471	2432.258741	K	L	132	154
PSM	LLTAPELILDQWFQLSSSGPNSR	472	sp|Q9BSJ8-2|ESYT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.1695.2	17.06143	4	2571.2945	2571.3333	R	L	574	597
PSM	VLTLSEDSPYETLHSFISNAVAPFFK	473	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.4692.3	40.6677	4	2911.4117	2911.4644	R	S	137	163
PSM	DGVTLYLLQSVNQLLLTATK	474	sp|A6NHR9-2|SMHD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.4723.2	41.38614	3	2189.1946	2189.2307	K	E	93	113
PSM	LLGNVVASLAQALQELSTSFR	475	sp|O14662-2|STX16_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.4729.4	41.54977	3	2216.1763	2216.2165	R	H	136	157
PSM	NLFDNLIEFLQK	476	sp|Q9UBD5-2|ORC3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.1577.3	16.17203	2	1492.7632	1492.7926	K	S	68	80
PSM	HAFEIIHLLTGENPLQVLVNAIINSGPR	477	sp|P46782|RS5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.4725.5	41.44517	4	3064.6281	3064.6822	K	E	95	123
PSM	TLSTIATSTDAASVVHSTDLVVEAIVENLK	478	sp|Q16836-2|HCDH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.4712.4	41.08202	4	3083.5665	3083.6238	K	V	155	185
PSM	GSVPLGLATVLQDLLR	479	sp|Q8WUX9-2|CHMP7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.1774.2	17.5905	2	1650.9366	1650.9669	K	R	85	101
PSM	FSSVQLLGDLLFHISGVTGK	480	sp|Q92616|GCN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.735.2	8.947567	3	2117.1172	2117.1521	R	M	1833	1853
PSM	TLLEGSGLESIISIIHSSLAEPR	481	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.521.3	5.383917	3	2421.2647	2421.3115	R	V	2483	2506
PSM	DYPVVSIEDPFDQDDWGAWQK	482	sp|P06733-2|ENOA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.4701.3	40.78883	3	2509.0624	2509.1074	K	F	193	214
PSM	VTVEPQDSGTSALPLVSLFFYVVTDGK	483	sp|Q13724-2|MOGS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.4729.9	41.5581	3	2868.4918	2868.4797	R	E	82	109
PSM	QLNHFWEIVVQDGITLITK	484	sp|P13010|XRCC5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:28	ms_run[1]:scan=1.1.4726.6	41.4739	3	2236.1462	2236.1882	K	E	670	689
PSM	ASVSELACIYSALILHDDEVTVTEDK	485	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:1,8-UNIMOD:4	ms_run[1]:scan=1.1.4713.9	41.11892	3	2919.3472	2919.4052	M	I	2	28
PSM	EQNGDSLVHAAFVAESAVAGSAEANAFSVLQHVLGAGPHVK	486	sp|P22695|QCR2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.4712.3	41.08035	6	4083.9811	4084.0403	R	R	260	301
PSM	DLVEAVAHILGIR	487	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.1988.2	19.5455	3	1404.8014	1404.8089	R	D	2126	2139
PSM	DLVEAVAHILGIR	488	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.2130.2	20.57408	3	1404.8014	1404.8089	R	D	2126	2139
PSM	VLTLSEDSPYETLHSFISNAVAPFFK	489	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.4715.4	41.16817	4	2911.4117	2911.4644	R	S	137	163
PSM	LLDGEAALPAVVFLHGLFGSK	490	sp|Q8NFV4-2|ABHDB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.784.2	9.7341	3	2153.1523	2153.1885	R	T	59	80
PSM	VNLSQDLEHQLQNIIQELNLEILPPPEDPSVPVALNIGK	491	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.4718.4	41.25162	6	4326.2455	4326.3111	K	L	276	315
PSM	ETPFELIEALLK	492	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.4150.2	36.45273	2	1401.7522	1401.7755	K	Y	631	643
PSM	QLFSSLFSGILK	493	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:28	ms_run[1]:scan=1.1.227.2	2.13215	2	1321.7082	1321.7272	K	E	2807	2819
PSM	AGILFEDIFDVK	494	sp|P52434|RPAB3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:1	ms_run[1]:scan=1.1.3626.2	32.44087	2	1407.7052	1407.7282	M	D	2	14
PSM	CLDILEDYLIQR	495	sp|Q8TD26|CHD6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1094.2	12.26962	2	1532.7252	1532.7542	R	R	811	823
PSM	QLILEEIFTSLAR	496	sp|Q6KC79|NIPBL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:28	ms_run[1]:scan=1.1.4732.2	41.62683	2	1514.8112	1514.8342	R	L	1450	1463
PSM	QCVLSTLAQLLLDK	497	sp|Q9NU22|MDN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:28,2-UNIMOD:4	ms_run[1]:scan=1.1.4723.4	41.38947	2	1583.8292	1583.8592	R	D	42	56
PSM	DLLQIIFSFSK	498	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.2416.2	22.99777	2	1309.7068	1309.7282	R	A	304	315
PSM	DLLQIIFSFSK	499	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.2390.2	22.48332	2	1309.7068	1309.7282	R	A	304	315
PSM	DITYFIQQLLR	500	sp|Q9C0K3|ARP3C_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.418.2	4.259167	2	1408.7476	1408.7714	R	E	70	81
PSM	VEVECSSLQEAVQAAEAGADLVLLDNFKPEELHPTATVLK	501	sp|Q15274|NADC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	5-UNIMOD:4	ms_run[1]:scan=1.1.250.2	2.431117	6	4320.1147	4320.1835	K	A	198	238
PSM	NQSLFCWEIPVQIVSHL	502	sp|P61916|NPC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	6-UNIMOD:4	ms_run[1]:scan=1.1.8.3	0.1319333	3	2069.0065	2069.0404	K	-	135	152
PSM	QSQLVVDWLESIAK	503	sp|P57740|NU107_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:28	ms_run[1]:scan=1.1.3522.2	31.69143	2	1597.8032	1597.8342	R	D	265	279
PSM	DGAGFLINLIDSPGHVDFSSEVTAALR	504	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.4710.3	41.02377	4	2800.3589	2800.4032	K	V	94	121
PSM	VLELAQLLDQIWR	505	sp|Q9P2I0|CPSF2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.685.2	8.121	3	1595.8891	1595.9035	R	T	243	256
PSM	NGFLNLALPFFGFSEPLAAPR	506	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.1511.2	15.55613	3	2277.1510	2277.1946	K	H	884	905
PSM	DIVAIILNEFR	507	sp|P49643|PRI2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.570.2	6.404883	2	1301.7158	1301.7343	K	A	213	224
PSM	CLDILEDYLIQR	508	sp|Q8TD26|CHD6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1029.2	11.73577	2	1532.7252	1532.7542	R	R	811	823
PSM	DYEEVGVDSVEGEGEEEGEEY	509	sp|P68363|TBA1B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.6722.2	54.7024	3	2347.8652	2347.8976	K	-	431	452
PSM	ETPFELIEALLK	510	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.4215.2	36.95765	2	1401.7522	1401.7755	K	Y	631	643
PSM	ASFEEASNQLINHIEQFLDTNETPYFMK	511	sp|P13010|XRCC5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.4708.5	40.97803	4	3315.4745	3315.5394	K	S	607	635
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	512	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.4711.3	41.0518	5	3585.6336	3585.6942	R	R	85	117
PSM	IQPGSQQADFLDALIVSMDVIQHETIGK	513	sp|P13010|XRCC5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.4710.6	41.02877	4	3052.4993	3052.5539	K	K	98	126
PSM	LAYSNGKDDEQNFIQNLSLFLCTFLK	514	sp|O14980|XPO1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	22-UNIMOD:4	ms_run[1]:scan=1.1.4722.8	41.36887	4	3077.4713	3077.5168	R	E	306	332
PSM	QLFSSLFSGILK	515	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:28	ms_run[1]:scan=1.1.184.2	1.6296	2	1321.7082	1321.7272	K	E	2807	2819
PSM	QMAEIAVNAVLTVADMER	516	sp|P48643|TCPE_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:28	ms_run[1]:scan=1.1.4728.11	41.53535	2	1942.9172	1942.9492	R	R	184	202
PSM	DIPIWGTLIQYIRPVFVSR	517	sp|Q8NF37|PCAT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.2900.2	27.22933	4	2272.2461	2272.2732	R	S	159	178
PSM	DGPSAGCTIVTALLSLAMGRPVR	518	sp|P36776-2|LONM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	7-UNIMOD:4	ms_run[1]:scan=1.1.4719.7	41.28443	3	2341.1875	2341.2246	K	Q	788	811
PSM	AYLDQTVVPILLQGLAVLAK	519	sp|Q9C005|DPY30_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.4717.4	41.22345	3	2124.2215	2124.2558	R	E	55	75
PSM	SLEELPVDIILASVG	520	sp|Q9Y678|COPG1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18		ms_run[1]:scan=1.1.895.2	10.74202	2	1553.8252	1553.8552	R	-	860	875
PSM	IIGINGDFFANMVVDAVLAIK	521	sp|P17987|TCPA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18		ms_run[1]:scan=1.1.4729.5	41.55143	3	2219.1613	2219.2024	K	Y	160	181
PSM	GVDLDQLLDMSYEQLMQLYSAR	522	sp|P62841|RS15_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18		ms_run[1]:scan=1.1.4720.2	41.30392	4	2587.1985	2587.2298	R	Q	19	41
PSM	TSSSIPPIILLQFLHMAFPQFAEK	523	sp|P54578-2|UBP14_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18		ms_run[1]:scan=1.1.4717.2	41.22012	4	2714.4073	2714.4506	K	G	131	155
PSM	SVAWNPSPAVCLVAAAVEDSVLLLNPALGDR	524	sp|Q14137|BOP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	18	11-UNIMOD:4	ms_run[1]:scan=1.1.4726.10	41.48057	3	3204.611171	3203.664885	K	L	459	490
459	490