MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000349 -- main2
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20200417\20200417151800575569^127.0.0.1^jpost@jpost.jpost\Psearch.ProteinPilotExecV5\Data140714_Kuno29.pilotFin.txt
MTD	software[1]	[MS, MS:1000663, ProteinPilot, 5.0.0.0, 4767]
MTD	software[1]-setting	FASTA=uniprot_mouse_20200318.fasta
MTD	software[1]-setting	PARAGON_VERSION=5.0.0.0, 4767
MTD	software[1]-setting	UI_SAMPLE_TYPE=Identification
MTD	software[1]-setting	UI_CYS_ALKYLATION=Iodoacetamide
MTD	software[1]-setting	UI_DIGESTION=Trypsin + Lys C
MTD	software[1]-setting	UI_INSTRUMENT=TripleTOF 5600
MTD	software[1]-setting	UI_SEARCH_EFFORT=Thorough
MTD	software[1]-setting	UI_ID_FOCUS=Biological modifications
MTD	software[1]-setting	UI_MIN_UNUSED_PROTSCORE=0.0458
MTD	software[1]-setting	MSTOLERANCE=0.05
MTD	software[1]-setting	MSTOLERANCE_U=Daltons
MTD	software[1]-setting	MSMSTOLERANCE=0.1
MTD	software[1]-setting	MSMSTOLERANCE_U=Daltons
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.uniprot_mouse_20200318
MTD	software[2]-setting	CLE=[R]|{P},[K]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=100
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=1
MTD	software[3]	[MS, MS:1002251, Comet, 2015.02 rev. 0]
MTD	software[3]-setting	Taxon=userFasta.uniprot_mouse_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Oxidation (M)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=1
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[1]-site	M
MTD	variable_mod[1]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P01942|HBA_MOUSE	Hemoglobin subunit alpha OS=Mus musculus (Mouse) OX=10090 GN=Hba PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	54.0	null	105-UNIMOD:4,33-UNIMOD:35	0.53	54.0	51	7	0
PRT	tr|Q91VB8|Q91VB8_MOUSE	Isoform of P01942, GLOBIN domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Hba-a1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	52.0	null	105-UNIMOD:4	0.46	52.0	6	3	0
PRT	sp|P07724|ALBU_MOUSE	Serum albumin OS=Mus musculus (Mouse) OX=10090 GN=Alb PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	51.0	null	313-UNIMOD:4,340-UNIMOD:4,322-UNIMOD:35,511-UNIMOD:4,384-UNIMOD:4,385-UNIMOD:4,393-UNIMOD:4,384-UNIMOD:385,591-UNIMOD:4,538-UNIMOD:4,582-UNIMOD:4,583-UNIMOD:4,114-UNIMOD:4,115-UNIMOD:4,472-UNIMOD:4,148-UNIMOD:4,118-UNIMOD:28,125-UNIMOD:4,58-UNIMOD:4,269-UNIMOD:4,270-UNIMOD:4,277-UNIMOD:4,99-UNIMOD:4,302-UNIMOD:4,303-UNIMOD:4	0.58	51.0	75	24	6
PRT	sp|Q8K0L3|ACSM2_MOUSE	Acyl-coenzyme A synthetase ACSM2, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Acsm2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	49.0	null	174-UNIMOD:4,371-UNIMOD:4,92-UNIMOD:28,101-UNIMOD:4,134-UNIMOD:35,318-UNIMOD:35,236-UNIMOD:4,445-UNIMOD:35,140-UNIMOD:35	0.55	49.0	71	23	5
PRT	tr|A8DUK4|A8DUK4_MOUSE	GLOBIN domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Hbb-bs PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	48.0	null	56-UNIMOD:35,110-UNIMOD:35	0.77	48.0	53	11	3
PRT	sp|Q99KI0|ACON_MOUSE	Aconitate hydratase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Aco2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	48.0	null	385-UNIMOD:4,448-UNIMOD:4,451-UNIMOD:4,332-UNIMOD:4	0.44	48.0	50	24	8
PRT	sp|Q9JLJ2|AL9A1_MOUSE	4-trimethylaminobutyraldehyde dehydrogenase OS=Mus musculus (Mouse) OX=10090 GN=Aldh9a1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	46.0	null	220-UNIMOD:4,355-UNIMOD:4,74-UNIMOD:4,45-UNIMOD:4,484-UNIMOD:4	0.29	46.0	17	10	3
PRT	sp|P08249|MDHM_MOUSE	Malate dehydrogenase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Mdh2 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	46.0	null	89-UNIMOD:4,251-UNIMOD:35,93-UNIMOD:4,212-UNIMOD:4,315-UNIMOD:35	0.40	46.0	33	11	1
PRT	tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE	Glyceraldehyde-3-phosphate dehydrogenase OS=Mus musculus (Mouse) OX=10090 GN=Gm10358 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	45.0	null	329-UNIMOD:35,326-UNIMOD:35,128-UNIMOD:35,131-UNIMOD:35	0.38	45.0	23	9	1
PRT	sp|P63038|CH60_MOUSE	60 kDa heat shock protein, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Hspd1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	45.0	null	237-UNIMOD:385,237-UNIMOD:4,447-UNIMOD:4	0.58	45.0	52	24	10
PRT	sp|Q8CHT0|AL4A1_MOUSE	Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Aldh4a1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	45.0	null	65-UNIMOD:4	0.34	45.0	25	11	5
PRT	sp|P60710|ACTB_MOUSE	Actin, cytoplasmic 1 OS=Mus musculus (Mouse) OX=10090 GN=Actb PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	45.0	null	217-UNIMOD:4,2-UNIMOD:1,17-UNIMOD:4,325-UNIMOD:35,47-UNIMOD:35,44-UNIMOD:35,257-UNIMOD:4,272-UNIMOD:4,153-UNIMOD:35,360-UNIMOD:28	0.61	45.0	50	14	4
PRT	sp|P97807|FUMH_MOUSE	Fumarate hydratase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Fh PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	44.0	null	330-UNIMOD:4	0.37	44.0	20	12	5
PRT	sp|Q91Y97|ALDOB_MOUSE	Fructose-bisphosphate aldolase B OS=Mus musculus (Mouse) OX=10090 GN=Aldob PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1000663, ProteinPilot, ]	44.0	null	158-UNIMOD:4,2-UNIMOD:1,240-UNIMOD:4,251-UNIMOD:35,290-UNIMOD:385,290-UNIMOD:4,269-UNIMOD:4	0.48	44.0	38	12	3
PRT	sp|P14152|MDHC_MOUSE	Malate dehydrogenase, cytoplasmic OS=Mus musculus (Mouse) OX=10090 GN=Mdh1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	43.0	null	137-UNIMOD:4,154-UNIMOD:4	0.23	43.0	19	6	0
PRT	sp|P17182|ENOA_MOUSE	Alpha-enolase OS=Mus musculus (Mouse) OX=10090 GN=Eno1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	43.0	null	337-UNIMOD:4,339-UNIMOD:4,165-UNIMOD:35	0.48	43.0	24	12	5
PRT	sp|Q9DCW4|ETFB_MOUSE	Electron transfer flavoprotein subunit beta OS=Mus musculus (Mouse) OX=10090 GN=Etfb PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	43.0	null	42-UNIMOD:4,66-UNIMOD:4,71-UNIMOD:4	0.38	43.0	18	7	1
PRT	sp|Q9DBM2|ECHP_MOUSE	Peroxisomal bifunctional enzyme OS=Mus musculus (Mouse) OX=10090 GN=Ehhadh PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	43.0	null	471-UNIMOD:4,561-UNIMOD:4,17-UNIMOD:4,618-UNIMOD:4,618-UNIMOD:385,51-UNIMOD:4,58-UNIMOD:4,680-UNIMOD:28,395-UNIMOD:4	0.47	43.0	43	23	8
PRT	sp|P99029|PRDX5_MOUSE	Peroxiredoxin-5, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Prdx5 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1000663, ProteinPilot, ]	43.0	null	200-UNIMOD:4,96-UNIMOD:4	0.60	43.0	32	11	1
PRT	sp|Q3UNZ8|QORL2_MOUSE	Quinone oxidoreductase-like protein 2 OS=Mus musculus (Mouse) OX=10090 GN=Cryzl2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	43.0	null	122-UNIMOD:4,61-UNIMOD:4,71-UNIMOD:4	0.36	43.0	8	7	6
PRT	sp|P52760|RIDA_MOUSE	2-iminobutanoate/2-iminopropanoate deaminase OS=Mus musculus (Mouse) OX=10090 GN=Rida PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	42.0	null	71-UNIMOD:4	0.69	42.0	12	5	0
PRT	sp|P17563|SBP1_MOUSE	Methanethiol oxidase OS=Mus musculus (Mouse) OX=10090 GN=Selenbp1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	42.0	null	268-UNIMOD:4,8-UNIMOD:4,371-UNIMOD:4,80-UNIMOD:4,83-UNIMOD:4,31-UNIMOD:4,412-UNIMOD:28,131-UNIMOD:4,141-UNIMOD:4	0.62	42.0	37	18	6
PRT	sp|Q61425|HCDH_MOUSE	Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Hadh PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	42.0	null	201-UNIMOD:4,256-UNIMOD:35	0.23	42.0	13	4	0
PRT	sp|Q99LC5|ETFA_MOUSE	Electron transfer flavoprotein subunit alpha, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Etfa PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	42.0	null	53-UNIMOD:4,102-UNIMOD:28,109-UNIMOD:4	0.47	42.0	20	10	4
PRT	sp|P16460|ASSY_MOUSE	Argininosuccinate synthase OS=Mus musculus (Mouse) OX=10090 GN=Ass1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	42.0	null	331-UNIMOD:4,67-UNIMOD:27,166-UNIMOD:28,132-UNIMOD:4,97-UNIMOD:4	0.48	42.0	34	15	4
PRT	sp|Q99NB1|ACS2L_MOUSE	Acetyl-coenzyme A synthetase 2-like, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Acss1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	42.0	null	178-UNIMOD:4	0.20	42.0	13	9	5
PRT	sp|P21550|ENOB_MOUSE	Beta-enolase OS=Mus musculus (Mouse) OX=10090 GN=Eno3 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	42.0	null	357-UNIMOD:4	0.04	42.0	3	1	0
PRT	sp|Q9JII6|AK1A1_MOUSE	Aldo-keto reductase family 1 member A1 OS=Mus musculus (Mouse) OX=10090 GN=Akr1a1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	41.0	null	46-UNIMOD:4,187-UNIMOD:4,200-UNIMOD:4,168-UNIMOD:28,286-UNIMOD:35,14-UNIMOD:35	0.52	41.0	35	12	1
PRT	sp|Q91V76|CK054_MOUSE	Ester hydrolase C11orf54 homolog OS=Mus musculus (Mouse) OX=10090 GN=MGI:1918234 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	41.0	null	226-UNIMOD:4,154-UNIMOD:4,187-UNIMOD:4,2-UNIMOD:1,3-UNIMOD:4,38-UNIMOD:4	0.43	41.0	14	8	4
PRT	sp|P06745|G6PI_MOUSE	Glucose-6-phosphate isomerase OS=Mus musculus (Mouse) OX=10090 GN=Gpi PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	41.0	null	437-UNIMOD:35,404-UNIMOD:4	0.31	41.0	14	9	5
PRT	sp|Q64442|DHSO_MOUSE	Sorbitol dehydrogenase OS=Mus musculus (Mouse) OX=10090 GN=Sord PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	41.0	null	179-UNIMOD:4,120-UNIMOD:4,130-UNIMOD:4,301-UNIMOD:4,45-UNIMOD:4,165-UNIMOD:4,106-UNIMOD:4	0.50	41.0	35	11	2
PRT	sp|Q99KP3|CRYL1_MOUSE	Lambda-crystallin homolog OS=Mus musculus (Mouse) OX=10090 GN=Cryl1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	41.0	null	2-UNIMOD:1,125-UNIMOD:4,141-UNIMOD:4	0.49	41.0	18	10	4
PRT	sp|P10649|GSTM1_MOUSE	Glutathione S-transferase Mu 1 OS=Mus musculus (Mouse) OX=10090 GN=Gstm1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1000663, ProteinPilot, ]	40.0	null	115-UNIMOD:4,105-UNIMOD:35,174-UNIMOD:4,19-UNIMOD:35,174-UNIMOD:385,123-UNIMOD:28	0.59	40.0	22	13	6
PRT	sp|P34884|MIF_MOUSE	Macrophage migration inhibitory factor OS=Mus musculus (Mouse) OX=10090 GN=Mif PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	40.0	null	57-UNIMOD:4,60-UNIMOD:4,81-UNIMOD:4	0.67	40.0	8	4	2
PRT	sp|O88844|IDHC_MOUSE	Isocitrate dehydrogenase [NADP] cytoplasmic OS=Mus musculus (Mouse) OX=10090 GN=Idh1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	40.0	null	269-UNIMOD:4,363-UNIMOD:4,245-UNIMOD:4	0.52	40.0	26	18	11
PRT	sp|Q91WR5|AK1CL_MOUSE	Aldo-keto reductase family 1 member C21 OS=Mus musculus (Mouse) OX=10090 GN=Akr1c21 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	40.0	null	145-UNIMOD:4,87-UNIMOD:4	0.35	40.0	18	7	1
PRT	sp|P47199|QOR_MOUSE	Quinone oxidoreductase OS=Mus musculus (Mouse) OX=10090 GN=Cryz PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	39.0	null	166-UNIMOD:4,137-UNIMOD:4,125-UNIMOD:28	0.49	39.0	19	10	2
PRT	sp|O35215|DOPD_MOUSE	D-dopachrome decarboxylase OS=Mus musculus (Mouse) OX=10090 GN=Ddt PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	39.0	null	57-UNIMOD:4,2-UNIMOD:1	0.53	39.0	13	4	0
PRT	sp|O08749|DLDH_MOUSE	Dihydrolipoyl dehydrogenase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Dld PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	39.0	null	80-UNIMOD:4,85-UNIMOD:4,477-UNIMOD:4	0.24	39.0	17	8	3
PRT	sp|Q9DCS2|MTL26_MOUSE	Methyltransferase-like 26 OS=Mus musculus (Mouse) OX=10090 GN=Mettl26 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	39.0	null		0.40	39.0	4	4	4
PRT	sp|Q8BWT1|THIM_MOUSE	3-ketoacyl-CoA thiolase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Acaa2 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	39.0	null	92-UNIMOD:4,103-UNIMOD:4,107-UNIMOD:4,116-UNIMOD:4,128-UNIMOD:4,287-UNIMOD:4	0.51	39.0	16	11	6
PRT	sp|P63017|HSP7C_MOUSE	Heat shock cognate 71 kDa protein OS=Mus musculus (Mouse) OX=10090 GN=Hspa8 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	38.0	null	17-UNIMOD:4,574-UNIMOD:385,574-UNIMOD:4	0.26	38.0	25	12	6
PRT	sp|P00329|ADH1_MOUSE	Alcohol dehydrogenase 1 OS=Mus musculus (Mouse) OX=10090 GN=Adh1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	38.0	null	171-UNIMOD:4,175-UNIMOD:4,241-UNIMOD:4,83-UNIMOD:4,98-UNIMOD:4,101-UNIMOD:4,196-UNIMOD:4,212-UNIMOD:4,112-UNIMOD:4,137-UNIMOD:28	0.42	38.0	13	8	4
PRT	sp|P63101|1433Z_MOUSE	14-3-3 protein zeta/delta OS=Mus musculus (Mouse) OX=10090 GN=Ywhaz PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	38.0	null	94-UNIMOD:4,1-UNIMOD:1,25-UNIMOD:4	0.46	38.0	15	10	6
PRT	sp|P70296|PEBP1_MOUSE	Phosphatidylethanolamine-binding protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Pebp1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	38.0	null	2-UNIMOD:1,13-UNIMOD:4,133-UNIMOD:4,168-UNIMOD:4	0.80	38.0	14	9	5
PRT	sp|P00920|CAH2_MOUSE	Carbonic anhydrase 2 OS=Mus musculus (Mouse) OX=10090 GN=Ca2 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	37.0	null	28-UNIMOD:28	0.35	37.0	7	4	2
PRT	sp|Q9Z2I8|SUCB2_MOUSE	Succinate--CoA ligase [GDP-forming] subunit beta, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Suclg2 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	37.0	null	256-UNIMOD:4,208-UNIMOD:35,277-UNIMOD:35	0.31	37.0	22	10	2
PRT	sp|P05202|AATM_MOUSE	Aspartate aminotransferase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Got2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	37.0	null	187-UNIMOD:4,272-UNIMOD:4,274-UNIMOD:4,295-UNIMOD:4,212-UNIMOD:4	0.42	37.0	26	12	4
PRT	sp|Q9R0P3|ESTD_MOUSE	S-formylglutathione hydrolase OS=Mus musculus (Mouse) OX=10090 GN=Esd PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	37.0	null	45-UNIMOD:385,45-UNIMOD:4,56-UNIMOD:4,206-UNIMOD:4,176-UNIMOD:4,181-UNIMOD:4,158-UNIMOD:4	0.45	37.0	14	7	4
PRT	sp|P08228|SODC_MOUSE	Superoxide dismutase [Cu-Zn] OS=Mus musculus (Mouse) OX=10090 GN=Sod1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	37.0	null	58-UNIMOD:4,147-UNIMOD:4	0.61	37.0	12	6	3
PRT	sp|P47738|ALDH2_MOUSE	Aldehyde dehydrogenase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Aldh2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	37.0	null	68-UNIMOD:4,210-UNIMOD:35	0.34	37.0	23	11	3
PRT	sp|P16858|G3P_MOUSE	Glyceraldehyde-3-phosphate dehydrogenase OS=Mus musculus (Mouse) OX=10090 GN=Gapdh PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	37.0	null	245-UNIMOD:4	0.05	37.0	5	2	1
PRT	sp|Q9D964|GATM_MOUSE	Glycine amidinotransferase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Gatm PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	37.0	null	407-UNIMOD:4,410-UNIMOD:4,64-UNIMOD:4,252-UNIMOD:4,87-UNIMOD:4,131-UNIMOD:4,281-UNIMOD:35	0.49	37.0	24	13	6
PRT	sp|P97328|KHK_MOUSE	Ketohexokinase OS=Mus musculus (Mouse) OX=10090 GN=Khk PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	37.0	null	47-UNIMOD:4,223-UNIMOD:4,57-UNIMOD:4	0.30	37.0	9	5	1
PRT	tr|Q80X68|Q80X68_MOUSE	Citrate synthase OS=Mus musculus (Mouse) OX=10090 GN=Csl PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	37.0	null		0.09	37.0	3	2	1
PRT	sp|Q9EQ20|MMSA_MOUSE	Methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Aldh6a1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	37.0	null	249-UNIMOD:4,317-UNIMOD:385,317-UNIMOD:4,149-UNIMOD:4,413-UNIMOD:4,79-UNIMOD:35,86-UNIMOD:4	0.57	37.0	32	19	9
PRT	sp|P07758|A1AT1_MOUSE	Alpha-1-antitrypsin 1-1 OS=Mus musculus (Mouse) OX=10090 GN=Serpina1a PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	37.0	null		0.38	37.0	18	9	2
PRT	sp|P14206|RSSA_MOUSE	40S ribosomal protein SA OS=Mus musculus (Mouse) OX=10090 GN=Rpsa PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	37.0	null	148-UNIMOD:4,163-UNIMOD:4	0.24	37.0	7	4	1
PRT	sp|P16125|LDHB_MOUSE	L-lactate dehydrogenase B chain OS=Mus musculus (Mouse) OX=10090 GN=Ldhb PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	37.0	null	36-UNIMOD:4,294-UNIMOD:4,132-UNIMOD:4,234-UNIMOD:35	0.45	37.0	26	11	3
PRT	sp|Q91V92|ACLY_MOUSE	ATP-citrate synthase OS=Mus musculus (Mouse) OX=10090 GN=Acly PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	37.0	null		0.04	37.0	4	3	2
PRT	sp|P35505|FAAA_MOUSE	Fumarylacetoacetase OS=Mus musculus (Mouse) OX=10090 GN=Fah PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	37.0	null	396-UNIMOD:4	0.25	37.0	13	6	1
PRT	sp|P62962|PROF1_MOUSE	Profilin-1 OS=Mus musculus (Mouse) OX=10090 GN=Pfn1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	37.0	null	2-UNIMOD:1,17-UNIMOD:4,128-UNIMOD:385,128-UNIMOD:4	0.88	37.0	14	8	4
PRT	sp|Q68FD5|CLH1_MOUSE	Clathrin heavy chain 1 OS=Mus musculus (Mouse) OX=10090 GN=Cltc PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	36.0	null	491-UNIMOD:4,459-UNIMOD:4,151-UNIMOD:4,824-UNIMOD:4,1102-UNIMOD:4,996-UNIMOD:35	0.31	36.0	51	36	21
PRT	sp|Q3TNA1|XYLB_MOUSE	Xylulose kinase OS=Mus musculus (Mouse) OX=10090 GN=Xylb PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	36.0	null	248-UNIMOD:4,252-UNIMOD:4,24-UNIMOD:4,25-UNIMOD:4	0.23	36.0	11	9	8
PRT	sp|P56480|ATPB_MOUSE	ATP synthase subunit beta, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Atp5f1b PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	36.0	null		0.43	36.0	22	15	9
PRT	sp|Q9CQN1|TRAP1_MOUSE	Heat shock protein 75 kDa, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Trap1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	36.0	null	503-UNIMOD:4	0.10	36.0	8	5	3
PRT	sp|Q9QXD6|F16P1_MOUSE	Fructose-1,6-bisphosphatase 1 OS=Mus musculus (Mouse) OX=10090 GN=Fbp1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	36.0	null	282-UNIMOD:4,39-UNIMOD:4,2-UNIMOD:1	0.51	36.0	23	11	2
PRT	sp|P28474|ADHX_MOUSE	Alcohol dehydrogenase class-3 OS=Mus musculus (Mouse) OX=10090 GN=Adh5 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	36.0	null	240-UNIMOD:4,170-UNIMOD:4,174-UNIMOD:4,97-UNIMOD:4,100-UNIMOD:4	0.23	36.0	11	6	2
PRT	sp|Q8CG76|ARK72_MOUSE	Aflatoxin B1 aldehyde reductase member 2 OS=Mus musculus (Mouse) OX=10090 GN=Akr7a2 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	36.0	null	164-UNIMOD:4,222-UNIMOD:4,214-UNIMOD:28	0.30	36.0	13	7	2
PRT	sp|P68372|TBB4B_MOUSE	Tubulin beta-4B chain OS=Mus musculus (Mouse) OX=10090 GN=Tubb4b PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	36.0	null	239-UNIMOD:4,354-UNIMOD:4,73-UNIMOD:35,164-UNIMOD:35	0.37	36.0	23	10	2
PRT	sp|Q9D2G2|ODO2_MOUSE	Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Dlst PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	36.0	null		0.19	36.0	11	6	2
PRT	sp|P17742|PPIA_MOUSE	Peptidyl-prolyl cis-trans isomerase A OS=Mus musculus (Mouse) OX=10090 GN=Ppia PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	36.0	null	62-UNIMOD:4,115-UNIMOD:4,2-UNIMOD:1,100-UNIMOD:35,161-UNIMOD:4,142-UNIMOD:35	0.70	36.0	25	9	2
PRT	sp|P50247|SAHH_MOUSE	Adenosylhomocysteinase OS=Mus musculus (Mouse) OX=10090 GN=Ahcy PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1000663, ProteinPilot, ]	36.0	null	79-UNIMOD:4,195-UNIMOD:4	0.30	36.0	16	10	6
PRT	sp|Q8BML9|SYQ_MOUSE	Glutamine--tRNA ligase OS=Mus musculus (Mouse) OX=10090 GN=Qars1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	null	2-UNIMOD:1	0.02	36.0	1	1	1
PRT	sp|P10639|THIO_MOUSE	Thioredoxin OS=Mus musculus (Mouse) OX=10090 GN=Txn PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	35.0	null	46-UNIMOD:4	0.34	35.0	7	3	0
PRT	sp|Q9D0K2|SCOT1_MOUSE	Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Oxct1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	35.0	null	125-UNIMOD:28,235-UNIMOD:4,67-UNIMOD:4	0.33	35.0	17	9	3
PRT	sp|Q9DBF1|AL7A1_MOUSE	Alpha-aminoadipic semialdehyde dehydrogenase OS=Mus musculus (Mouse) OX=10090 GN=Aldh7a1 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	35.0	null	70-UNIMOD:4,522-UNIMOD:4	0.28	35.0	17	9	4
PRT	sp|Q64516|GLPK_MOUSE	Glycerol kinase OS=Mus musculus (Mouse) OX=10090 GN=Gk PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	35.0	null	421-UNIMOD:4,387-UNIMOD:4,67-UNIMOD:4,220-UNIMOD:4	0.28	35.0	20	12	7
PRT	sp|Q9DCY0|KEG1_MOUSE	Glycine N-acyltransferase-like protein Keg1 OS=Mus musculus (Mouse) OX=10090 GN=Keg1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	35.0	null	85-UNIMOD:4,1-UNIMOD:1,3-UNIMOD:4,1-UNIMOD:35,129-UNIMOD:28,130-UNIMOD:4,136-UNIMOD:4	0.43	35.0	20	9	1
PRT	sp|P07759|SPA3K_MOUSE	Serine protease inhibitor A3K OS=Mus musculus (Mouse) OX=10090 GN=Serpina3k PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	35.0	null	260-UNIMOD:4	0.25	35.0	8	6	4
PRT	sp|P09411|PGK1_MOUSE	Phosphoglycerate kinase 1 OS=Mus musculus (Mouse) OX=10090 GN=Pgk1 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	35.0	null	99-UNIMOD:4,108-UNIMOD:4,316-UNIMOD:4	0.36	35.0	17	9	3
PRT	sp|Q07417|ACADS_MOUSE	Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Acads PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	35.0	null	289-UNIMOD:4,246-UNIMOD:4	0.37	35.0	18	11	5
PRT	sp|P06151|LDHA_MOUSE	L-lactate dehydrogenase A chain OS=Mus musculus (Mouse) OX=10090 GN=Ldha PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	35.0	null	233-UNIMOD:28	0.30	35.0	16	8	3
PRT	sp|P38060|HMGCL_MOUSE	Hydroxymethylglutaryl-CoA lyase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Hmgcl PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	35.0	null	307-UNIMOD:4,141-UNIMOD:4	0.24	35.0	7	6	5
PRT	sp|O88587|COMT_MOUSE	Catechol O-methyltransferase OS=Mus musculus (Mouse) OX=10090 GN=Comt PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	35.0	null		0.25	35.0	4	3	2
PRT	sp|P63260|ACTG_MOUSE	Actin, cytoplasmic 2 OS=Mus musculus (Mouse) OX=10090 GN=Actg1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	null	2-UNIMOD:1,17-UNIMOD:4	0.05	35.0	2	1	0
PRT	sp|P56399|UBP5_MOUSE	Ubiquitin carboxyl-terminal hydrolase 5 OS=Mus musculus (Mouse) OX=10090 GN=Usp5 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	35.0	null	2-UNIMOD:1	0.08	35.0	4	4	4
PRT	sp|P17751|TPIS_MOUSE	Triosephosphate isomerase OS=Mus musculus (Mouse) OX=10090 GN=Tpi1 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	34.0	null	268-UNIMOD:4,177-UNIMOD:4,71-UNIMOD:4,77-UNIMOD:4,92-UNIMOD:4,71-UNIMOD:385	0.46	34.0	25	8	0
PRT	sp|P35486|ODPA_MOUSE	Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Pdha1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34.0	null	218-UNIMOD:4,222-UNIMOD:4,91-UNIMOD:4,94-UNIMOD:4,100-UNIMOD:4,101-UNIMOD:4,261-UNIMOD:4	0.24	34.0	15	6	1
PRT	sp|Q05920|PYC_MOUSE	Pyruvate carboxylase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Pc PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34.0	null	752-UNIMOD:4,131-UNIMOD:4,850-UNIMOD:4,622-UNIMOD:4	0.32	34.0	41	24	10
PRT	sp|Q9WUM5|SUCA_MOUSE	Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Suclg1 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34.0	null	172-UNIMOD:4,181-UNIMOD:4	0.27	34.0	16	6	2
PRT	sp|Q64105|SPRE_MOUSE	Sepiapterin reductase OS=Mus musculus (Mouse) OX=10090 GN=Spr PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34.0	null		0.35	34.0	11	6	1
PRT	sp|Q9DBJ1|PGAM1_MOUSE	Phosphoglycerate mutase 1 OS=Mus musculus (Mouse) OX=10090 GN=Pgam1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34.0	null	153-UNIMOD:4	0.29	34.0	6	4	2
PRT	sp|Q8VCR7|ABHEB_MOUSE	Protein ABHD14B OS=Mus musculus (Mouse) OX=10090 GN=Abhd14b PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34.0	null	138-UNIMOD:4	0.44	34.0	13	7	1
PRT	sp|P05213|TBA1B_MOUSE	Tubulin alpha-1B chain OS=Mus musculus (Mouse) OX=10090 GN=Tuba1b PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34.0	null	295-UNIMOD:4,347-UNIMOD:4,315-UNIMOD:4,316-UNIMOD:4	0.39	34.0	28	13	3
PRT	sp|Q7TNG8|LDHD_MOUSE	Probable D-lactate dehydrogenase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Ldhd PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	34.0	null	369-UNIMOD:4,439-UNIMOD:4,287-UNIMOD:4,63-UNIMOD:4,63-UNIMOD:385,295-UNIMOD:4	0.37	34.0	20	12	6
PRT	sp|P97823|LYPA1_MOUSE	Acyl-protein thioesterase 1 OS=Mus musculus (Mouse) OX=10090 GN=Lypla1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34.0	null	144-UNIMOD:4,169-UNIMOD:4,173-UNIMOD:4	0.28	34.0	5	3	2
PRT	sp|P56565|S10A1_MOUSE	Protein S100-A1 OS=Mus musculus (Mouse) OX=10090 GN=S100a1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34.0	null		0.17	34.0	1	1	1
PRT	sp|P97816|S100G_MOUSE	Protein S100-G OS=Mus musculus (Mouse) OX=10090 GN=S100g PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34.0	null		0.51	34.0	9	3	0
PRT	sp|P28271|ACOC_MOUSE	Cytoplasmic aconitate hydratase OS=Mus musculus (Mouse) OX=10090 GN=Aco1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34.0	null	50-UNIMOD:4	0.23	34.0	16	12	8
PRT	tr|G3UXX3|G3UXX3_MOUSE	Isoform of Q64105, Sepiapterin reductase OS=Mus musculus (Mouse) OX=10090 GN=Spr PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	null	1-UNIMOD:1,8-UNIMOD:4,11-UNIMOD:4	0.09	34.0	1	1	1
PRT	sp|P18760|COF1_MOUSE	Cofilin-1 OS=Mus musculus (Mouse) OX=10090 GN=Cfl1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	34.0	null	2-UNIMOD:1,39-UNIMOD:4	0.60	34.0	13	7	3
PRT	sp|Q99MZ7|PECR_MOUSE	Peroxisomal trans-2-enoyl-CoA reductase OS=Mus musculus (Mouse) OX=10090 GN=Pecr PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33.0	null	43-UNIMOD:4,79-UNIMOD:4	0.45	33.0	15	8	1
PRT	sp|P45952|ACADM_MOUSE	Medium-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Acadm PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	33.0	null	31-UNIMOD:28	0.37	33.0	21	11	4
PRT	sp|P09041|PGK2_MOUSE	Phosphoglycerate kinase 2 OS=Mus musculus (Mouse) OX=10090 GN=Pgk2 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33.0	null		0.10	33.0	11	4	1
PRT	sp|P11499|HS90B_MOUSE	Heat shock protein HSP 90-beta OS=Mus musculus (Mouse) OX=10090 GN=Hsp90ab1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	33.0	null	412-UNIMOD:385,412-UNIMOD:4,366-UNIMOD:4	0.18	33.0	20	9	3
PRT	sp|Q99PT1|GDIR1_MOUSE	Rho GDP-dissociation inhibitor 1 OS=Mus musculus (Mouse) OX=10090 GN=Arhgdia PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33.0	null	79-UNIMOD:4	0.28	33.0	5	3	1
PRT	sp|P16332|MUTA_MOUSE	Methylmalonyl-CoA mutase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Mmut PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33.0	null	349-UNIMOD:4	0.17	33.0	8	7	6
PRT	sp|Q91XE0|GLYAT_MOUSE	Glycine N-acyltransferase OS=Mus musculus (Mouse) OX=10090 GN=Glyat PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	33.0	null		0.28	33.0	15	7	2
PRT	sp|Q61171|PRDX2_MOUSE	Peroxiredoxin-2 OS=Mus musculus (Mouse) OX=10090 GN=Prdx2 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33.0	null		0.29	33.0	8	5	2
PRT	sp|P16627|HS71L_MOUSE	Heat shock 70 kDa protein 1-like OS=Mus musculus (Mouse) OX=10090 GN=Hspa1l PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33.0	null		0.05	33.0	6	2	0
PRT	sp|P52480|KPYM_MOUSE	Pyruvate kinase PKM OS=Mus musculus (Mouse) OX=10090 GN=Pkm PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	33.0	null	358-UNIMOD:4,31-UNIMOD:4,152-UNIMOD:385,152-UNIMOD:4,474-UNIMOD:4	0.38	33.0	22	13	7
PRT	sp|Q9Z0S1|BPNT1_MOUSE	3'(2'),5'-bisphosphate nucleotidase 1 OS=Mus musculus (Mouse) OX=10090 GN=Bpnt1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	33.0	null	206-UNIMOD:4,249-UNIMOD:4,28-UNIMOD:4,28-UNIMOD:385,59-UNIMOD:4,2-UNIMOD:1	0.36	33.0	17	8	2
PRT	sp|Q9WTP6|KAD2_MOUSE	Adenylate kinase 2, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Ak2 PE=1 SV=5	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	33.0	null	208-UNIMOD:4	0.35	33.0	6	5	4
PRT	sp|Q91Z53|GRHPR_MOUSE	Glyoxylate reductase/hydroxypyruvate reductase OS=Mus musculus (Mouse) OX=10090 GN=Grhpr PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33.0	null	57-UNIMOD:4,288-UNIMOD:4	0.28	33.0	10	6	2
PRT	sp|P32020|NLTP_MOUSE	Non-specific lipid-transfer protein OS=Mus musculus (Mouse) OX=10090 GN=Scp2 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33.0	null	495-UNIMOD:4	0.10	33.0	7	4	1
PRT	sp|P50516|VATA_MOUSE	V-type proton ATPase catalytic subunit A OS=Mus musculus (Mouse) OX=10090 GN=Atp6v1a PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33.0	null	240-UNIMOD:4,254-UNIMOD:4,277-UNIMOD:4	0.26	33.0	14	10	6
PRT	sp|Q9DB29|IAH1_MOUSE	Isoamyl acetate-hydrolyzing esterase 1 homolog OS=Mus musculus (Mouse) OX=10090 GN=Iah1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	33.0	null	173-UNIMOD:4,100-UNIMOD:28	0.17	33.0	5	3	2
PRT	sp|Q9CPY7|AMPL_MOUSE	Cytosol aminopeptidase OS=Mus musculus (Mouse) OX=10090 GN=Lap3 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33.0	null	335-UNIMOD:4,313-UNIMOD:4,445-UNIMOD:4	0.37	33.0	22	14	7
PRT	sp|Q8BLF1|NCEH1_MOUSE	Neutral cholesterol ester hydrolase 1 OS=Mus musculus (Mouse) OX=10090 GN=Nceh1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33.0	null		0.07	33.0	1	1	1
PRT	sp|D3Z7P3|GLSK_MOUSE	Glutaminase kidney isoform, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Gls PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	33.0	null	208-UNIMOD:385,208-UNIMOD:4	0.06	33.0	3	3	3
PRT	sp|Q9CQ92|FIS1_MOUSE	Mitochondrial fission 1 protein OS=Mus musculus (Mouse) OX=10090 GN=Fis1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	null	1-UNIMOD:1	0.11	33.0	1	1	1
PRT	sp|Q60866|PTER_MOUSE	Phosphotriesterase-related protein OS=Mus musculus (Mouse) OX=10090 GN=Pter PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	196-UNIMOD:4,164-UNIMOD:385,164-UNIMOD:4,172-UNIMOD:4	0.42	32.0	13	10	7
PRT	sp|P26443|DHE3_MOUSE	Glutamate dehydrogenase 1, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Glud1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	376-UNIMOD:4,172-UNIMOD:4,254-UNIMOD:4	0.41	32.0	27	16	7
PRT	sp|P99024|TBB5_MOUSE	Tubulin beta-5 chain OS=Mus musculus (Mouse) OX=10090 GN=Tubb5 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32.0	null	12-UNIMOD:4	0.07	32.0	6	3	0
PRT	sp|P58252|EF2_MOUSE	Elongation factor 2 OS=Mus musculus (Mouse) OX=10090 GN=Eef2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	591-UNIMOD:4,466-UNIMOD:4,369-UNIMOD:4,728-UNIMOD:4,651-UNIMOD:4,728-UNIMOD:385,290-UNIMOD:4	0.26	32.0	26	14	8
PRT	sp|P07901|HS90A_MOUSE	Heat shock protein HSP 90-alpha OS=Mus musculus (Mouse) OX=10090 GN=Hsp90aa1 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	421-UNIMOD:385,421-UNIMOD:4,530-UNIMOD:4	0.34	32.0	38	19	7
PRT	sp|Q8JZV9|BDH2_MOUSE	3-hydroxybutyrate dehydrogenase type 2 OS=Mus musculus (Mouse) OX=10090 GN=Bdh2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32.0	null	93-UNIMOD:4	0.31	32.0	6	5	4
PRT	sp|O88990|ACTN3_MOUSE	Alpha-actinin-3 OS=Mus musculus (Mouse) OX=10090 GN=Actn3 PE=2 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32.0	null	167-UNIMOD:4,345-UNIMOD:4	0.06	32.0	5	4	2
PRT	sp|Q9CQ62|DECR_MOUSE	2,4-dienoyl-CoA reductase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Decr1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32.0	null	86-UNIMOD:4	0.34	32.0	11	8	6
PRT	sp|O08997|ATOX1_MOUSE	Copper transport protein ATOX1 OS=Mus musculus (Mouse) OX=10090 GN=Atox1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32.0	null	41-UNIMOD:4	0.49	32.0	4	3	2
PRT	sp|Q8R0Y6|AL1L1_MOUSE	Cytosolic 10-formyltetrahydrofolate dehydrogenase OS=Mus musculus (Mouse) OX=10090 GN=Aldh1l1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32.0	null	404-UNIMOD:4,238-UNIMOD:4,17-UNIMOD:4,152-UNIMOD:4	0.36	32.0	30	20	12
PRT	sp|P62259|1433E_MOUSE	14-3-3 protein epsilon OS=Mus musculus (Mouse) OX=10090 GN=Ywhae PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	97-UNIMOD:4,98-UNIMOD:4,1-UNIMOD:1	0.40	32.0	17	8	3
PRT	sp|P31428|DPEP1_MOUSE	Dipeptidase 1 OS=Mus musculus (Mouse) OX=10090 GN=Dpep1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32.0	null		0.05	32.0	1	1	1
PRT	sp|Q91XE4|ACY3_MOUSE	N-acyl-aromatic-L-amino acid amidohydrolase (carboxylate-forming) OS=Mus musculus (Mouse) OX=10090 GN=Acy3 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32.0	null	73-UNIMOD:4,61-UNIMOD:4,62-UNIMOD:4	0.36	32.0	8	5	3
PRT	sp|Q01853|TERA_MOUSE	Transitional endoplasmic reticulum ATPase OS=Mus musculus (Mouse) OX=10090 GN=Vcp PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	105-UNIMOD:4,535-UNIMOD:4,2-UNIMOD:1,568-UNIMOD:28,572-UNIMOD:4,691-UNIMOD:4,415-UNIMOD:4,522-UNIMOD:4,69-UNIMOD:4,77-UNIMOD:4	0.42	32.0	32	21	10
PRT	sp|Q99MN9|PCCB_MOUSE	Propionyl-CoA carboxylase beta chain, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Pccb PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32.0	null	271-UNIMOD:4,518-UNIMOD:4,519-UNIMOD:4,367-UNIMOD:4	0.28	32.0	16	10	4
PRT	sp|Q9CQV8|1433B_MOUSE	14-3-3 protein beta/alpha OS=Mus musculus (Mouse) OX=10090 GN=Ywhab PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32.0	null	96-UNIMOD:4	0.21	32.0	4	3	2
PRT	sp|P21614|VTDB_MOUSE	Vitamin D-binding protein OS=Mus musculus (Mouse) OX=10090 GN=Gc PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32.0	null		0.08	32.0	2	2	2
PRT	sp|P80317|TCPZ_MOUSE	T-complex protein 1 subunit zeta OS=Mus musculus (Mouse) OX=10090 GN=Cct6a PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32.0	null	406-UNIMOD:4	0.10	32.0	3	3	3
PRT	sp|P85094|ISC2A_MOUSE	Isochorismatase domain-containing protein 2A OS=Mus musculus (Mouse) OX=10090 GN=Isoc2a PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	21-UNIMOD:4,84-UNIMOD:4,136-UNIMOD:4,153-UNIMOD:28,206-UNIMOD:4	0.57	32.0	10	6	2
PRT	sp|Q8QZT1|THIL_MOUSE	Acetyl-CoA acetyltransferase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Acat1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	271-UNIMOD:27,116-UNIMOD:4,206-UNIMOD:28,193-UNIMOD:4	0.36	32.0	20	9	4
PRT	sp|P09671|SODM_MOUSE	Superoxide dismutase [Mn], mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Sod2 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.22	31.0	6	3	1
PRT	sp|P70670|NACAM_MOUSE	Nascent polypeptide-associated complex subunit alpha, muscle-specific form OS=Mus musculus (Mouse) OX=10090 GN=Naca PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.03	31.0	5	4	3
PRT	sp|P54071|IDHP_MOUSE	Isocitrate dehydrogenase [NADP], mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Idh2 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	402-UNIMOD:4,154-UNIMOD:4,418-UNIMOD:4,113-UNIMOD:385,113-UNIMOD:4	0.36	31.0	22	14	7
PRT	sp|Q62468|VILI_MOUSE	Villin-1 OS=Mus musculus (Mouse) OX=10090 GN=Vil1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31.0	null	553-UNIMOD:4,554-UNIMOD:4,558-UNIMOD:4	0.23	31.0	25	14	4
PRT	sp|P15105|GLNA_MOUSE	Glutamine synthetase OS=Mus musculus (Mouse) OX=10090 GN=Glul PE=1 SV=6	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31.0	null	346-UNIMOD:4,49-UNIMOD:4,209-UNIMOD:4	0.19	31.0	7	4	2
PRT	sp|P40142|TKT_MOUSE	Transketolase OS=Mus musculus (Mouse) OX=10090 GN=Tkt PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	386-UNIMOD:4,206-UNIMOD:4,225-UNIMOD:4,115-UNIMOD:28,133-UNIMOD:4	0.30	31.0	16	12	9
PRT	sp|Q9Z2V4|PCKGC_MOUSE	Phosphoenolpyruvate carboxykinase, cytosolic [GTP] OS=Mus musculus (Mouse) OX=10090 GN=Pck1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	75-UNIMOD:4,307-UNIMOD:4,176-UNIMOD:35,192-UNIMOD:385,192-UNIMOD:4,198-UNIMOD:4	0.23	31.0	13	9	5
PRT	sp|P13707|GPDA_MOUSE	Glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic OS=Mus musculus (Mouse) OX=10090 GN=Gpd1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31.0	null	7-UNIMOD:4,329-UNIMOD:4	0.25	31.0	11	8	5
PRT	sp|P62814|VATB2_MOUSE	V-type proton ATPase subunit B, brain isoform OS=Mus musculus (Mouse) OX=10090 GN=Atp6v1b2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	207-UNIMOD:4,387-UNIMOD:28,112-UNIMOD:4,425-UNIMOD:4	0.28	31.0	15	9	6
PRT	sp|Q921I1|TRFE_MOUSE	Serotransferrin OS=Mus musculus (Mouse) OX=10090 GN=Tf PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	506-UNIMOD:4,633-UNIMOD:4,638-UNIMOD:4,156-UNIMOD:4,260-UNIMOD:4,350-UNIMOD:4,386-UNIMOD:4,395-UNIMOD:4,583-UNIMOD:4,246-UNIMOD:4,363-UNIMOD:4,190-UNIMOD:4,193-UNIMOD:4,196-UNIMOD:4,198-UNIMOD:4,576-UNIMOD:28	0.39	31.0	28	19	11
PRT	sp|Q80W22|THNS2_MOUSE	Threonine synthase-like 2 OS=Mus musculus (Mouse) OX=10090 GN=Thnsl2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31.0	null	280-UNIMOD:4,119-UNIMOD:4,303-UNIMOD:4	0.20	31.0	8	6	4
PRT	sp|P04117|FABP4_MOUSE	Fatty acid-binding protein, adipocyte OS=Mus musculus (Mouse) OX=10090 GN=Fabp4 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.40	31.0	9	5	1
PRT	sp|P38647|GRP75_MOUSE	Stress-70 protein, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Hspa9 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31.0	null	608-UNIMOD:4	0.31	31.0	33	17	9
PRT	sp|Q8VC30|TKFC_MOUSE	Triokinase/FMN cyclase OS=Mus musculus (Mouse) OX=10090 GN=Tkfc PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31.0	null	155-UNIMOD:4	0.27	31.0	16	11	6
PRT	sp|P11352|GPX1_MOUSE	Glutathione peroxidase 1 OS=Mus musculus (Mouse) OX=10090 GN=Gpx1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31.0	null	154-UNIMOD:4	0.33	31.0	11	5	1
PRT	sp|P61979|HNRPK_MOUSE	Heterogeneous nuclear ribonucleoprotein K OS=Mus musculus (Mouse) OX=10090 GN=Hnrnpk PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31.0	null	145-UNIMOD:4	0.22	31.0	10	7	4
PRT	sp|Q3TLP5|ECHD2_MOUSE	Enoyl-CoA hydratase domain-containing protein 2, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Echdc2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.06	31.0	1	1	1
PRT	sp|P57780|ACTN4_MOUSE	Alpha-actinin-4 OS=Mus musculus (Mouse) OX=10090 GN=Actn4 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	352-UNIMOD:385,352-UNIMOD:4,500-UNIMOD:4,439-UNIMOD:28	0.32	31.0	39	21	6
PRT	sp|Q91WU0|CES1F_MOUSE	Carboxylesterase 1F OS=Mus musculus (Mouse) OX=10090 GN=Ces1f PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31.0	null	273-UNIMOD:4	0.15	31.0	6	5	4
PRT	sp|Q99L13|3HIDH_MOUSE	3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Hibadh PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31.0	null	74-UNIMOD:4,149-UNIMOD:35	0.36	31.0	18	7	2
PRT	sp|P34914|HYES_MOUSE	Bifunctional epoxide hydrolase 2 OS=Mus musculus (Mouse) OX=10090 GN=Ephx2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31.0	null	312-UNIMOD:4,78-UNIMOD:4,230-UNIMOD:4,521-UNIMOD:4	0.45	31.0	18	14	10
PRT	sp|P40124|CAP1_MOUSE	Adenylyl cyclase-associated protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Cap1 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31.0	null	415-UNIMOD:4	0.11	31.0	3	3	3
PRT	sp|Q9WVA4|TAGL2_MOUSE	Transgelin-2 OS=Mus musculus (Mouse) OX=10090 GN=Tagln2 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	31.0	null	89-UNIMOD:28	0.38	31.0	8	5	2
PRT	sp|P31786|ACBP_MOUSE	Acyl-CoA-binding protein OS=Mus musculus (Mouse) OX=10090 GN=Dbi PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	31.0	null	34-UNIMOD:28	0.22	31.0	5	1	0
PRT	sp|P26039|TLN1_MOUSE	Talin-1 OS=Mus musculus (Mouse) OX=10090 GN=Tln1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	2442-UNIMOD:4,2161-UNIMOD:4,1939-UNIMOD:4	0.10	31.0	19	18	17
PRT	sp|P62960|YBOX1_MOUSE	Y-box-binding protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Ybx1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30.0	null		0.15	30.0	4	3	2
PRT	sp|P15532|NDKA_MOUSE	Nucleoside diphosphate kinase A OS=Mus musculus (Mouse) OX=10090 GN=Nme1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30.0	null	90-UNIMOD:35	0.44	30.0	10	5	1
PRT	sp|Q9D6R2|IDH3A_MOUSE	Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Idh3a PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	30.0	null	331-UNIMOD:4,127-UNIMOD:4,351-UNIMOD:385,351-UNIMOD:4,359-UNIMOD:4	0.40	30.0	17	11	7
PRT	sp|O08709|PRDX6_MOUSE	Peroxiredoxin-6 OS=Mus musculus (Mouse) OX=10090 GN=Prdx6 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30.0	null	47-UNIMOD:4	0.53	30.0	15	10	5
PRT	sp|P52196|THTR_MOUSE	Thiosulfate sulfurtransferase OS=Mus musculus (Mouse) OX=10090 GN=Tst PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30.0	null		0.18	30.0	6	4	2
PRT	sp|P50544|ACADV_MOUSE	Very long-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Acadvl PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30.0	null		0.20	30.0	12	8	5
PRT	sp|O35488|S27A2_MOUSE	Very long-chain acyl-CoA synthetase OS=Mus musculus (Mouse) OX=10090 GN=Slc27a2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30.0	null	301-UNIMOD:4	0.22	30.0	16	10	5
PRT	sp|Q8R164|BPHL_MOUSE	Valacyclovir hydrolase OS=Mus musculus (Mouse) OX=10090 GN=Bphl PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	30.0	null	206-UNIMOD:4,132-UNIMOD:28,234-UNIMOD:4	0.43	30.0	18	9	4
PRT	sp|P06801|MAOX_MOUSE	NADP-dependent malic enzyme OS=Mus musculus (Mouse) OX=10090 GN=Me1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	30.0	null	36-UNIMOD:28,47-UNIMOD:4,264-UNIMOD:4,468-UNIMOD:4	0.26	30.0	16	7	2
PRT	sp|Q9D172|GAL3A_MOUSE	Glutamine amidotransferase-like class 1 domain-containing protein 3A, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Gatd3a PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30.0	null	174-UNIMOD:4,175-UNIMOD:4	0.35	30.0	9	4	0
PRT	sp|O55137|ACOT1_MOUSE	Acyl-coenzyme A thioesterase 1 OS=Mus musculus (Mouse) OX=10090 GN=Acot1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30.0	null	14-UNIMOD:4	0.16	30.0	5	4	3
PRT	sp|Q9R0P5|DEST_MOUSE	Destrin OS=Mus musculus (Mouse) OX=10090 GN=Dstn PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	30.0	null	2-UNIMOD:1,12-UNIMOD:4,147-UNIMOD:4	0.44	30.0	10	6	2
PRT	sp|Q9R0H0|ACOX1_MOUSE	Peroxisomal acyl-coenzyme A oxidase 1 OS=Mus musculus (Mouse) OX=10090 GN=Acox1 PE=1 SV=5	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30.0	null	392-UNIMOD:4,559-UNIMOD:4,531-UNIMOD:4,199-UNIMOD:4	0.47	30.0	34	21	11
PRT	sp|Q9EPL9|ACOX3_MOUSE	Peroxisomal acyl-coenzyme A oxidase 3 OS=Mus musculus (Mouse) OX=10090 GN=Acox3 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30.0	null		0.10	30.0	4	4	4
PRT	sp|P0DP26|CALM1_MOUSE	Calmodulin-1 OS=Mus musculus (Mouse) OX=10090 GN=Calm1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30.0	null		0.30	30.0	4	3	2
PRT	tr|Q9CR99|Q9CR99_MOUSE	RIKEN cDNA 4930544G11 gene OS=Mus musculus (Mouse) OX=10090 GN=4930544G11Rik PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30.0	null		0.13	30.0	1	1	1
PRT	sp|P62737|ACTA_MOUSE	Actin, aortic smooth muscle OS=Mus musculus (Mouse) OX=10090 GN=Acta2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30.0	null	84-UNIMOD:35	0.12	30.0	8	3	2
PRT	sp|P62141|PP1B_MOUSE	Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Mus musculus (Mouse) OX=10090 GN=Ppp1cb PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	null	98-UNIMOD:28,104-UNIMOD:4,2-UNIMOD:1	0.09	30.0	2	2	2
PRT	sp|P51855|GSHB_MOUSE	Glutathione synthetase OS=Mus musculus (Mouse) OX=10090 GN=Gss PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	30.0	null	142-UNIMOD:28,294-UNIMOD:4,2-UNIMOD:1,294-UNIMOD:385	0.15	30.0	7	5	3
PRT	sp|P29699|FETUA_MOUSE	Alpha-2-HS-glycoprotein OS=Mus musculus (Mouse) OX=10090 GN=Ahsg PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	30.0	null	104-UNIMOD:28,114-UNIMOD:4,208-UNIMOD:4	0.12	30.0	3	2	1
PRT	sp|P40936|INMT_MOUSE	Indolethylamine N-methyltransferase OS=Mus musculus (Mouse) OX=10090 GN=Inmt PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29.0	null	231-UNIMOD:4,116-UNIMOD:4	0.24	29.0	9	5	3
PRT	sp|Q9D051|ODPB_MOUSE	Pyruvate dehydrogenase E1 component subunit beta, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Pdhb PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29.0	null	263-UNIMOD:4,161-UNIMOD:4,169-UNIMOD:4	0.27	29.0	11	6	2
PRT	sp|Q8K1Z0|COQ9_MOUSE	Ubiquinone biosynthesis protein COQ9, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Coq9 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29.0	null		0.07	29.0	1	1	1
PRT	sp|P10126|EF1A1_MOUSE	Elongation factor 1-alpha 1 OS=Mus musculus (Mouse) OX=10090 GN=Eef1a1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	29.0	null	411-UNIMOD:4,234-UNIMOD:4	0.22	29.0	9	6	3
PRT	sp|Q9CQR4|ACO13_MOUSE	Acyl-coenzyme A thioesterase 13 OS=Mus musculus (Mouse) OX=10090 GN=Acot13 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	29.0	null	2-UNIMOD:1	0.24	29.0	6	3	1
PRT	sp|Q9DCD0|6PGD_MOUSE	6-phosphogluconate dehydrogenase, decarboxylating OS=Mus musculus (Mouse) OX=10090 GN=Pgd PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29.0	null	170-UNIMOD:4,171-UNIMOD:4	0.17	29.0	7	5	3
PRT	sp|P29341|PABP1_MOUSE	Polyadenylate-binding protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Pabpc1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29.0	null		0.07	29.0	3	3	3
PRT	sp|Q8BVI4|DHPR_MOUSE	Dihydropteridine reductase OS=Mus musculus (Mouse) OX=10090 GN=Qdpr PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29.0	null	82-UNIMOD:4	0.44	29.0	10	6	3
PRT	sp|P16546|SPTN1_MOUSE	Spectrin alpha chain, non-erythrocytic 1 OS=Mus musculus (Mouse) OX=10090 GN=Sptan1 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	29.0	null	1068-UNIMOD:28,1622-UNIMOD:4	0.12	29.0	26	23	20
PRT	sp|Q61133|GSTT2_MOUSE	Glutathione S-transferase theta-2 OS=Mus musculus (Mouse) OX=10090 GN=Gstt2 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29.0	null	50-UNIMOD:4	0.25	29.0	8	4	0
PRT	sp|Q9JIL4|NHRF3_MOUSE	Na(+)/H(+) exchange regulatory cofactor NHE-RF3 OS=Mus musculus (Mouse) OX=10090 GN=Pdzk1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	29.0	null	15-UNIMOD:28,136-UNIMOD:4	0.18	29.0	13	7	2
PRT	sp|Q99LB2|DHRS4_MOUSE	Dehydrogenase/reductase SDR family member 4 OS=Mus musculus (Mouse) OX=10090 GN=Dhrs4 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29.0	null	89-UNIMOD:4	0.22	29.0	5	4	3
PRT	sp|P42125|ECI1_MOUSE	Enoyl-CoA delta isomerase 1, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Eci1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29.0	null	61-UNIMOD:4	0.18	29.0	4	3	2
PRT	sp|Q61838|PZP_MOUSE	Pregnancy zone protein OS=Mus musculus (Mouse) OX=10090 GN=Pzp PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29.0	null	833-UNIMOD:4	0.09	29.0	13	10	7
PRT	sp|Q60597|ODO1_MOUSE	2-oxoglutarate dehydrogenase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Ogdh PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29.0	null	283-UNIMOD:4,566-UNIMOD:4,487-UNIMOD:4	0.22	29.0	20	14	8
PRT	sp|P11983|TCPA_MOUSE	T-complex protein 1 subunit alpha OS=Mus musculus (Mouse) OX=10090 GN=Tcp1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29.0	null	357-UNIMOD:4	0.19	29.0	9	8	7
PRT	sp|Q8K157|GALM_MOUSE	Aldose 1-epimerase OS=Mus musculus (Mouse) OX=10090 GN=Galm PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29.0	null		0.13	29.0	3	3	3
PRT	sp|Q9Z1N5|DX39B_MOUSE	Spliceosome RNA helicase Ddx39b OS=Mus musculus (Mouse) OX=10090 GN=Ddx39b PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	29.0	null	300-UNIMOD:385,300-UNIMOD:4,198-UNIMOD:4	0.11	29.0	4	3	2
PRT	sp|P63158|HMGB1_MOUSE	High mobility group protein B1 OS=Mus musculus (Mouse) OX=10090 GN=Hmgb1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	28.0	null	106-UNIMOD:4	0.15	28.0	3	2	1
PRT	sp|Q8BMF4|ODP2_MOUSE	Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Dlat PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28.0	null	290-UNIMOD:4,581-UNIMOD:4,163-UNIMOD:4	0.24	28.0	12	9	6
PRT	sp|P24270|CATA_MOUSE	Catalase OS=Mus musculus (Mouse) OX=10090 GN=Cat PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	28.0	null	232-UNIMOD:4,425-UNIMOD:4,377-UNIMOD:4	0.37	28.0	20	13	7
PRT	sp|P56395|CYB5_MOUSE	Cytochrome b5 OS=Mus musculus (Mouse) OX=10090 GN=Cyb5a PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28.0	null		0.16	28.0	2	1	0
PRT	sp|Q62433|NDRG1_MOUSE	Protein NDRG1 OS=Mus musculus (Mouse) OX=10090 GN=Ndrg1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28.0	null		0.13	28.0	5	3	1
PRT	sp|P35700|PRDX1_MOUSE	Peroxiredoxin-1 OS=Mus musculus (Mouse) OX=10090 GN=Prdx1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	28.0	null	71-UNIMOD:4,83-UNIMOD:4,141-UNIMOD:28,94-UNIMOD:28	0.52	28.0	23	10	3
PRT	sp|Q9CXN7|PBLD2_MOUSE	Phenazine biosynthesis-like domain-containing protein 2 OS=Mus musculus (Mouse) OX=10090 GN=Pbld2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28.0	null	24-UNIMOD:4	0.09	28.0	3	2	1
PRT	sp|P12658|CALB1_MOUSE	Calbindin OS=Mus musculus (Mouse) OX=10090 GN=Calb1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	28.0	null	35-UNIMOD:27	0.45	28.0	16	8	1
PRT	sp|Q03265|ATPA_MOUSE	ATP synthase subunit alpha, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Atp5f1a PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28.0	null	244-UNIMOD:4	0.27	28.0	18	10	4
PRT	sp|P56389|CDD_MOUSE	Cytidine deaminase OS=Mus musculus (Mouse) OX=10090 GN=Cda PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28.0	null	53-UNIMOD:4,59-UNIMOD:4,65-UNIMOD:4	0.23	28.0	4	2	0
PRT	sp|Q922D8|C1TC_MOUSE	C-1-tetrahydrofolate synthase, cytoplasmic OS=Mus musculus (Mouse) OX=10090 GN=Mthfd1 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	28.0	null	195-UNIMOD:4,863-UNIMOD:4,143-UNIMOD:4,147-UNIMOD:4,408-UNIMOD:4,785-UNIMOD:4	0.25	28.0	19	15	11
PRT	sp|Q9D6Y7|MSRA_MOUSE	Mitochondrial peptide methionine sulfoxide reductase OS=Mus musculus (Mouse) OX=10090 GN=Msra PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28.0	null		0.22	28.0	5	3	1
PRT	sp|O09173|HGD_MOUSE	Homogentisate 1,2-dioxygenase OS=Mus musculus (Mouse) OX=10090 GN=Hgd PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	28.0	null	120-UNIMOD:4,180-UNIMOD:4,416-UNIMOD:4,418-UNIMOD:4,146-UNIMOD:385,146-UNIMOD:4	0.36	28.0	21	10	5
PRT	sp|O35459|ECH1_MOUSE	Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Ech1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28.0	null	186-UNIMOD:4,170-UNIMOD:4,181-UNIMOD:4	0.17	28.0	3	3	3
PRT	sp|P61458|PHS_MOUSE	Pterin-4-alpha-carbinolamine dehydratase OS=Mus musculus (Mouse) OX=10090 GN=Pcbd1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28.0	null		0.31	28.0	3	2	1
PRT	sp|P68254|1433T_MOUSE	14-3-3 protein theta OS=Mus musculus (Mouse) OX=10090 GN=Ywhaq PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28.0	null	94-UNIMOD:4	0.27	28.0	5	4	3
PRT	sp|Q8BFR5|EFTU_MOUSE	Elongation factor Tu, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Tufm PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	28.0	null	170-UNIMOD:28,222-UNIMOD:4	0.21	28.0	7	6	5
PRT	sp|P80313|TCPH_MOUSE	T-complex protein 1 subunit eta OS=Mus musculus (Mouse) OX=10090 GN=Cct7 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28.0	null	511-UNIMOD:4	0.07	28.0	2	2	2
PRT	sp|P28825|MEP1A_MOUSE	Meprin A subunit alpha OS=Mus musculus (Mouse) OX=10090 GN=Mep1a PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28.0	null	342-UNIMOD:4	0.08	28.0	5	4	3
PRT	sp|Q9CQM5|TXD17_MOUSE	Thioredoxin domain-containing protein 17 OS=Mus musculus (Mouse) OX=10090 GN=Txndc17 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	28.0	null	2-UNIMOD:1,43-UNIMOD:4,46-UNIMOD:4	0.43	28.0	5	4	3
PRT	sp|P26350|PTMA_MOUSE	Prothymosin alpha OS=Mus musculus (Mouse) OX=10090 GN=Ptma PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.14	27.0	1	1	1
PRT	sp|P50431|GLYC_MOUSE	Serine hydroxymethyltransferase, cytosolic OS=Mus musculus (Mouse) OX=10090 GN=Shmt1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	27.0	null	374-UNIMOD:4,378-UNIMOD:4,62-UNIMOD:4,2-UNIMOD:1,329-UNIMOD:4	0.13	27.0	7	5	3
PRT	sp|O55234|PSB5_MOUSE	Proteasome subunit beta type-5 OS=Mus musculus (Mouse) OX=10090 GN=Psmb5 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.15	27.0	3	3	3
PRT	sp|Q9JHW2|NIT2_MOUSE	Omega-amidase NIT2 OS=Mus musculus (Mouse) OX=10090 GN=Nit2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27.0	null	170-UNIMOD:4,146-UNIMOD:4	0.44	27.0	11	8	5
PRT	sp|P19157|GSTP1_MOUSE	Glutathione S-transferase P 1 OS=Mus musculus (Mouse) OX=10090 GN=Gstp1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.25	27.0	7	5	3
PRT	sp|Q91X91|NADC_MOUSE	Nicotinate-nucleotide pyrophosphorylase [carboxylating] OS=Mus musculus (Mouse) OX=10090 GN=Qprt PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	27.0	null	202-UNIMOD:4,111-UNIMOD:385,111-UNIMOD:4	0.15	27.0	4	3	2
PRT	sp|Q9DC50|OCTC_MOUSE	Peroxisomal carnitine O-octanoyltransferase OS=Mus musculus (Mouse) OX=10090 GN=Crot PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	27.0	null	466-UNIMOD:4,228-UNIMOD:4	0.25	27.0	17	13	9
PRT	sp|P11930|NUD19_MOUSE	Nucleoside diphosphate-linked moiety X motif 19 OS=Mus musculus (Mouse) OX=10090 GN=Nudt19 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27.0	null	198-UNIMOD:4,199-UNIMOD:4,227-UNIMOD:4	0.43	27.0	15	10	7
PRT	sp|Q91VA0|ACSM1_MOUSE	Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Acsm1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27.0	null	102-UNIMOD:4	0.13	27.0	6	4	2
PRT	sp|Q3UNX5|ACSM3_MOUSE	Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Acsm3 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27.0	null	134-UNIMOD:4,109-UNIMOD:4,343-UNIMOD:4	0.23	27.0	17	11	5
PRT	sp|Q93092|TALDO_MOUSE	Transaldolase OS=Mus musculus (Mouse) OX=10090 GN=Taldo1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27.0	null	250-UNIMOD:4	0.08	27.0	4	2	1
PRT	sp|Q60605|MYL6_MOUSE	Myosin light polypeptide 6 OS=Mus musculus (Mouse) OX=10090 GN=Myl6 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.25	27.0	6	3	0
PRT	sp|O09174|AMACR_MOUSE	Alpha-methylacyl-CoA racemase OS=Mus musculus (Mouse) OX=10090 GN=Amacr PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.19	27.0	7	5	3
PRT	sp|P97494|GSH1_MOUSE	Glutamate--cysteine ligase catalytic subunit OS=Mus musculus (Mouse) OX=10090 GN=Gclc PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	27.0	null	142-UNIMOD:4	0.15	27.0	8	7	6
PRT	sp|P14211|CALR_MOUSE	Calreticulin OS=Mus musculus (Mouse) OX=10090 GN=Calr PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27.0	null	137-UNIMOD:4	0.13	27.0	6	4	2
PRT	sp|Q8BH00|AL8A1_MOUSE	2-aminomuconic semialdehyde dehydrogenase OS=Mus musculus (Mouse) OX=10090 GN=Aldh8a1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	27.0	null	271-UNIMOD:4,287-UNIMOD:4,289-UNIMOD:4,387-UNIMOD:385,387-UNIMOD:4,398-UNIMOD:4	0.39	27.0	15	11	8
PRT	sp|P68368|TBA4A_MOUSE	Tubulin alpha-4A chain OS=Mus musculus (Mouse) OX=10090 GN=Tuba4a PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	27.0	null	85-UNIMOD:28	0.11	27.0	7	3	0
PRT	sp|P05201|AATC_MOUSE	Aspartate aminotransferase, cytoplasmic OS=Mus musculus (Mouse) OX=10090 GN=Got1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	27.0	null		0.38	27.0	14	11	8
PRT	sp|P20108|PRDX3_MOUSE	Thioredoxin-dependent peroxide reductase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Prdx3 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27.0	null	230-UNIMOD:4	0.26	27.0	8	5	2
PRT	sp|Q9CQ60|6PGL_MOUSE	6-phosphogluconolactonase OS=Mus musculus (Mouse) OX=10090 GN=Pgls PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	27.0	null	2-UNIMOD:1,236-UNIMOD:4	0.60	27.0	9	8	7
PRT	sp|Q9EQH3|VPS35_MOUSE	Vacuolar protein sorting-associated protein 35 OS=Mus musculus (Mouse) OX=10090 GN=Vps35 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	27.0	null	240-UNIMOD:28,253-UNIMOD:4,653-UNIMOD:4	0.15	27.0	9	8	7
PRT	sp|Q9CPU0|LGUL_MOUSE	Lactoylglutathione lyase OS=Mus musculus (Mouse) OX=10090 GN=Glo1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27.0	null	139-UNIMOD:4	0.27	27.0	4	3	2
PRT	sp|P16015|CAH3_MOUSE	Carbonic anhydrase 3 OS=Mus musculus (Mouse) OX=10090 GN=Ca3 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	null	136-UNIMOD:28	0.05	27.0	1	1	1
PRT	sp|Q99KB8|GLO2_MOUSE	Hydroxyacylglutathione hydrolase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Hagh PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.05	26.0	1	1	1
PRT	sp|P61161|ARP2_MOUSE	Actin-related protein 2 OS=Mus musculus (Mouse) OX=10090 GN=Actr2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.10	26.0	4	3	2
PRT	sp|P51174|ACADL_MOUSE	Long-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Acadl PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	26.0	null	166-UNIMOD:385,166-UNIMOD:4,96-UNIMOD:28	0.31	26.0	19	10	4
PRT	sp|P09103|PDIA1_MOUSE	Protein disulfide-isomerase OS=Mus musculus (Mouse) OX=10090 GN=P4hb PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	26.0	null	173-UNIMOD:28,314-UNIMOD:4	0.27	26.0	9	8	7
PRT	sp|Q9D1A2|CNDP2_MOUSE	Cytosolic non-specific dipeptidase OS=Mus musculus (Mouse) OX=10090 GN=Cndp2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.22	26.0	11	7	3
PRT	sp|Q61316|HSP74_MOUSE	Heat shock 70 kDa protein 4 OS=Mus musculus (Mouse) OX=10090 GN=Hspa4 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	26.0	null	245-UNIMOD:4,780-UNIMOD:4	0.12	26.0	7	7	7
PRT	sp|P70404|IDHG1_MOUSE	Isocitrate dehydrogenase [NAD] subunit gamma 1, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Idh3g PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1000663, ProteinPilot, ]	26.0	null	235-UNIMOD:4,236-UNIMOD:4,333-UNIMOD:4,81-UNIMOD:4,148-UNIMOD:4	0.18	26.0	8	4	1
PRT	sp|P47963|RL13_MOUSE	60S ribosomal protein L13 OS=Mus musculus (Mouse) OX=10090 GN=Rpl13 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.07	26.0	1	1	1
PRT	tr|Q91VA7|Q91VA7_MOUSE	Isocitrate dehydrogenase [NAD] subunit, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Idh3b PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.29	26.0	10	8	6
PRT	sp|Q8VCA8|SCRN2_MOUSE	Secernin-2 OS=Mus musculus (Mouse) OX=10090 GN=Scrn2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26.0	null	59-UNIMOD:4	0.21	26.0	5	5	5
PRT	sp|Q61699|HS105_MOUSE	Heat shock protein 105 kDa OS=Mus musculus (Mouse) OX=10090 GN=Hsph1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26.0	null	167-UNIMOD:4,642-UNIMOD:4	0.06	26.0	4	4	4
PRT	sp|P62242|RS8_MOUSE	40S ribosomal protein S8 OS=Mus musculus (Mouse) OX=10090 GN=Rps8 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26.0	null	100-UNIMOD:4	0.13	26.0	4	2	0
PRT	sp|P97351|RS3A_MOUSE	40S ribosomal protein S3a OS=Mus musculus (Mouse) OX=10090 GN=Rps3a PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26.0	null	201-UNIMOD:4	0.10	26.0	2	2	2
PRT	sp|Q9R0Q7|TEBP_MOUSE	Prostaglandin E synthase 3 OS=Mus musculus (Mouse) OX=10090 GN=Ptges3 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26.0	null	58-UNIMOD:4,40-UNIMOD:4	0.32	26.0	6	4	2
PRT	sp|O88342|WDR1_MOUSE	WD repeat-containing protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Wdr1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26.0	null	507-UNIMOD:4	0.19	26.0	6	6	6
PRT	sp|P61922|GABT_MOUSE	4-aminobutyrate aminotransferase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Abat PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	26.0	null	269-UNIMOD:385,269-UNIMOD:4,440-UNIMOD:4,321-UNIMOD:4,334-UNIMOD:4,224-UNIMOD:4	0.27	26.0	12	9	6
PRT	sp|P37804|TAGL_MOUSE	Transgelin OS=Mus musculus (Mouse) OX=10090 GN=Tagln PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.07	26.0	1	1	1
PRT	sp|P23492|PNPH_MOUSE	Purine nucleoside phosphorylase OS=Mus musculus (Mouse) OX=10090 GN=Pnp PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26.0	null	142-UNIMOD:4	0.19	26.0	3	3	3
PRT	sp|O70456|1433S_MOUSE	14-3-3 protein sigma OS=Mus musculus (Mouse) OX=10090 GN=Sfn PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.04	26.0	5	1	0
PRT	sp|Q9CZU6|CISY_MOUSE	Citrate synthase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Cs PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.10	26.0	9	4	0
PRT	sp|Q921F2|TADBP_MOUSE	TAR DNA-binding protein 43 OS=Mus musculus (Mouse) OX=10090 GN=Tardbp PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26.0	null	244-UNIMOD:4	0.15	26.0	4	4	4
PRT	sp|P47955|RLA1_MOUSE	60S acidic ribosomal protein P1 OS=Mus musculus (Mouse) OX=10090 GN=Rplp1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	26.0	null	2-UNIMOD:1,9-UNIMOD:4	0.39	26.0	3	2	1
PRT	sp|O89017|LGMN_MOUSE	Legumain OS=Mus musculus (Mouse) OX=10090 GN=Lgmn PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.04	26.0	1	1	1
PRT	sp|Q9QYB1|CLIC4_MOUSE	Chloride intracellular channel protein 4 OS=Mus musculus (Mouse) OX=10090 GN=Clic4 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26.0	null	100-UNIMOD:4	0.13	26.0	3	2	1
PRT	sp|Q9Z1Q5|CLIC1_MOUSE	Chloride intracellular channel protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Clic1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26.0	null	178-UNIMOD:4,191-UNIMOD:4,223-UNIMOD:4	0.30	26.0	7	5	3
PRT	sp|Q5FWK3|RHG01_MOUSE	Rho GTPase-activating protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Arhgap1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	26.0	null	1-UNIMOD:1	0.09	26.0	2	2	2
PRT	sp|P47911|RL6_MOUSE	60S ribosomal protein L6 OS=Mus musculus (Mouse) OX=10090 GN=Rpl6 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	26.0	null	175-UNIMOD:28	0.09	26.0	2	2	2
PRT	sp|Q4KML4|ABRAL_MOUSE	Costars family protein ABRACL OS=Mus musculus (Mouse) OX=10090 GN=Abracl PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	26.0	null	39-UNIMOD:385,39-UNIMOD:4,1-UNIMOD:1	0.49	26.0	4	3	2
PRT	sp|P50543|S10AB_MOUSE	Protein S100-A11 OS=Mus musculus (Mouse) OX=10090 GN=S100a11 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	26.0	null	8-UNIMOD:385,8-UNIMOD:4	0.30	26.0	3	2	1
PRT	sp|Q9CQR2|RS21_MOUSE	40S ribosomal protein S21 OS=Mus musculus (Mouse) OX=10090 GN=Rps21 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	26.0	null	1-UNIMOD:1,56-UNIMOD:4	0.31	26.0	2	2	2
PRT	sp|P62858|RS28_MOUSE	40S ribosomal protein S28 OS=Mus musculus (Mouse) OX=10090 GN=Rps28 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25.0	null	27-UNIMOD:4	0.30	25.0	2	2	2
PRT	sp|P60867|RS20_MOUSE	40S ribosomal protein S20 OS=Mus musculus (Mouse) OX=10090 GN=Rps20 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.21	25.0	3	2	1
PRT	sp|Q8VDK1|NIT1_MOUSE	Deaminated glutathione amidase OS=Mus musculus (Mouse) OX=10090 GN=Nit1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25.0	null	63-UNIMOD:4,247-UNIMOD:4,255-UNIMOD:4,281-UNIMOD:4,288-UNIMOD:4,76-UNIMOD:4,199-UNIMOD:4	0.35	25.0	10	7	4
PRT	sp|Q9Z2I9|SUCB1_MOUSE	Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Sucla2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25.0	null	152-UNIMOD:4,158-UNIMOD:4,384-UNIMOD:4	0.20	25.0	8	6	4
PRT	sp|Q8VCC2|EST1_MOUSE	Liver carboxylesterase 1 OS=Mus musculus (Mouse) OX=10090 GN=Ces1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|P97447|FHL1_MOUSE	Four and a half LIM domains protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Fhl1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.05	25.0	2	1	0
PRT	sp|P62245|RS15A_MOUSE	40S ribosomal protein S15a OS=Mus musculus (Mouse) OX=10090 GN=Rps15a PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.19	25.0	4	2	1
PRT	sp|P14148|RL7_MOUSE	60S ribosomal protein L7 OS=Mus musculus (Mouse) OX=10090 GN=Rpl7 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.09	25.0	3	2	1
PRT	sp|P98078|DAB2_MOUSE	Disabled homolog 2 OS=Mus musculus (Mouse) OX=10090 GN=Dab2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25.0	null	138-UNIMOD:4	0.11	25.0	10	6	3
PRT	sp|Q64727|VINC_MOUSE	Vinculin OS=Mus musculus (Mouse) OX=10090 GN=Vcl PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.08	25.0	6	6	6
PRT	sp|P61205|ARF3_MOUSE	ADP-ribosylation factor 3 OS=Mus musculus (Mouse) OX=10090 GN=Arf3 PE=2 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.09	25.0	2	1	0
PRT	sp|Q9D826|SOX_MOUSE	Peroxisomal sarcosine oxidase OS=Mus musculus (Mouse) OX=10090 GN=Pipox PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	25.0	null	163-UNIMOD:4,170-UNIMOD:4,71-UNIMOD:4,113-UNIMOD:28,89-UNIMOD:28	0.22	25.0	13	6	0
PRT	sp|O88569|ROA2_MOUSE	Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Mus musculus (Mouse) OX=10090 GN=Hnrnpa2b1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25.0	null	50-UNIMOD:4	0.24	25.0	9	6	3
PRT	tr|A0A5F8MPY2|A0A5F8MPY2_MOUSE	Uncharacterized protein OS=Mus musculus (Mouse) OX=10090 GN=ENSMUSG00000118552 PE=3 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.40	25.0	3	2	1
PRT	sp|Q9DBE0|CSAD_MOUSE	Cysteine sulfinic acid decarboxylase OS=Mus musculus (Mouse) OX=10090 GN=Csad PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.14	25.0	8	5	2
PRT	sp|Q9DCU9|HOGA1_MOUSE	4-hydroxy-2-oxoglutarate aldolase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Hoga1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25.0	null	251-UNIMOD:4	0.20	25.0	6	4	2
PRT	sp|E9PV24|FIBA_MOUSE	Fibrinogen alpha chain OS=Mus musculus (Mouse) OX=10090 GN=Fga PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.03	25.0	2	2	2
PRT	sp|Q99LX0|PARK7_MOUSE	Protein/nucleic acid deglycase DJ-1 OS=Mus musculus (Mouse) OX=10090 GN=Park7 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25.0	null	53-UNIMOD:4,46-UNIMOD:4,106-UNIMOD:4,121-UNIMOD:4	0.43	25.0	7	4	2
PRT	sp|Q8VDN2|AT1A1_MOUSE	Sodium/potassium-transporting ATPase subunit alpha-1 OS=Mus musculus (Mouse) OX=10090 GN=Atp1a1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25.0	null	249-UNIMOD:4	0.06	25.0	6	4	2
PRT	sp|P10605|CATB_MOUSE	Cathepsin B OS=Mus musculus (Mouse) OX=10090 GN=Ctsb PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25.0	null	319-UNIMOD:4,93-UNIMOD:4	0.19	25.0	7	4	1
PRT	sp|A2AQ07|TBB1_MOUSE	Tubulin beta-1 chain OS=Mus musculus (Mouse) OX=10090 GN=Tubb1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25.0	null	257-UNIMOD:35	0.05	25.0	10	3	0
PRT	sp|Q9CPV4|GLOD4_MOUSE	Glyoxalase domain-containing protein 4 OS=Mus musculus (Mouse) OX=10090 GN=Glod4 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.22	25.0	5	4	3
PRT	sp|Q8BP67|RL24_MOUSE	60S ribosomal protein L24 OS=Mus musculus (Mouse) OX=10090 GN=Rpl24 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.09	25.0	2	1	0
PRT	sp|Q3UP75|UD3A1_MOUSE	UDP-glucuronosyltransferase 3A1 OS=Mus musculus (Mouse) OX=10090 GN=Ugt3a1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|P13020|GELS_MOUSE	Gelsolin OS=Mus musculus (Mouse) OX=10090 GN=Gsn PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25.0	null	329-UNIMOD:4	0.10	25.0	4	4	4
PRT	sp|Q9CWS0|DDAH1_MOUSE	N(G),N(G)-dimethylarginine dimethylaminohydrolase 1 OS=Mus musculus (Mouse) OX=10090 GN=Ddah1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	25.0	null	274-UNIMOD:4,275-UNIMOD:4,46-UNIMOD:28,178-UNIMOD:4	0.45	25.0	10	8	6
PRT	sp|Q91ZA3|PCCA_MOUSE	Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Pcca PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.20	25.0	11	10	9
PRT	sp|P29758|OAT_MOUSE	Ornithine aminotransferase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Oat PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.17	25.0	6	5	4
PRT	sp|Q00898|A1AT5_MOUSE	Alpha-1-antitrypsin 1-5 OS=Mus musculus (Mouse) OX=10090 GN=Serpina1e PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.05	25.0	2	1	0
PRT	sp|Q02053|UBA1_MOUSE	Ubiquitin-like modifier-activating enzyme 1 OS=Mus musculus (Mouse) OX=10090 GN=Uba1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25.0	null	234-UNIMOD:4	0.19	25.0	12	11	10
PRT	sp|O08756|HCD2_MOUSE	3-hydroxyacyl-CoA dehydrogenase type-2 OS=Mus musculus (Mouse) OX=10090 GN=Hsd17b10 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25.0	null	91-UNIMOD:4	0.17	25.0	3	3	3
PRT	sp|Q61598|GDIB_MOUSE	Rab GDP dissociation inhibitor beta OS=Mus musculus (Mouse) OX=10090 GN=Gdi2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25.0	null	202-UNIMOD:4,203-UNIMOD:4	0.25	25.0	11	8	5
PRT	sp|Q9CZ30|OLA1_MOUSE	Obg-like ATPase 1 OS=Mus musculus (Mouse) OX=10090 GN=Ola1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.04	25.0	1	1	1
PRT	sp|Q03734|SPA3M_MOUSE	Serine protease inhibitor A3M OS=Mus musculus (Mouse) OX=10090 GN=Serpina3m PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.05	25.0	1	1	1
PRT	sp|P46656|ADX_MOUSE	Adrenodoxin, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Fdx1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25.0	null	156-UNIMOD:4,159-UNIMOD:4	0.17	25.0	2	2	2
PRT	sp|Q9WVM8|AADAT_MOUSE	Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Aadat PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25.0	null	154-UNIMOD:4	0.24	25.0	9	6	4
PRT	sp|P55264|ADK_MOUSE	Adenosine kinase OS=Mus musculus (Mouse) OX=10090 GN=Adk PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25.0	null	159-UNIMOD:4,105-UNIMOD:4,352-UNIMOD:4	0.24	25.0	7	5	3
PRT	sp|P16331|PH4H_MOUSE	Phenylalanine-4-hydroxylase OS=Mus musculus (Mouse) OX=10090 GN=Pah PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	25.0	null	2-UNIMOD:1,357-UNIMOD:4	0.21	25.0	9	7	5
PRT	sp|P26041|MOES_MOUSE	Moesin OS=Mus musculus (Mouse) OX=10090 GN=Msn PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	25.0	null		0.10	25.0	4	4	4
PRT	tr|Q91V77|Q91V77_MOUSE	Isoform of P56565, Protein S100 OS=Mus musculus (Mouse) OX=10090 GN=S100a1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	null	2-UNIMOD:1	0.23	25.0	1	1	1
PRT	sp|Q8BGJ9|U2AF4_MOUSE	Splicing factor U2AF 26 kDa subunit OS=Mus musculus (Mouse) OX=10090 GN=U2af1l4 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	null	2-UNIMOD:1	0.06	25.0	1	1	1
PRT	sp|Q60865|CAPR1_MOUSE	Caprin-1 OS=Mus musculus (Mouse) OX=10090 GN=Caprin1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|O89023|TPP1_MOUSE	Tripeptidyl-peptidase 1 OS=Mus musculus (Mouse) OX=10090 GN=Tpp1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.04	25.0	2	1	0
PRT	sp|Q9D7B6|ACAD8_MOUSE	Isobutyryl-CoA dehydrogenase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Acad8 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.12	24.0	4	4	4
PRT	sp|P70290|EM55_MOUSE	55 kDa erythrocyte membrane protein OS=Mus musculus (Mouse) OX=10090 GN=Mpp1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	null	242-UNIMOD:4	0.05	24.0	2	1	0
PRT	sp|O35381|AN32A_MOUSE	Acidic leucine-rich nuclear phosphoprotein 32 family member A OS=Mus musculus (Mouse) OX=10090 GN=Anp32a PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	null	123-UNIMOD:4	0.15	24.0	3	3	3
PRT	tr|A0A0J9YTU1|A0A0J9YTU1_MOUSE	Isoform of P97328, PfkB domain-containing protein (Fragment) OS=Mus musculus (Mouse) OX=10090 GN=Khk PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.05	24.0	3	1	0
PRT	sp|Q9QUI0|RHOA_MOUSE	Transforming protein RhoA OS=Mus musculus (Mouse) OX=10090 GN=Rhoa PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	24.0	null	159-UNIMOD:4,52-UNIMOD:28	0.16	24.0	3	2	1
PRT	sp|Q9CZN7|GLYM_MOUSE	Serine hydroxymethyltransferase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Shmt2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	null	91-UNIMOD:4	0.08	24.0	5	3	1
PRT	sp|P97315|CSRP1_MOUSE	Cysteine and glycine-rich protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Csrp1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	null	25-UNIMOD:4	0.09	24.0	1	1	1
PRT	sp|Q60668|HNRPD_MOUSE	Heterogeneous nuclear ribonucleoprotein D0 OS=Mus musculus (Mouse) OX=10090 GN=Hnrnpd PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	null	226-UNIMOD:4	0.08	24.0	3	2	1
PRT	sp|Q9JHI5|IVD_MOUSE	Isovaleryl-CoA dehydrogenase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Ivd PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	null	134-UNIMOD:4,252-UNIMOD:4,259-UNIMOD:4	0.23	24.0	9	6	3
PRT	sp|Q80X90|FLNB_MOUSE	Filamin-B OS=Mus musculus (Mouse) OX=10090 GN=Flnb PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	null	1081-UNIMOD:4,2115-UNIMOD:4,1434-UNIMOD:4	0.06	24.0	10	10	10
PRT	sp|Q99J99|THTM_MOUSE	3-mercaptopyruvate sulfurtransferase OS=Mus musculus (Mouse) OX=10090 GN=Mpst PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.16	24.0	2	2	2
PRT	tr|E9Q7L0|E9Q7L0_MOUSE	Transket_pyr domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Ogdhl PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	null	513-UNIMOD:4	0.06	24.0	7	5	3
PRT	sp|Q9CXW4|RL11_MOUSE	60S ribosomal protein L11 OS=Mus musculus (Mouse) OX=10090 GN=Rpl11 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	null	21-UNIMOD:4,25-UNIMOD:4	0.16	24.0	4	2	0
PRT	sp|P10630|IF4A2_MOUSE	Eukaryotic initiation factor 4A-II OS=Mus musculus (Mouse) OX=10090 GN=Eif4a2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.11	24.0	6	4	3
PRT	sp|Q8R146|APEH_MOUSE	Acylamino-acid-releasing enzyme OS=Mus musculus (Mouse) OX=10090 GN=Apeh PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	24.0	null	682-UNIMOD:28,292-UNIMOD:4,303-UNIMOD:4	0.16	24.0	8	7	6
PRT	tr|A0A1B0GRG8|A0A1B0GRG8_MOUSE	Predicted gene 5678 OS=Mus musculus (Mouse) OX=10090 GN=Gm5678 PE=3 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	null	226-UNIMOD:4,227-UNIMOD:4	0.11	24.0	2	2	2
PRT	sp|Q9CR57|RL14_MOUSE	60S ribosomal protein L14 OS=Mus musculus (Mouse) OX=10090 GN=Rpl14 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	24.0	null	54-UNIMOD:385,54-UNIMOD:4	0.11	24.0	3	2	1
PRT	sp|P20029|BIP_MOUSE	Endoplasmic reticulum chaperone BiP OS=Mus musculus (Mouse) OX=10090 GN=Hspa5 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.18	24.0	11	8	6
PRT	sp|Q60864|STIP1_MOUSE	Stress-induced-phosphoprotein 1 OS=Mus musculus (Mouse) OX=10090 GN=Stip1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.04	24.0	2	2	2
PRT	sp|P48722|HS74L_MOUSE	Heat shock 70 kDa protein 4L OS=Mus musculus (Mouse) OX=10090 GN=Hspa4l PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	null	376-UNIMOD:4,380-UNIMOD:4	0.02	24.0	2	1	0
PRT	sp|Q9D0S9|HINT2_MOUSE	Histidine triad nucleotide-binding protein 2, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Hint2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	null	75-UNIMOD:4	0.33	24.0	6	3	1
PRT	sp|O09172|GSH0_MOUSE	Glutamate--cysteine ligase regulatory subunit OS=Mus musculus (Mouse) OX=10090 GN=Gclm PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.12	24.0	2	2	2
PRT	tr|A0A0A6YW67|A0A0A6YW67_MOUSE	Predicted pseudogene 8797 OS=Mus musculus (Mouse) OX=10090 GN=Gm8797 PE=4 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.22	24.0	2	1	0
PRT	sp|Q9QXD1|ACOX2_MOUSE	Peroxisomal acyl-coenzyme A oxidase 2 OS=Mus musculus (Mouse) OX=10090 GN=Acox2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.05	24.0	2	2	2
PRT	sp|Q8VCN5|CGL_MOUSE	Cystathionine gamma-lyase OS=Mus musculus (Mouse) OX=10090 GN=Cth PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	null	251-UNIMOD:4,254-UNIMOD:4,255-UNIMOD:4,108-UNIMOD:4,171-UNIMOD:4	0.28	24.0	9	7	6
PRT	sp|Q9Z2Y8|PLPHP_MOUSE	Pyridoxal phosphate homeostasis protein OS=Mus musculus (Mouse) OX=10090 GN=Plpbp PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.20	24.0	5	4	3
PRT	sp|Q8BVE3|VATH_MOUSE	V-type proton ATPase subunit H OS=Mus musculus (Mouse) OX=10090 GN=Atp6v1h PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.08	24.0	3	2	1
PRT	sp|Q99LP6|GRPE1_MOUSE	GrpE protein homolog 1, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Grpel1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.06	24.0	1	1	1
PRT	sp|Q8CI94|PYGB_MOUSE	Glycogen phosphorylase, brain form OS=Mus musculus (Mouse) OX=10090 GN=Pygb PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.03	24.0	2	2	2
PRT	sp|Q3TW96|UAP1L_MOUSE	UDP-N-acetylhexosamine pyrophosphorylase-like protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Uap1l1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	null	271-UNIMOD:4,278-UNIMOD:4	0.16	24.0	6	5	4
PRT	sp|P62821|RAB1A_MOUSE	Ras-related protein Rab-1A OS=Mus musculus (Mouse) OX=10090 GN=Rab1A PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.12	24.0	3	2	1
PRT	sp|Q8BMS1|ECHA_MOUSE	Trifunctional enzyme subunit alpha, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Hadha PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.18	24.0	7	7	7
PRT	sp|Q9QYR9|ACOT2_MOUSE	Acyl-coenzyme A thioesterase 2, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Acot2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.14	24.0	5	5	5
PRT	sp|O35643|AP1B1_MOUSE	AP-1 complex subunit beta-1 OS=Mus musculus (Mouse) OX=10090 GN=Ap1b1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	24.0	null	391-UNIMOD:385,391-UNIMOD:4	0.15	24.0	10	9	8
PRT	tr|E9QPD7|E9QPD7_MOUSE	Isoform of Q05920, Pyruvate carboxylase OS=Mus musculus (Mouse) OX=10090 GN=Pcx PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	24.0	null	302-UNIMOD:28	0.05	24.0	2	2	1
PRT	sp|P21107-2|TPM3-2_MOUSE	Isoform of P21107, Isoform 2 of Tropomyosin alpha-3 chain OS=Mus musculus (Mouse) OX=10090 GN=Tpm3 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null	2-UNIMOD:1	0.08	24.0	2	2	2
PRT	sp|P24288|BCAT1_MOUSE	Branched-chain-amino-acid aminotransferase, cytosolic OS=Mus musculus (Mouse) OX=10090 GN=Bcat1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null	292-UNIMOD:28	0.04	24.0	1	1	1
PRT	sp|P20065-2|TYB4-2_MOUSE	Isoform of P20065, Isoform Short of Thymosin beta-4 OS=Mus musculus (Mouse) OX=10090 GN=Tmsb4x PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null	2-UNIMOD:1	0.27	24.0	2	1	0
PRT	sp|Q91VM9|IPYR2_MOUSE	Inorganic pyrophosphatase 2, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Ppa2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	null	285-UNIMOD:4,291-UNIMOD:4,297-UNIMOD:4	0.37	24.0	11	8	5
PRT	sp|Q99K67|AASS_MOUSE	Alpha-aminoadipic semialdehyde synthase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Aass PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	null	240-UNIMOD:4,765-UNIMOD:4	0.21	23.0	18	14	10
PRT	sp|Q8BWF0|SSDH_MOUSE	Succinate-semialdehyde dehydrogenase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Aldh5a1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	23.0	null	328-UNIMOD:4,330-UNIMOD:4,181-UNIMOD:28,260-UNIMOD:4,81-UNIMOD:4	0.20	23.0	10	7	4
PRT	sp|Q9CY64|BIEA_MOUSE	Biliverdin reductase A OS=Mus musculus (Mouse) OX=10090 GN=Blvra PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	null	280-UNIMOD:4	0.17	23.0	5	4	3
PRT	sp|Q8BL66|EEA1_MOUSE	Early endosome antigen 1 OS=Mus musculus (Mouse) OX=10090 GN=Eea1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q99020|ROAA_MOUSE	Heterogeneous nuclear ribonucleoprotein A/B OS=Mus musculus (Mouse) OX=10090 GN=Hnrnpab PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.05	23.0	2	1	0
PRT	sp|Q64669|NQO1_MOUSE	NAD(P)H dehydrogenase [quinone] 1 OS=Mus musculus (Mouse) OX=10090 GN=Nqo1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.05	23.0	1	1	1
PRT	sp|P62137|PP1A_MOUSE	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Mus musculus (Mouse) OX=10090 GN=Ppp1ca PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	null	171-UNIMOD:4,172-UNIMOD:4	0.14	23.0	3	3	3
PRT	sp|Q9DBP5|KCY_MOUSE	UMP-CMP kinase OS=Mus musculus (Mouse) OX=10090 GN=Cmpk1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.13	23.0	4	2	0
PRT	sp|Q9DCM0|ETHE1_MOUSE	Persulfide dioxygenase ETHE1, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Ethe1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	null	219-UNIMOD:4,98-UNIMOD:4,170-UNIMOD:4	0.25	23.0	8	5	2
PRT	sp|Q78JT3|3HAO_MOUSE	3-hydroxyanthranilate 3,4-dioxygenase OS=Mus musculus (Mouse) OX=10090 GN=Haao PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	23.0	null	224-UNIMOD:28	0.29	23.0	8	6	5
PRT	sp|Q8VCH0|THIKB_MOUSE	3-ketoacyl-CoA thiolase B, peroxisomal OS=Mus musculus (Mouse) OX=10090 GN=Acaa1b PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	null	381-UNIMOD:4	0.30	23.0	7	6	5
PRT	sp|O35593|PSDE_MOUSE	26S proteasome non-ATPase regulatory subunit 14 OS=Mus musculus (Mouse) OX=10090 GN=Psmd14 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.05	23.0	1	1	1
PRT	sp|O88428|PAPS2_MOUSE	Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2 OS=Mus musculus (Mouse) OX=10090 GN=Papss2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.05	23.0	2	2	2
PRT	sp|Q8R4N0|CLYBL_MOUSE	Citramalyl-CoA lyase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Clybl PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.18	23.0	6	4	2
PRT	sp|P35278|RAB5C_MOUSE	Ras-related protein Rab-5C OS=Mus musculus (Mouse) OX=10090 GN=Rab5c PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.23	23.0	5	4	3
PRT	sp|P62702|RS4X_MOUSE	40S ribosomal protein S4, X isoform OS=Mus musculus (Mouse) OX=10090 GN=Rps4x PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	null	181-UNIMOD:4	0.16	23.0	5	3	1
PRT	sp|Q9WTP7|KAD3_MOUSE	GTP:AMP phosphotransferase AK3, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Ak3 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	null	85-UNIMOD:4	0.32	23.0	9	5	1
PRT	sp|P26883|FKB1A_MOUSE	Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Mus musculus (Mouse) OX=10090 GN=Fkbp1a PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	23.0	null		0.27	23.0	4	2	0
PRT	sp|P15626|GSTM2_MOUSE	Glutathione S-transferase Mu 2 OS=Mus musculus (Mouse) OX=10090 GN=Gstm2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	null	174-UNIMOD:4	0.11	23.0	2	2	2
PRT	sp|Q8BGA8|ACSM5_MOUSE	Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Acsm5 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	null	109-UNIMOD:4,342-UNIMOD:4,317-UNIMOD:4,318-UNIMOD:4	0.16	23.0	6	6	6
PRT	sp|Q6PB66|LPPRC_MOUSE	Leucine-rich PPR motif-containing protein, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Lrpprc PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	null	207-UNIMOD:4	0.03	23.0	5	3	2
PRT	tr|A0A0R4J0I1|A0A0R4J0I1_MOUSE	Isoform of P07759, Serine protease inhibitor A3K OS=Mus musculus (Mouse) OX=10090 GN=Serpina3k PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.04	23.0	2	1	0
PRT	sp|P62264|RS14_MOUSE	40S ribosomal protein S14 OS=Mus musculus (Mouse) OX=10090 GN=Rps14 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.15	23.0	1	1	1
PRT	sp|Q8JZZ0|UD3A2_MOUSE	UDP-glucuronosyltransferase 3A2 OS=Mus musculus (Mouse) OX=10090 GN=Ugt3a2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	null	120-UNIMOD:4	0.05	23.0	3	2	1
PRT	sp|P57776|EF1D_MOUSE	Elongation factor 1-delta OS=Mus musculus (Mouse) OX=10090 GN=Eef1d PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.05	23.0	3	1	0
PRT	sp|Q9DCG6|PBLD1_MOUSE	Phenazine biosynthesis-like domain-containing protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Pbld1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.09	23.0	5	2	0
PRT	sp|Q8BFP9|PDK1_MOUSE	[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Pdk1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|P27773|PDIA3_MOUSE	Protein disulfide-isomerase A3 OS=Mus musculus (Mouse) OX=10090 GN=Pdia3 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	null	85-UNIMOD:4,92-UNIMOD:4,244-UNIMOD:4	0.23	23.0	10	8	6
PRT	sp|P51660|DHB4_MOUSE	Peroxisomal multifunctional enzyme type 2 OS=Mus musculus (Mouse) OX=10090 GN=Hsd17b4 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	23.0	null	175-UNIMOD:4,424-UNIMOD:385,424-UNIMOD:4	0.09	23.0	5	5	5
PRT	sp|O55060|TPMT_MOUSE	Thiopurine S-methyltransferase OS=Mus musculus (Mouse) OX=10090 GN=Tpmt PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	null	65-UNIMOD:4	0.24	23.0	4	4	4
PRT	sp|Q641P0|ARP3B_MOUSE	Actin-related protein 3B OS=Mus musculus (Mouse) OX=10090 GN=Actr3b PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q9JHU4|DYHC1_MOUSE	Cytoplasmic dynein 1 heavy chain 1 OS=Mus musculus (Mouse) OX=10090 GN=Dync1h1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.01	23.0	3	3	3
PRT	sp|Q76MZ3|2AAA_MOUSE	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Mus musculus (Mouse) OX=10090 GN=Ppp2r1a PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	23.0	null	2-UNIMOD:1,399-UNIMOD:28,310-UNIMOD:4,317-UNIMOD:4	0.17	23.0	7	6	5
PRT	sp|Q60759|GCDH_MOUSE	Glutaryl-CoA dehydrogenase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Gcdh PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	23.0	null		0.15	23.0	4	4	4
PRT	sp|Q61233|PLSL_MOUSE	Plastin-2 OS=Mus musculus (Mouse) OX=10090 GN=Lcp1 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.06	23.0	2	2	2
PRT	sp|P26638|SYSC_MOUSE	Serine--tRNA ligase, cytoplasmic OS=Mus musculus (Mouse) OX=10090 GN=Sars1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	null	395-UNIMOD:4,398-UNIMOD:4	0.09	23.0	2	2	2
PRT	sp|Q8VDD5|MYH9_MOUSE	Myosin-9 OS=Mus musculus (Mouse) OX=10090 GN=Myh9 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	23.0	null	210-UNIMOD:28	0.07	23.0	7	7	7
PRT	tr|A0A0J9YU79|A0A0J9YU79_MOUSE	Isoform of P97328, Ketohexokinase OS=Mus musculus (Mouse) OX=10090 GN=Khk PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	null	57-UNIMOD:385,57-UNIMOD:4,289-UNIMOD:385,289-UNIMOD:4	0.11	23.0	2	2	1
PRT	sp|P52825|CPT2_MOUSE	Carnitine O-palmitoyltransferase 2, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Cpt2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	23.0	null	643-UNIMOD:385,643-UNIMOD:4	0.04	23.0	2	2	2
PRT	sp|Q8K183|PDXK_MOUSE	Pyridoxal kinase OS=Mus musculus (Mouse) OX=10090 GN=Pdxk PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.06	23.0	2	1	0
PRT	sp|O35660|GSTM6_MOUSE	Glutathione S-transferase Mu 6 OS=Mus musculus (Mouse) OX=10090 GN=Gstm6 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null	87-UNIMOD:4	0.10	22.0	5	3	2
PRT	sp|Q91YI0|ARLY_MOUSE	Argininosuccinate lyase OS=Mus musculus (Mouse) OX=10090 GN=Asl PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null	256-UNIMOD:35,307-UNIMOD:4	0.21	22.0	15	8	3
PRT	sp|Q99KR3|LACB2_MOUSE	Endoribonuclease LACTB2 OS=Mus musculus (Mouse) OX=10090 GN=Lactb2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null	100-UNIMOD:4,58-UNIMOD:4	0.26	22.0	9	5	2
PRT	tr|D3Z5G7|D3Z5G7_MOUSE	Carboxylic ester hydrolase OS=Mus musculus (Mouse) OX=10090 GN=Ces1b PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.04	22.0	2	2	2
PRT	sp|O08638|MYH11_MOUSE	Myosin-11 OS=Mus musculus (Mouse) OX=10090 GN=Myh11 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q3UZZ6|ST1D1_MOUSE	Sulfotransferase 1 family member D1 OS=Mus musculus (Mouse) OX=10090 GN=Sult1d1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.41	22.0	11	8	5
PRT	sp|O35855|BCAT2_MOUSE	Branched-chain-amino-acid aminotransferase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Bcat2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.03	22.0	2	1	0
PRT	sp|Q61545|EWS_MOUSE	RNA-binding protein EWS OS=Mus musculus (Mouse) OX=10090 GN=Ewsr1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|P21981|TGM2_MOUSE	Protein-glutamine gamma-glutamyltransferase 2 OS=Mus musculus (Mouse) OX=10090 GN=Tgm2 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null	370-UNIMOD:4,371-UNIMOD:4,619-UNIMOD:4	0.08	22.0	4	3	2
PRT	sp|P58771|TPM1_MOUSE	Tropomyosin alpha-1 chain OS=Mus musculus (Mouse) OX=10090 GN=Tpm1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.04	22.0	3	1	0
PRT	sp|Q61207|SAP_MOUSE	Prosaposin OS=Mus musculus (Mouse) OX=10090 GN=Psap PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null	240-UNIMOD:4	0.07	22.0	4	3	2
PRT	tr|D3Z2H9|D3Z2H9_MOUSE	Tropomyosin 3, related sequence 7 OS=Mus musculus (Mouse) OX=10090 GN=Tpm3-rs7 PE=3 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null	170-UNIMOD:4	0.26	22.0	6	6	6
PRT	sp|Q9WV92|E41L3_MOUSE	Band 4.1-like protein 3 OS=Mus musculus (Mouse) OX=10090 GN=Epb41l3 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q2TPA8|HSDL2_MOUSE	Hydroxysteroid dehydrogenase-like protein 2 OS=Mus musculus (Mouse) OX=10090 GN=Hsdl2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null	11-UNIMOD:4	0.03	22.0	1	1	1
PRT	sp|P80315|TCPD_MOUSE	T-complex protein 1 subunit delta OS=Mus musculus (Mouse) OX=10090 GN=Cct4 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.04	22.0	3	2	1
PRT	sp|Q9CZ42|NNRD_MOUSE	ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Mus musculus (Mouse) OX=10090 GN=Naxd PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.10	22.0	2	2	2
PRT	sp|Q9D819|IPYR_MOUSE	Inorganic pyrophosphatase OS=Mus musculus (Mouse) OX=10090 GN=Ppa1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.06	22.0	1	1	1
PRT	sp|P34022|RANG_MOUSE	Ran-specific GTPase-activating protein OS=Mus musculus (Mouse) OX=10090 GN=Ranbp1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.06	22.0	1	1	1
PRT	sp|Q91X72|HEMO_MOUSE	Hemopexin OS=Mus musculus (Mouse) OX=10090 GN=Hpx PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null	255-UNIMOD:4,406-UNIMOD:4	0.12	22.0	5	4	3
PRT	tr|A2AFQ2|A2AFQ2_MOUSE	Isoform of O08756, 3-hydroxyacyl-CoA dehydrogenase type-2 OS=Mus musculus (Mouse) OX=10090 GN=Hsd17b10 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.14	22.0	3	2	1
PRT	sp|P62267|RS23_MOUSE	40S ribosomal protein S23 OS=Mus musculus (Mouse) OX=10090 GN=Rps23 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.08	22.0	1	1	1
PRT	sp|P17156|HSP72_MOUSE	Heat shock-related 70 kDa protein 2 OS=Mus musculus (Mouse) OX=10090 GN=Hspa2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.04	22.0	6	3	1
PRT	tr|D3Z7X0|D3Z7X0_MOUSE	Acyl-Coenzyme A dehydrogenase family, member 12 OS=Mus musculus (Mouse) OX=10090 GN=Acad12 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.09	22.0	3	3	3
PRT	sp|Q00897|A1AT4_MOUSE	Alpha-1-antitrypsin 1-4 OS=Mus musculus (Mouse) OX=10090 GN=Serpina1d PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.05	22.0	2	1	0
PRT	sp|P62075|TIM13_MOUSE	Mitochondrial import inner membrane translocase subunit Tim13 OS=Mus musculus (Mouse) OX=10090 GN=Timm13 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.16	22.0	1	1	1
PRT	tr|A2A5N3|A2A5N3_MOUSE	Polyadenylate-binding protein OS=Mus musculus (Mouse) OX=10090 GN=Pabpc1l PE=2 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null	339-UNIMOD:4	0.03	22.0	1	1	1
PRT	sp|P17879|HS71B_MOUSE	Heat shock 70 kDa protein 1B OS=Mus musculus (Mouse) OX=10090 GN=Hspa1b PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.03	22.0	1	1	1
PRT	tr|E9Q616|E9Q616_MOUSE	PDZ domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Ahnak PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|P47754|CAZA2_MOUSE	F-actin-capping protein subunit alpha-2 OS=Mus musculus (Mouse) OX=10090 GN=Capza2 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	22.0	null	2-UNIMOD:1,157-UNIMOD:4	0.37	22.0	6	6	6
PRT	sp|Q9WVL0|MAAI_MOUSE	Maleylacetoacetate isomerase OS=Mus musculus (Mouse) OX=10090 GN=Gstz1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null	154-UNIMOD:4,165-UNIMOD:4	0.31	22.0	7	5	3
PRT	sp|P49935|CATH_MOUSE	Pro-cathepsin H OS=Mus musculus (Mouse) OX=10090 GN=Ctsh PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.09	22.0	3	2	1
PRT	sp|P68040|RACK1_MOUSE	Receptor of activated protein C kinase 1 OS=Mus musculus (Mouse) OX=10090 GN=Rack1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null	240-UNIMOD:4,182-UNIMOD:4	0.18	22.0	7	4	2
PRT	tr|Q80X81|Q80X81_MOUSE	Acetyl-Coenzyme A acetyltransferase 3 OS=Mus musculus (Mouse) OX=10090 GN=Acat3 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null	65-UNIMOD:4	0.12	22.0	5	3	1
PRT	sp|P62082|RS7_MOUSE	40S ribosomal protein S7 OS=Mus musculus (Mouse) OX=10090 GN=Rps7 PE=2 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.25	22.0	3	3	3
PRT	sp|P26043|RADI_MOUSE	Radixin OS=Mus musculus (Mouse) OX=10090 GN=Rdx PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.09	22.0	5	4	3
PRT	sp|Q9Z0J0|NPC2_MOUSE	NPC intracellular cholesterol transporter 2 OS=Mus musculus (Mouse) OX=10090 GN=Npc2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null	140-UNIMOD:4,93-UNIMOD:4,42-UNIMOD:4,47-UNIMOD:4	0.30	22.0	4	3	2
PRT	sp|Q8R1G2|CMBL_MOUSE	Carboxymethylenebutenolidase homolog OS=Mus musculus (Mouse) OX=10090 GN=Cmbl PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.11	22.0	1	1	1
PRT	sp|P26040|EZRI_MOUSE	Ezrin OS=Mus musculus (Mouse) OX=10090 GN=Ezr PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	22.0	null	117-UNIMOD:4,530-UNIMOD:28	0.15	22.0	11	6	1
PRT	sp|Q9D0F9|PGM1_MOUSE	Phosphoglucomutase-1 OS=Mus musculus (Mouse) OX=10090 GN=Pgm1 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null	374-UNIMOD:4,160-UNIMOD:4	0.21	22.0	8	7	6
PRT	tr|A0A087WPX1|A0A087WPX1_MOUSE	Isoform of Q99JW2, Aminoacylase-1 (Fragment) OS=Mus musculus (Mouse) OX=10090 GN=Acy1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.11	22.0	1	1	1
PRT	sp|Q8K386|RAB15_MOUSE	Ras-related protein Rab-15 OS=Mus musculus (Mouse) OX=10090 GN=Rab15 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.06	22.0	2	1	0
PRT	sp|Q99MR8|MCCA_MOUSE	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Mccc1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.10	22.0	4	4	4
PRT	sp|P49722|PSA2_MOUSE	Proteasome subunit alpha type-2 OS=Mus musculus (Mouse) OX=10090 GN=Psma2 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.15	22.0	2	2	2
PRT	sp|P70441|NHRF1_MOUSE	Na(+)/H(+) exchange regulatory cofactor NHE-RF1 OS=Mus musculus (Mouse) OX=10090 GN=Slc9a3r1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.13	22.0	7	4	2
PRT	tr|G5E895|G5E895_MOUSE	Aldo-keto reductase family 1, member B10 (aldose reductase) OS=Mus musculus (Mouse) OX=10090 GN=Akr1b10 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	null	2-UNIMOD:1	0.04	22.0	2	1	0
PRT	sp|P70168|IMB1_MOUSE	Importin subunit beta-1 OS=Mus musculus (Mouse) OX=10090 GN=Kpnb1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	null	1-UNIMOD:1	0.01	22.0	1	1	1
PRT	sp|Q9DAK9|PHP14_MOUSE	14 kDa phosphohistidine phosphatase OS=Mus musculus (Mouse) OX=10090 GN=Phpt1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	null	2-UNIMOD:1	0.16	22.0	1	1	1
PRT	sp|Q8K4F5|ABHDB_MOUSE	Protein ABHD11 OS=Mus musculus (Mouse) OX=10090 GN=Abhd11 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	22.0	null	209-UNIMOD:28	0.05	22.0	2	1	0
PRT	sp|Q8C0C7|SYFA_MOUSE	Phenylalanine--tRNA ligase alpha subunit OS=Mus musculus (Mouse) OX=10090 GN=Farsa PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	null	2-UNIMOD:1	0.02	22.0	1	1	1
PRT	sp|Q9DCV4|RMD1_MOUSE	Regulator of microtubule dynamics protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Rmdn1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	null	293-UNIMOD:28	0.05	22.0	1	1	1
PRT	sp|Q99LB7|SARDH_MOUSE	Sarcosine dehydrogenase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Sardh PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null	498-UNIMOD:4,800-UNIMOD:4	0.16	21.0	12	9	7
PRT	sp|Q9D0J8|PTMS_MOUSE	Parathymosin OS=Mus musculus (Mouse) OX=10090 GN=Ptms PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.13	21.0	3	2	1
PRT	sp|Q8K2B3|SDHA_MOUSE	Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Sdha PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null	467-UNIMOD:4,475-UNIMOD:4	0.07	21.0	3	3	3
PRT	sp|Q9CR51|VATG1_MOUSE	V-type proton ATPase subunit G 1 OS=Mus musculus (Mouse) OX=10090 GN=Atp6v1g1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.10	21.0	2	1	0
PRT	sp|Q6IRU2|TPM4_MOUSE	Tropomyosin alpha-4 chain OS=Mus musculus (Mouse) OX=10090 GN=Tpm4 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.14	21.0	3	3	3
PRT	tr|E9Q6L7|E9Q6L7_MOUSE	Glutathione S-transferase OS=Mus musculus (Mouse) OX=10090 GN=Gm10639 PE=3 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.14	21.0	5	4	3
PRT	sp|P61089|UBE2N_MOUSE	Ubiquitin-conjugating enzyme E2 N OS=Mus musculus (Mouse) OX=10090 GN=Ube2n PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null	87-UNIMOD:4	0.26	21.0	3	3	3
PRT	sp|Q8R0F8|FAHD1_MOUSE	Acylpyruvase FAHD1, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Fahd1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null	132-UNIMOD:4	0.13	21.0	2	2	2
PRT	tr|A0A087WP24|A0A087WP24_MOUSE	Isoform of Q8VCR7, AB hydrolase-1 domain-containing protein (Fragment) OS=Mus musculus (Mouse) OX=10090 GN=Abhd14b PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.07	21.0	1	1	1
PRT	sp|P62908|RS3_MOUSE	40S ribosomal protein S3 OS=Mus musculus (Mouse) OX=10090 GN=Rps3 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null	97-UNIMOD:4	0.12	21.0	3	2	1
PRT	sp|Q3V0K9|PLSI_MOUSE	Plastin-1 OS=Mus musculus (Mouse) OX=10090 GN=Pls1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.06	21.0	2	2	2
PRT	sp|P50396|GDIA_MOUSE	Rab GDP dissociation inhibitor alpha OS=Mus musculus (Mouse) OX=10090 GN=Gdi1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null	282-UNIMOD:4	0.18	21.0	5	5	5
PRT	sp|O35658|C1QBP_MOUSE	Complement component 1 Q subcomponent-binding protein, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=C1qbp PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.10	21.0	3	2	1
PRT	sp|Q9CS42|PRPS2_MOUSE	Ribose-phosphate pyrophosphokinase 2 OS=Mus musculus (Mouse) OX=10090 GN=Prps2 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	21.0	null	165-UNIMOD:4	0.10	21.0	2	2	2
PRT	sp|Q9WVE8|PACN2_MOUSE	Protein kinase C and casein kinase substrate in neurons protein 2 OS=Mus musculus (Mouse) OX=10090 GN=Pacsin2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null	465-UNIMOD:4	0.06	21.0	2	2	2
PRT	sp|P14131|RS16_MOUSE	40S ribosomal protein S16 OS=Mus musculus (Mouse) OX=10090 GN=Rps16 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.17	21.0	3	2	1
PRT	sp|Q61847|MEP1B_MOUSE	Meprin A subunit beta OS=Mus musculus (Mouse) OX=10090 GN=Mep1b PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null	145-UNIMOD:4	0.06	21.0	3	3	3
PRT	sp|Q6ZQ38|CAND1_MOUSE	Cullin-associated NEDD8-dissociated protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Cand1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	21.0	null	2-UNIMOD:1	0.13	21.0	10	10	10
PRT	sp|Q91YP0|L2HDH_MOUSE	L-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=L2hgdh PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|P01027|CO3_MOUSE	Complement C3 OS=Mus musculus (Mouse) OX=10090 GN=C3 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.04	21.0	4	4	4
PRT	sp|P08113|ENPL_MOUSE	Endoplasmin OS=Mus musculus (Mouse) OX=10090 GN=Hsp90b1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.09	21.0	6	6	6
PRT	sp|Q8BH86|GLUCM_MOUSE	D-glutamate cyclase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Dglucy PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null	54-UNIMOD:4	0.12	21.0	6	5	4
PRT	sp|Q8VEK3|HNRPU_MOUSE	Heterogeneous nuclear ribonucleoprotein U OS=Mus musculus (Mouse) OX=10090 GN=Hnrnpu PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.04	21.0	2	2	2
PRT	sp|Q62261|SPTB2_MOUSE	Spectrin beta chain, non-erythrocytic 1 OS=Mus musculus (Mouse) OX=10090 GN=Sptbn1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null	2261-UNIMOD:4,1389-UNIMOD:4	0.06	21.0	9	9	9
PRT	sp|Q7TQI3|OTUB1_MOUSE	Ubiquitin thioesterase OTUB1 OS=Mus musculus (Mouse) OX=10090 GN=Otub1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.06	21.0	1	1	1
PRT	sp|O08529|CAN2_MOUSE	Calpain-2 catalytic subunit OS=Mus musculus (Mouse) OX=10090 GN=Capn2 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null	82-UNIMOD:4	0.03	21.0	1	1	1
PRT	sp|P30275|KCRU_MOUSE	Creatine kinase U-type, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Ckmt1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.06	21.0	1	1	1
PRT	sp|Q8BG05|ROA3_MOUSE	Heterogeneous nuclear ribonucleoprotein A3 OS=Mus musculus (Mouse) OX=10090 GN=Hnrnpa3 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.09	21.0	2	2	2
PRT	sp|P16675|PPGB_MOUSE	Lysosomal protective protein OS=Mus musculus (Mouse) OX=10090 GN=Ctsa PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.09	21.0	4	3	2
PRT	tr|G3X9G9|G3X9G9_MOUSE	Methyltransferase-like 7A3 OS=Mus musculus (Mouse) OX=10090 GN=Mettl7a3 PE=4 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null	79-UNIMOD:4	0.07	21.0	1	1	1
PRT	sp|Q5XJY5|COPD_MOUSE	Coatomer subunit delta OS=Mus musculus (Mouse) OX=10090 GN=Arcn1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|P62900|RL31_MOUSE	60S ribosomal protein L31 OS=Mus musculus (Mouse) OX=10090 GN=Rpl31 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.12	21.0	1	1	1
PRT	sp|Q62422|OSTF1_MOUSE	Osteoclast-stimulating factor 1 OS=Mus musculus (Mouse) OX=10090 GN=Ostf1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.06	21.0	1	1	1
PRT	tr|D3YYM6|D3YYM6_MOUSE	Isoform of P97461, Ribosomal_S7 domain-containing protein (Fragment) OS=Mus musculus (Mouse) OX=10090 GN=Rps5 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null	172-UNIMOD:4	0.09	21.0	1	1	1
PRT	sp|Q9DCL9|PUR6_MOUSE	Multifunctional protein ADE2 OS=Mus musculus (Mouse) OX=10090 GN=Paics PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null	63-UNIMOD:4,288-UNIMOD:4,295-UNIMOD:4	0.16	21.0	5	5	5
PRT	tr|A0A0R4J050|A0A0R4J050_MOUSE	Isoform of Q99JW2, M20_dimer domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Acy1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.06	21.0	1	1	1
PRT	sp|P70349|HINT1_MOUSE	Histidine triad nucleotide-binding protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Hint1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	21.0	null	38-UNIMOD:385,38-UNIMOD:4	0.62	21.0	4	4	4
PRT	sp|Q64471|GSTT1_MOUSE	Glutathione S-transferase theta-1 OS=Mus musculus (Mouse) OX=10090 GN=Gstt1 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	21.0	null	14-UNIMOD:4	0.19	21.0	5	3	2
PRT	sp|Q99K30|ES8L2_MOUSE	Epidermal growth factor receptor kinase substrate 8-like protein 2 OS=Mus musculus (Mouse) OX=10090 GN=Eps8l2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|P61924|COPZ1_MOUSE	Coatomer subunit zeta-1 OS=Mus musculus (Mouse) OX=10090 GN=Copz1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	null	1-UNIMOD:1	0.08	21.0	1	1	1
PRT	sp|Q9CPP0|NPM3_MOUSE	Nucleoplasmin-3 OS=Mus musculus (Mouse) OX=10090 GN=Npm3 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	null	2-UNIMOD:1	0.10	21.0	1	1	1
PRT	sp|Q8JZN5|ACAD9_MOUSE	Complex I assembly factor ACAD9, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Acad9 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|Q9Z2M7|PMM2_MOUSE	Phosphomannomutase 2 OS=Mus musculus (Mouse) OX=10090 GN=Pmm2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	null	2-UNIMOD:1,5-UNIMOD:4	0.07	21.0	1	1	1
PRT	sp|Q61239|FNTA_MOUSE	Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha OS=Mus musculus (Mouse) OX=10090 GN=Fnta PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.05	21.0	1	1	1
PRT	sp|Q9D1K2|VATF_MOUSE	V-type proton ATPase subunit F OS=Mus musculus (Mouse) OX=10090 GN=Atp6v1f PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.17	20.0	2	2	2
PRT	sp|P61982|1433G_MOUSE	14-3-3 protein gamma OS=Mus musculus (Mouse) OX=10090 GN=Ywhag PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null	97-UNIMOD:4,112-UNIMOD:4	0.25	20.0	4	4	4
PRT	sp|Q7TMM9|TBB2A_MOUSE	Tubulin beta-2A chain OS=Mus musculus (Mouse) OX=10090 GN=Tubb2a PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.06	20.0	3	2	1
PRT	sp|P23927|CRYAB_MOUSE	Alpha-crystallin B chain OS=Mus musculus (Mouse) OX=10090 GN=Cryab PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.38	20.0	6	4	2
PRT	sp|O08677|KNG1_MOUSE	Kininogen-1 OS=Mus musculus (Mouse) OX=10090 GN=Kng1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null	339-UNIMOD:4,125-UNIMOD:4	0.04	20.0	2	2	2
PRT	sp|Q99L47|F10A1_MOUSE	Hsc70-interacting protein OS=Mus musculus (Mouse) OX=10090 GN=St13 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.08	20.0	2	2	2
PRT	sp|P80318|TCPG_MOUSE	T-complex protein 1 subunit gamma OS=Mus musculus (Mouse) OX=10090 GN=Cct3 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null	455-UNIMOD:4,173-UNIMOD:4	0.12	20.0	5	5	5
PRT	sp|Q62426|CYTB_MOUSE	Cystatin-B OS=Mus musculus (Mouse) OX=10090 GN=Cstb PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.31	20.0	3	2	1
PRT	sp|P62827|RAN_MOUSE	GTP-binding nuclear protein Ran OS=Mus musculus (Mouse) OX=10090 GN=Ran PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	20.0	null	112-UNIMOD:4,120-UNIMOD:4,2-UNIMOD:1	0.23	20.0	5	4	3
PRT	sp|Q3UPL0|SC31A_MOUSE	Protein transport protein Sec31A OS=Mus musculus (Mouse) OX=10090 GN=Sec31a PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.03	20.0	3	2	1
PRT	sp|P60766|CDC42_MOUSE	Cell division control protein 42 homolog OS=Mus musculus (Mouse) OX=10090 GN=Cdc42 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null	18-UNIMOD:4	0.23	20.0	4	3	2
PRT	sp|Q8VCT4|CES1D_MOUSE	Carboxylesterase 1D OS=Mus musculus (Mouse) OX=10090 GN=Ces1d PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.06	20.0	2	2	2
PRT	sp|Q99KQ4|NAMPT_MOUSE	Nicotinamide phosphoribosyltransferase OS=Mus musculus (Mouse) OX=10090 GN=Nampt PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.05	20.0	2	2	2
PRT	sp|Q9QXG4|ACSA_MOUSE	Acetyl-coenzyme A synthetase, cytoplasmic OS=Mus musculus (Mouse) OX=10090 GN=Acss2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null	104-UNIMOD:4	0.04	20.0	3	2	1
PRT	sp|Q78JN3|ECI3_MOUSE	Enoyl-CoA delta isomerase 3, peroxisomal OS=Mus musculus (Mouse) OX=10090 GN=Eci3 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null	289-UNIMOD:4	0.12	20.0	5	3	1
PRT	sp|Q8R086|SUOX_MOUSE	Sulfite oxidase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Suox PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null	300-UNIMOD:4	0.10	20.0	3	3	3
PRT	sp|Q6P1B1|XPP1_MOUSE	Xaa-Pro aminopeptidase 1 OS=Mus musculus (Mouse) OX=10090 GN=Xpnpep1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	20.0	null	606-UNIMOD:28	0.08	20.0	4	4	4
PRT	sp|P06728|APOA4_MOUSE	Apolipoprotein A-IV OS=Mus musculus (Mouse) OX=10090 GN=Apoa4 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.09	20.0	3	3	3
PRT	sp|Q9QXY6|EHD3_MOUSE	EH domain-containing protein 3 OS=Mus musculus (Mouse) OX=10090 GN=Ehd3 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q71RI9|KAT3_MOUSE	Kynurenine--oxoglutarate transaminase 3 OS=Mus musculus (Mouse) OX=10090 GN=Kyat3 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null	417-UNIMOD:4	0.09	20.0	3	3	3
PRT	sp|Q9JHU9|INO1_MOUSE	Inositol-3-phosphate synthase 1 OS=Mus musculus (Mouse) OX=10090 GN=Isyna1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	20.0	null	1-UNIMOD:1	0.09	20.0	3	3	3
PRT	sp|Q62159|RHOC_MOUSE	Rho-related GTP-binding protein RhoC OS=Mus musculus (Mouse) OX=10090 GN=Rhoc PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null	159-UNIMOD:4,107-UNIMOD:4,16-UNIMOD:4	0.21	20.0	3	3	3
PRT	sp|P62889|RL30_MOUSE	60S ribosomal protein L30 OS=Mus musculus (Mouse) OX=10090 GN=Rpl30 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null	52-UNIMOD:4	0.11	20.0	3	1	0
PRT	sp|Q9D2R0|AACS_MOUSE	Acetoacetyl-CoA synthetase OS=Mus musculus (Mouse) OX=10090 GN=Aacs PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.03	20.0	2	2	2
PRT	sp|O08553|DPYL2_MOUSE	Dihydropyrimidinase-related protein 2 OS=Mus musculus (Mouse) OX=10090 GN=Dpysl2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null	504-UNIMOD:4	0.09	20.0	3	3	3
PRT	tr|Q91YH6|Q91YH6_MOUSE	Vacuolar proton pump subunit B OS=Mus musculus (Mouse) OX=10090 GN=Atp6v1b1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null	419-UNIMOD:4	0.07	20.0	3	2	1
PRT	sp|P14869|RLA0_MOUSE	60S acidic ribosomal protein P0 OS=Mus musculus (Mouse) OX=10090 GN=Rplp0 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null	119-UNIMOD:4	0.18	20.0	7	4	1
PRT	sp|Q9R0N0|GALK1_MOUSE	Galactokinase OS=Mus musculus (Mouse) OX=10090 GN=Galk1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.10	20.0	4	3	2
PRT	sp|Q9CR16|PPID_MOUSE	Peptidyl-prolyl cis-trans isomerase D OS=Mus musculus (Mouse) OX=10090 GN=Ppid PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|P15331|PERI_MOUSE	Peripherin OS=Mus musculus (Mouse) OX=10090 GN=Prph PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|Q64433|CH10_MOUSE	10 kDa heat shock protein, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Hspe1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.22	20.0	3	3	3
PRT	sp|P80314|TCPB_MOUSE	T-complex protein 1 subunit beta OS=Mus musculus (Mouse) OX=10090 GN=Cct2 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.08	20.0	3	3	3
PRT	sp|Q9JLT4|TRXR2_MOUSE	Thioredoxin reductase 2, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Txnrd2 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null	86-UNIMOD:4,91-UNIMOD:4	0.03	20.0	1	1	1
PRT	sp|Q6ZQM8|UD17C_MOUSE	UDP-glucuronosyltransferase 1-7C OS=Mus musculus (Mouse) OX=10090 GN=Ugt1a7c PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null	154-UNIMOD:4	0.07	20.0	2	2	2
PRT	sp|P35979|RL12_MOUSE	60S ribosomal protein L12 OS=Mus musculus (Mouse) OX=10090 GN=Rpl12 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.10	20.0	2	1	0
PRT	sp|Q9DCM2|GSTK1_MOUSE	Glutathione S-transferase kappa 1 OS=Mus musculus (Mouse) OX=10090 GN=Gstk1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.07	20.0	1	1	1
PRT	tr|G3UXL2|G3UXL2_MOUSE	Pribosyltran_N domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Prps1l3 PE=3 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null	91-UNIMOD:4	0.10	20.0	2	2	2
PRT	sp|Q9CQI6|COTL1_MOUSE	Coactosin-like protein OS=Mus musculus (Mouse) OX=10090 GN=Cotl1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.27	20.0	5	3	2
PRT	sp|G5E8K5|ANK3_MOUSE	Ankyrin-3 OS=Mus musculus (Mouse) OX=10090 GN=Ank3 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.02	20.0	3	3	3
PRT	sp|Q68FL4|SAHH3_MOUSE	Putative adenosylhomocysteinase 3 OS=Mus musculus (Mouse) OX=10090 GN=Ahcyl2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null	234-UNIMOD:4,255-UNIMOD:4	0.04	20.0	1	1	1
PRT	sp|P61148|FGF1_MOUSE	Fibroblast growth factor 1 OS=Mus musculus (Mouse) OX=10090 GN=Fgf1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.08	20.0	1	1	1
PRT	sp|Q9CX56|PSMD8_MOUSE	26S proteasome non-ATPase regulatory subunit 8 OS=Mus musculus (Mouse) OX=10090 GN=Psmd8 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.05	20.0	1	1	1
PRT	sp|O35343|IMA3_MOUSE	Importin subunit alpha-3 OS=Mus musculus (Mouse) OX=10090 GN=Kpna4 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|Q921H8|THIKA_MOUSE	3-ketoacyl-CoA thiolase A, peroxisomal OS=Mus musculus (Mouse) OX=10090 GN=Acaa1a PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.05	20.0	1	1	1
PRT	sp|Q922R8|PDIA6_MOUSE	Protein disulfide-isomerase A6 OS=Mus musculus (Mouse) OX=10090 GN=Pdia6 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.13	20.0	4	3	2
PRT	sp|P61079|UB2D3_MOUSE	Ubiquitin-conjugating enzyme E2 D3 OS=Mus musculus (Mouse) OX=10090 GN=Ube2d3 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null	107-UNIMOD:4,111-UNIMOD:4	0.17	20.0	1	1	1
PRT	sp|P47757|CAPZB_MOUSE	F-actin-capping protein subunit beta OS=Mus musculus (Mouse) OX=10090 GN=Capzb PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	20.0	null	36-UNIMOD:4,2-UNIMOD:1,8-UNIMOD:4	0.22	20.0	3	3	3
PRT	sp|Q6PHN9|RAB35_MOUSE	Ras-related protein Rab-35 OS=Mus musculus (Mouse) OX=10090 GN=Rab35 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.06	20.0	2	1	0
PRT	sp|Q9QXN5|MIOX_MOUSE	Inositol oxygenase OS=Mus musculus (Mouse) OX=10090 GN=Miox PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	20.0	null	233-UNIMOD:28,235-UNIMOD:4	0.15	20.0	3	3	3
PRT	sp|Q8CAY6|THIC_MOUSE	Acetyl-CoA acetyltransferase, cytosolic OS=Mus musculus (Mouse) OX=10090 GN=Acat2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	20.0	null	360-UNIMOD:4	0.05	20.0	2	1	0
PRT	sp|O88685|PRS6A_MOUSE	26S proteasome regulatory subunit 6A OS=Mus musculus (Mouse) OX=10090 GN=Psmc3 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	null	197-UNIMOD:28,133-UNIMOD:28	0.07	20.0	2	2	2
PRT	sp|Q11011|PSA_MOUSE	Puromycin-sensitive aminopeptidase OS=Mus musculus (Mouse) OX=10090 GN=Npepps PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|P05784|K1C18_MOUSE	Keratin, type I cytoskeletal 18 OS=Mus musculus (Mouse) OX=10090 GN=Krt18 PE=1 SV=5	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.07	20.0	3	2	1
PRT	sp|Q8BP40|PPA6_MOUSE	Lysophosphatidic acid phosphatase type 6 OS=Mus musculus (Mouse) OX=10090 GN=Acp6 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|P84089|ERH_MOUSE	Enhancer of rudimentary homolog OS=Mus musculus (Mouse) OX=10090 GN=Erh PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	null	2-UNIMOD:1	0.12	20.0	2	1	0
PRT	sp|Q6ZWX6|IF2A_MOUSE	Eukaryotic translation initiation factor 2 subunit 1 OS=Mus musculus (Mouse) OX=10090 GN=Eif2s1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|Q9JME5|AP3B2_MOUSE	AP-3 complex subunit beta-2 OS=Mus musculus (Mouse) OX=10090 GN=Ap3b2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|A2ARV4|LRP2_MOUSE	Low-density lipoprotein receptor-related protein 2 OS=Mus musculus (Mouse) OX=10090 GN=Lrp2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null	3493-UNIMOD:4,3495-UNIMOD:4,2830-UNIMOD:4,2836-UNIMOD:4	0.02	19.0	8	7	6
PRT	sp|Q9CZ44|NSF1C_MOUSE	NSFL1 cofactor p47 OS=Mus musculus (Mouse) OX=10090 GN=Nsfl1c PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.08	19.0	2	2	2
PRT	sp|P47962|RL5_MOUSE	60S ribosomal protein L5 OS=Mus musculus (Mouse) OX=10090 GN=Rpl5 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null	62-UNIMOD:4	0.09	19.0	3	2	1
PRT	sp|Q3UFF7|LYPL1_MOUSE	Lysophospholipase-like protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Lyplal1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.13	19.0	2	2	2
PRT	sp|P20152|VIME_MOUSE	Vimentin OS=Mus musculus (Mouse) OX=10090 GN=Vim PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.04	19.0	2	2	2
PRT	sp|Q9CZX8|RS19_MOUSE	40S ribosomal protein S19 OS=Mus musculus (Mouse) OX=10090 GN=Rps19 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.07	19.0	1	1	1
PRT	sp|Q60692|PSB6_MOUSE	Proteasome subunit beta type-6 OS=Mus musculus (Mouse) OX=10090 GN=Psmb6 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.05	19.0	2	1	0
PRT	tr|E9Q453|E9Q453_MOUSE	Isoform of P58771, Tropomyosin alpha-1 chain OS=Mus musculus (Mouse) OX=10090 GN=Tpm1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.05	19.0	1	1	1
PRT	sp|Q91YR1|TWF1_MOUSE	Twinfilin-1 OS=Mus musculus (Mouse) OX=10090 GN=Twf1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.11	19.0	4	3	2
PRT	sp|P45376|ALDR_MOUSE	Aldo-keto reductase family 1 member B1 OS=Mus musculus (Mouse) OX=10090 GN=Akr1b1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	19.0	null	2-UNIMOD:1	0.13	19.0	5	4	3
PRT	sp|P61358|RL27_MOUSE	60S ribosomal protein L27 OS=Mus musculus (Mouse) OX=10090 GN=Rpl27 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.07	19.0	1	1	1
PRT	sp|Q9QUM9|PSA6_MOUSE	Proteasome subunit alpha type-6 OS=Mus musculus (Mouse) OX=10090 GN=Psma6 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.09	19.0	2	2	2
PRT	sp|P67984|RL22_MOUSE	60S ribosomal protein L22 OS=Mus musculus (Mouse) OX=10090 GN=Rpl22 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.09	19.0	2	1	0
PRT	sp|O35943|FRDA_MOUSE	Frataxin, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Fxn PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.06	19.0	1	1	1
PRT	sp|Q62393|TPD52_MOUSE	Tumor protein D52 OS=Mus musculus (Mouse) OX=10090 GN=Tpd52 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.12	19.0	2	2	2
PRT	sp|Q9DCC4|P5CR3_MOUSE	Pyrroline-5-carboxylate reductase 3 OS=Mus musculus (Mouse) OX=10090 GN=Pycr3 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.07	19.0	1	1	1
PRT	sp|Q8VCT3|AMPB_MOUSE	Aminopeptidase B OS=Mus musculus (Mouse) OX=10090 GN=Rnpep PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null	151-UNIMOD:4	0.03	19.0	1	1	1
PRT	sp|P62852|RS25_MOUSE	40S ribosomal protein S25 OS=Mus musculus (Mouse) OX=10090 GN=Rps25 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.16	19.0	2	2	2
PRT	sp|Q60928|GGT1_MOUSE	Glutathione hydrolase 1 proenzyme OS=Mus musculus (Mouse) OX=10090 GN=Ggt1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null	191-UNIMOD:4,195-UNIMOD:4	0.10	19.0	6	5	4
PRT	sp|Q64010|CRK_MOUSE	Adapter molecule crk OS=Mus musculus (Mouse) OX=10090 GN=Crk PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.05	19.0	1	1	1
PRT	sp|P62754|RS6_MOUSE	40S ribosomal protein S6 OS=Mus musculus (Mouse) OX=10090 GN=Rps6 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null	12-UNIMOD:4	0.22	19.0	5	4	3
PRT	sp|P08032|SPTA1_MOUSE	Spectrin alpha chain, erythrocytic 1 OS=Mus musculus (Mouse) OX=10090 GN=Spta1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.00	19.0	2	1	0
PRT	sp|Q00623|APOA1_MOUSE	Apolipoprotein A-I OS=Mus musculus (Mouse) OX=10090 GN=Apoa1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.09	19.0	3	2	1
PRT	sp|Q99JY0|ECHB_MOUSE	Trifunctional enzyme subunit beta, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Hadhb PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.08	19.0	4	3	2
PRT	sp|P28798|GRN_MOUSE	Progranulin OS=Mus musculus (Mouse) OX=10090 GN=Grn PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null	304-UNIMOD:4,305-UNIMOD:4	0.02	19.0	3	1	0
PRT	sp|Q60854|SPB6_MOUSE	Serpin B6 OS=Mus musculus (Mouse) OX=10090 GN=Serpinb6 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.07	19.0	2	2	2
PRT	sp|Q9WUM4|COR1C_MOUSE	Coronin-1C OS=Mus musculus (Mouse) OX=10090 GN=Coro1c PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null	39-UNIMOD:4	0.07	19.0	2	2	2
PRT	sp|P62774|MTPN_MOUSE	Myotrophin OS=Mus musculus (Mouse) OX=10090 GN=Mtpn PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.15	19.0	2	1	0
PRT	sp|Q99L20|GSTT3_MOUSE	Glutathione S-transferase theta-3 OS=Mus musculus (Mouse) OX=10090 GN=Gstt3 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	19.0	null	238-UNIMOD:4,14-UNIMOD:4,196-UNIMOD:28	0.26	19.0	6	4	2
PRT	sp|Q8K009|AL1L2_MOUSE	Mitochondrial 10-formyltetrahydrofolate dehydrogenase OS=Mus musculus (Mouse) OX=10090 GN=Aldh1l2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null	728-UNIMOD:4	0.03	19.0	3	3	3
PRT	sp|P51881|ADT2_MOUSE	ADP/ATP translocase 2 OS=Mus musculus (Mouse) OX=10090 GN=Slc25a5 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	19.0	null	2-UNIMOD:1	0.12	19.0	3	3	3
PRT	sp|P63242|IF5A1_MOUSE	Eukaryotic translation initiation factor 5A-1 OS=Mus musculus (Mouse) OX=10090 GN=Eif5a PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	19.0	null	2-UNIMOD:1,22-UNIMOD:4	0.25	19.0	4	2	1
PRT	sp|Q5U5V2|HYKK_MOUSE	Hydroxylysine kinase OS=Mus musculus (Mouse) OX=10090 GN=Hykk PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	19.0	null	313-UNIMOD:4,2-UNIMOD:1,102-UNIMOD:4	0.28	19.0	9	9	9
PRT	tr|D3Z298|D3Z298_MOUSE	Carboxylic ester hydrolase OS=Mus musculus (Mouse) OX=10090 GN=Ces1h PE=3 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.02	19.0	2	1	0
PRT	sp|Q9JMD3|STA10_MOUSE	START domain-containing protein 10 OS=Mus musculus (Mouse) OX=10090 GN=Stard10 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null	181-UNIMOD:4	0.10	19.0	2	2	2
PRT	sp|P68373|TBA1C_MOUSE	Tubulin alpha-1C chain OS=Mus musculus (Mouse) OX=10090 GN=Tuba1c PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null	295-UNIMOD:4	0.06	19.0	1	1	1
PRT	sp|Q9QXK3|COPG2_MOUSE	Coatomer subunit gamma-2 OS=Mus musculus (Mouse) OX=10090 GN=Copg2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q8K4Z3|NNRE_MOUSE	NAD(P)H-hydrate epimerase OS=Mus musculus (Mouse) OX=10090 GN=Naxe PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.11	19.0	2	2	2
PRT	sp|P62835|RAP1A_MOUSE	Ras-related protein Rap-1A OS=Mus musculus (Mouse) OX=10090 GN=Rap1a PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.07	19.0	1	1	1
PRT	sp|Q920A5|RISC_MOUSE	Retinoid-inducible serine carboxypeptidase OS=Mus musculus (Mouse) OX=10090 GN=Scpep1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.05	19.0	2	2	2
PRT	sp|P61087|UBE2K_MOUSE	Ubiquitin-conjugating enzyme E2 K OS=Mus musculus (Mouse) OX=10090 GN=Ube2k PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.08	19.0	1	1	1
PRT	sp|Q8R2K1|FUCM_MOUSE	Fucose mutarotase OS=Mus musculus (Mouse) OX=10090 GN=Fuom PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.19	19.0	2	2	2
PRT	sp|Q9D7S9|CHMP5_MOUSE	Charged multivesicular body protein 5 OS=Mus musculus (Mouse) OX=10090 GN=Chmp5 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.08	19.0	1	1	1
PRT	sp|Q64462|CP4B1_MOUSE	Cytochrome P450 4B1 OS=Mus musculus (Mouse) OX=10090 GN=Cyp4b1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	19.0	null	250-UNIMOD:4	0.13	19.0	7	5	4
PRT	sp|O09061|PSB1_MOUSE	Proteasome subunit beta type-1 OS=Mus musculus (Mouse) OX=10090 GN=Psmb1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.19	19.0	3	3	3
PRT	sp|P48774|GSTM5_MOUSE	Glutathione S-transferase Mu 5 OS=Mus musculus (Mouse) OX=10090 GN=Gstm5 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	19.0	null	177-UNIMOD:4,177-UNIMOD:385	0.30	19.0	6	5	4
PRT	sp|Q60648|SAP3_MOUSE	Ganglioside GM2 activator OS=Mus musculus (Mouse) OX=10090 GN=Gm2a PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.18	19.0	4	2	0
PRT	tr|D3Z6I8|D3Z6I8_MOUSE	Isoform of P21107, Tropomyosin alpha-3 chain OS=Mus musculus (Mouse) OX=10090 GN=Tpm3 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.05	19.0	1	1	1
PRT	sp|O88958|GNPI1_MOUSE	Glucosamine-6-phosphate isomerase 1 OS=Mus musculus (Mouse) OX=10090 GN=Gnpda1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null	118-UNIMOD:4	0.15	19.0	2	2	2
PRT	tr|A0A0A6YX73|A0A0A6YX73_MOUSE	Isoform of P12367, cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Mus musculus (Mouse) OX=10090 GN=Prkar2a PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	null	2-UNIMOD:1	0.06	19.0	1	1	1
PRT	sp|Q8CIE6|COPA_MOUSE	Coatomer subunit alpha OS=Mus musculus (Mouse) OX=10090 GN=Copa PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q9WTI7|MYO1C_MOUSE	Unconventional myosin-Ic OS=Mus musculus (Mouse) OX=10090 GN=Myo1c PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	null	939-UNIMOD:28,2-UNIMOD:1	0.03	19.0	2	2	2
PRT	sp|Q64737|PUR2_MOUSE	Trifunctional purine biosynthetic protein adenosine-3 OS=Mus musculus (Mouse) OX=10090 GN=Gart PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.05	19.0	2	2	2
PRT	sp|Q9EQ06|DHB11_MOUSE	Estradiol 17-beta-dehydrogenase 11 OS=Mus musculus (Mouse) OX=10090 GN=Hsd17b11 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.10	19.0	2	2	2
PRT	sp|P62751|RL23A_MOUSE	60S ribosomal protein L23a OS=Mus musculus (Mouse) OX=10090 GN=Rpl23a PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.09	19.0	1	1	1
PRT	sp|P48428|TBCA_MOUSE	Tubulin-specific chaperone A OS=Mus musculus (Mouse) OX=10090 GN=Tbca PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.09	18.0	1	1	1
PRT	sp|Q91VI7|RINI_MOUSE	Ribonuclease inhibitor OS=Mus musculus (Mouse) OX=10090 GN=Rnh1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null	194-UNIMOD:4	0.02	18.0	1	1	1
PRT	sp|Q9DBK0|ACO12_MOUSE	Acetyl-coenzyme A thioesterase OS=Mus musculus (Mouse) OX=10090 GN=Acot12 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null	540-UNIMOD:4	0.02	18.0	1	1	1
PRT	sp|P19253|RL13A_MOUSE	60S ribosomal protein L13a OS=Mus musculus (Mouse) OX=10090 GN=Rpl13a PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	18.0	null	2-UNIMOD:1	0.12	18.0	2	2	2
PRT	sp|O70475|UGDH_MOUSE	UDP-glucose 6-dehydrogenase OS=Mus musculus (Mouse) OX=10090 GN=Ugdh PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.03	18.0	1	1	1
PRT	sp|Q9JJV2|PROF2_MOUSE	Profilin-2 OS=Mus musculus (Mouse) OX=10090 GN=Pfn2 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.11	18.0	2	1	0
PRT	sp|Q8K010|OPLA_MOUSE	5-oxoprolinase OS=Mus musculus (Mouse) OX=10090 GN=Oplah PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null	382-UNIMOD:4	0.04	18.0	3	3	3
PRT	sp|Q3THS6|METK2_MOUSE	S-adenosylmethionine synthase isoform type-2 OS=Mus musculus (Mouse) OX=10090 GN=Mat2a PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.09	18.0	2	2	2
PRT	sp|Q924M7|MPI_MOUSE	Mannose-6-phosphate isomerase OS=Mus musculus (Mouse) OX=10090 GN=Mpi PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.04	18.0	1	1	1
PRT	sp|Q3ULJ0|GPD1L_MOUSE	Glycerol-3-phosphate dehydrogenase 1-like protein OS=Mus musculus (Mouse) OX=10090 GN=Gpd1l PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null	9-UNIMOD:4	0.05	18.0	1	1	1
PRT	sp|P61967|AP1S1_MOUSE	AP-1 complex subunit sigma-1A OS=Mus musculus (Mouse) OX=10090 GN=Ap1s1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.11	18.0	1	1	1
PRT	sp|Q9WUR9|KAD4_MOUSE	Adenylate kinase 4, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Ak4 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.08	18.0	1	1	1
PRT	sp|Q5SW19|CLU_MOUSE	Clustered mitochondria protein homolog OS=Mus musculus (Mouse) OX=10090 GN=Cluh PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.01	18.0	1	1	1
PRT	sp|P14115|RL27A_MOUSE	60S ribosomal protein L27a OS=Mus musculus (Mouse) OX=10090 GN=Rpl27a PE=1 SV=5	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.16	18.0	2	2	2
PRT	tr|A0A140T8T4|A0A140T8T4_MOUSE	Ribosomal protein L9, pseudogene 6 OS=Mus musculus (Mouse) OX=10090 GN=Rpl9-ps6 PE=4 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.06	18.0	1	1	1
PRT	sp|P47753|CAZA1_MOUSE	F-actin-capping protein subunit alpha-1 OS=Mus musculus (Mouse) OX=10090 GN=Capza1 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.04	18.0	1	1	1
PRT	sp|P10518|HEM2_MOUSE	Delta-aminolevulinic acid dehydratase OS=Mus musculus (Mouse) OX=10090 GN=Alad PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	18.0	null	203-UNIMOD:4,75-UNIMOD:4,75-UNIMOD:385	0.18	18.0	6	5	4
PRT	sp|Q91ZJ5|UGPA_MOUSE	UTP--glucose-1-phosphate uridylyltransferase OS=Mus musculus (Mouse) OX=10090 GN=Ugp2 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.06	18.0	2	2	2
PRT	sp|Q6P3A8|ODBB_MOUSE	2-oxoisovalerate dehydrogenase subunit beta, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Bckdhb PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null	297-UNIMOD:4	0.03	18.0	2	1	0
PRT	sp|Q8VDG5|PPCS_MOUSE	Phosphopantothenate--cysteine ligase OS=Mus musculus (Mouse) OX=10090 GN=Ppcs PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.04	18.0	1	1	1
PRT	sp|Q11136|PEPD_MOUSE	Xaa-Pro dipeptidase OS=Mus musculus (Mouse) OX=10090 GN=Pepd PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	18.0	null	183-UNIMOD:4,2-UNIMOD:1,58-UNIMOD:4	0.09	18.0	3	3	3
PRT	sp|Q9JKF1|IQGA1_MOUSE	Ras GTPase-activating-like protein IQGAP1 OS=Mus musculus (Mouse) OX=10090 GN=Iqgap1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.01	18.0	1	1	1
PRT	sp|P09405|NUCL_MOUSE	Nucleolin OS=Mus musculus (Mouse) OX=10090 GN=Ncl PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.07	18.0	4	4	4
PRT	sp|Q3THE2|ML12B_MOUSE	Myosin regulatory light chain 12B OS=Mus musculus (Mouse) OX=10090 GN=Myl12b PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.07	18.0	1	1	1
PRT	sp|Q8CC88|VWA8_MOUSE	von Willebrand factor A domain-containing protein 8 OS=Mus musculus (Mouse) OX=10090 GN=Vwa8 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.03	18.0	4	4	4
PRT	sp|Q8BGC4|PTGR3_MOUSE	Prostaglandin reductase-3 OS=Mus musculus (Mouse) OX=10090 GN=Zadh2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.04	18.0	1	1	1
PRT	sp|Q99K51|PLST_MOUSE	Plastin-3 OS=Mus musculus (Mouse) OX=10090 GN=Pls3 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.04	18.0	3	2	1
PRT	sp|Q9R1P0|PSA4_MOUSE	Proteasome subunit alpha type-4 OS=Mus musculus (Mouse) OX=10090 GN=Psma4 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null	107-UNIMOD:4,115-UNIMOD:4	0.13	18.0	2	2	2
PRT	sp|P97371|PSME1_MOUSE	Proteasome activator complex subunit 1 OS=Mus musculus (Mouse) OX=10090 GN=Psme1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.05	18.0	1	1	1
PRT	sp|Q04447|KCRB_MOUSE	Creatine kinase B-type OS=Mus musculus (Mouse) OX=10090 GN=Ckb PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.03	18.0	1	1	1
PRT	sp|Q3UGR5|HDHD2_MOUSE	Haloacid dehalogenase-like hydrolase domain-containing protein 2 OS=Mus musculus (Mouse) OX=10090 GN=Hdhd2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.05	18.0	1	1	1
PRT	tr|Q91WT7|Q91WT7_MOUSE	Aldo_ket_red domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Akr1c14 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.04	18.0	2	1	0
PRT	sp|P42932|TCPQ_MOUSE	T-complex protein 1 subunit theta OS=Mus musculus (Mouse) OX=10090 GN=Cct8 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.08	18.0	4	4	4
PRT	sp|P36552|HEM6_MOUSE	Oxygen-dependent coproporphyrinogen-III oxidase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Cpox PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null	346-UNIMOD:4	0.11	18.0	3	3	3
PRT	sp|P62281|RS11_MOUSE	40S ribosomal protein S11 OS=Mus musculus (Mouse) OX=10090 GN=Rps11 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null	131-UNIMOD:4	0.19	18.0	2	2	2
PRT	sp|Q9R1P1|PSB3_MOUSE	Proteasome subunit beta type-3 OS=Mus musculus (Mouse) OX=10090 GN=Psmb3 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.25	18.0	3	3	3
PRT	sp|Q9DBL7|COASY_MOUSE	Bifunctional coenzyme A synthase OS=Mus musculus (Mouse) OX=10090 GN=Coasy PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.05	18.0	2	2	2
PRT	sp|Q9JMH6|TRXR1_MOUSE	Thioredoxin reductase 1, cytoplasmic OS=Mus musculus (Mouse) OX=10090 GN=Txnrd1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.05	18.0	3	2	1
PRT	sp|Q9QZE5|COPG1_MOUSE	Coatomer subunit gamma-1 OS=Mus musculus (Mouse) OX=10090 GN=Copg1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null	325-UNIMOD:4,420-UNIMOD:4	0.06	18.0	3	3	3
PRT	sp|P53395|ODB2_MOUSE	Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Dbt PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null	333-UNIMOD:4	0.15	18.0	4	4	4
PRT	sp|Q9QZX7|SRR_MOUSE	Serine racemase OS=Mus musculus (Mouse) OX=10090 GN=Srr PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.05	18.0	1	1	1
PRT	sp|P70695|F16P2_MOUSE	Fructose-1,6-bisphosphatase isozyme 2 OS=Mus musculus (Mouse) OX=10090 GN=Fbp2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.05	18.0	1	1	1
PRT	sp|Q61768|KINH_MOUSE	Kinesin-1 heavy chain OS=Mus musculus (Mouse) OX=10090 GN=Kif5b PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.02	18.0	1	1	1
PRT	sp|P05214|TBA3_MOUSE	Tubulin alpha-3 chain OS=Mus musculus (Mouse) OX=10090 GN=Tuba3a PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null	347-UNIMOD:4	0.03	18.0	2	1	0
PRT	tr|F7AEH4|F7AEH4_MOUSE	Isoform of P63323, 40S ribosomal protein S12 OS=Mus musculus (Mouse) OX=10090 GN=Rps12 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	null	2-UNIMOD:1	0.17	18.0	2	1	0
PRT	tr|A6ZI47|A6ZI47_MOUSE	Fructose-bisphosphate aldolase OS=Mus musculus (Mouse) OX=10090 GN=Aldoart2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	null	2-UNIMOD:1	0.04	18.0	1	1	1
PRT	sp|P47740|AL3A2_MOUSE	Aldehyde dehydrogenase family 3 member A2 OS=Mus musculus (Mouse) OX=10090 GN=Aldh3a2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.03	18.0	1	1	1
PRT	sp|P62334|PRS10_MOUSE	26S proteasome regulatory subunit 10B OS=Mus musculus (Mouse) OX=10090 GN=Psmc6 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.04	18.0	1	1	1
PRT	sp|P54775|PRS6B_MOUSE	26S proteasome regulatory subunit 6B OS=Mus musculus (Mouse) OX=10090 GN=Psmc4 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	null	204-UNIMOD:35,210-UNIMOD:4	0.03	18.0	2	1	0
PRT	sp|P17710|HXK1_MOUSE	Hexokinase-1 OS=Mus musculus (Mouse) OX=10090 GN=Hk1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null	684-UNIMOD:4	0.03	18.0	2	2	2
PRT	sp|P53996|CNBP_MOUSE	Cellular nucleic acid-binding protein OS=Mus musculus (Mouse) OX=10090 GN=Cnbp PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	null	120-UNIMOD:385,120-UNIMOD:4,123-UNIMOD:4	0.07	18.0	1	1	1
PRT	tr|Q3UWL8|Q3UWL8_MOUSE	Prefoldin subunit 4 OS=Mus musculus (Mouse) OX=10090 GN=Pfdn4 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.10	18.0	1	1	1
PRT	sp|Q6ZWV7|RL35_MOUSE	60S ribosomal protein L35 OS=Mus musculus (Mouse) OX=10090 GN=Rpl35 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.09	18.0	1	1	1
PRT	sp|Q8CGK3|LONM_MOUSE	Lon protease homolog, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Lonp1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	17.0	null		0.05	17.0	4	4	4
PRT	tr|A2AEH9|A2AEH9_MOUSE	Thymosin beta 15a OS=Mus musculus (Mouse) OX=10090 GN=Tmsb15a PE=4 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.10	17.0	2	1	0
PRT	sp|P17225|PTBP1_MOUSE	Polypyrimidine tract-binding protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Ptbp1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|Q9CY58|PAIRB_MOUSE	Plasminogen activator inhibitor 1 RNA-binding protein OS=Mus musculus (Mouse) OX=10090 GN=Serbp1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.03	17.0	1	1	1
PRT	sp|Q9QZD9|EIF3I_MOUSE	Eukaryotic translation initiation factor 3 subunit I OS=Mus musculus (Mouse) OX=10090 GN=Eif3i PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.03	17.0	1	1	1
PRT	sp|P46638|RB11B_MOUSE	Ras-related protein Rab-11B OS=Mus musculus (Mouse) OX=10090 GN=Rab11b PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.08	17.0	2	2	2
PRT	sp|O09131|GSTO1_MOUSE	Glutathione S-transferase omega-1 OS=Mus musculus (Mouse) OX=10090 GN=Gsto1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.04	17.0	1	1	1
PRT	sp|Q99JW2|ACY1_MOUSE	Aminoacylase-1 OS=Mus musculus (Mouse) OX=10090 GN=Acy1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.08	17.0	4	3	2
PRT	sp|O70435|PSA3_MOUSE	Proteasome subunit alpha type-3 OS=Mus musculus (Mouse) OX=10090 GN=Psma3 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.15	17.0	4	3	2
PRT	sp|P28738|KIF5C_MOUSE	Kinesin heavy chain isoform 5C OS=Mus musculus (Mouse) OX=10090 GN=Kif5c PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null	296-UNIMOD:4	0.03	17.0	2	2	2
PRT	sp|Q8K0E8|FIBB_MOUSE	Fibrinogen beta chain OS=Mus musculus (Mouse) OX=10090 GN=Fgb PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.03	17.0	1	1	1
PRT	sp|Q9JJU8|SH3L1_MOUSE	SH3 domain-binding glutamic acid-rich-like protein OS=Mus musculus (Mouse) OX=10090 GN=Sh3bgrl PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.12	17.0	1	1	1
PRT	sp|A3KMP2|TTC38_MOUSE	Tetratricopeptide repeat protein 38 OS=Mus musculus (Mouse) OX=10090 GN=Ttc38 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null	24-UNIMOD:4	0.09	17.0	3	3	3
PRT	sp|Q9DCJ9|NPL_MOUSE	N-acetylneuraminate lyase OS=Mus musculus (Mouse) OX=10090 GN=Npl PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null	185-UNIMOD:4	0.14	17.0	3	3	3
PRT	tr|B2RPU8|B2RPU8_MOUSE	SCAN domain containing 3 OS=Mus musculus (Mouse) OX=10090 GN=Zbed5 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null	136-UNIMOD:4,126-UNIMOD:4	0.03	17.0	2	2	2
PRT	sp|A2BIM8|MUP18_MOUSE	Major urinary protein 18 OS=Mus musculus (Mouse) OX=10090 GN=Mup18 PE=3 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.07	17.0	2	1	0
PRT	sp|Q8R3P0|ACY2_MOUSE	Aspartoacylase OS=Mus musculus (Mouse) OX=10090 GN=Aspa PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.04	17.0	1	1	1
PRT	sp|O35737|HNRH1_MOUSE	Heterogeneous nuclear ribonucleoprotein H OS=Mus musculus (Mouse) OX=10090 GN=Hnrnph1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	17.0	null	22-UNIMOD:4	0.14	17.0	5	4	3
PRT	sp|O08807|PRDX4_MOUSE	Peroxiredoxin-4 OS=Mus musculus (Mouse) OX=10090 GN=Prdx4 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.03	17.0	2	1	0
PRT	sp|Q3UEG6|AGT2_MOUSE	Alanine--glyoxylate aminotransferase 2, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Agxt2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null	316-UNIMOD:4,199-UNIMOD:4	0.12	17.0	4	4	4
PRT	sp|Q64176|EST1E_MOUSE	Carboxylesterase 1E OS=Mus musculus (Mouse) OX=10090 GN=Ces1e PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.03	17.0	1	1	1
PRT	sp|P12382|PFKAL_MOUSE	ATP-dependent 6-phosphofructokinase, liver type OS=Mus musculus (Mouse) OX=10090 GN=Pfkl PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null	708-UNIMOD:4	0.02	17.0	1	1	1
PRT	sp|Q9DCH4|EIF3F_MOUSE	Eukaryotic translation initiation factor 3 subunit F OS=Mus musculus (Mouse) OX=10090 GN=Eif3f PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.05	17.0	1	1	1
PRT	sp|P24527|LKHA4_MOUSE	Leukotriene A-4 hydrolase OS=Mus musculus (Mouse) OX=10090 GN=Lta4h PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.07	17.0	3	3	3
PRT	sp|P10493|NID1_MOUSE	Nidogen-1 OS=Mus musculus (Mouse) OX=10090 GN=Nid1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|Q9D8I3|GLOD5_MOUSE	Glyoxalase domain-containing protein 5 OS=Mus musculus (Mouse) OX=10090 GN=Glod5 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.07	17.0	1	1	1
PRT	sp|P62746|RHOB_MOUSE	Rho-related GTP-binding protein RhoB OS=Mus musculus (Mouse) OX=10090 GN=Rhob PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null	20-UNIMOD:4	0.05	17.0	3	1	0
PRT	sp|Q9QUH0|GLRX1_MOUSE	Glutaredoxin-1 OS=Mus musculus (Mouse) OX=10090 GN=Glrx PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.11	17.0	2	1	0
PRT	sp|Q4FZG7|TI8AB_MOUSE	Putative mitochondrial import inner membrane translocase subunit Tim8 A-B OS=Mus musculus (Mouse) OX=10090 GN=Timm8a2 PE=3 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.12	17.0	1	1	1
PRT	sp|Q9WVK4|EHD1_MOUSE	EH domain-containing protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Ehd1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null	138-UNIMOD:4	0.07	17.0	2	2	2
PRT	sp|Q8K1M6|DNM1L_MOUSE	Dynamin-1-like protein OS=Mus musculus (Mouse) OX=10090 GN=Dnm1l PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|Q9NYQ2|HAOX2_MOUSE	Hydroxyacid oxidase 2 OS=Mus musculus (Mouse) OX=10090 GN=Hao2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	17.0	null	2-UNIMOD:1,5-UNIMOD:4	0.11	17.0	3	3	3
PRT	sp|Q91WG0|EST2C_MOUSE	Acylcarnitine hydrolase OS=Mus musculus (Mouse) OX=10090 GN=Ces2c PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|Q8QZS1|HIBCH_MOUSE	3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Hibch PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null	270-UNIMOD:4	0.17	17.0	4	4	4
PRT	sp|Q91V41|RAB14_MOUSE	Ras-related protein Rab-14 OS=Mus musculus (Mouse) OX=10090 GN=Rab14 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.13	17.0	2	2	2
PRT	sp|Q9WU78|PDC6I_MOUSE	Programmed cell death 6-interacting protein OS=Mus musculus (Mouse) OX=10090 GN=Pdcd6ip PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|Q9R0M5|TPK1_MOUSE	Thiamin pyrophosphokinase 1 OS=Mus musculus (Mouse) OX=10090 GN=Tpk1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null	20-UNIMOD:4	0.06	17.0	2	1	0
PRT	tr|B1AWE0|B1AWE0_MOUSE	Isoform of O08585, Clathrin light chain OS=Mus musculus (Mouse) OX=10090 GN=Clta PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.10	17.0	1	1	1
PRT	sp|Q9CWH6|PSMA8_MOUSE	Proteasome subunit alpha type-8 OS=Mus musculus (Mouse) OX=10090 GN=Psma8 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.06	17.0	1	1	1
PRT	sp|Q9CX86|ROA0_MOUSE	Heterogeneous nuclear ribonucleoprotein A0 OS=Mus musculus (Mouse) OX=10090 GN=Hnrnpa0 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.06	17.0	1	1	1
PRT	sp|P62715|PP2AB_MOUSE	Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform OS=Mus musculus (Mouse) OX=10090 GN=Ppp2cb PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	17.0	null	266-UNIMOD:4,269-UNIMOD:385,269-UNIMOD:4,196-UNIMOD:4	0.17	17.0	3	3	3
PRT	sp|Q9Z2X1|HNRPF_MOUSE	Heterogeneous nuclear ribonucleoprotein F OS=Mus musculus (Mouse) OX=10090 GN=Hnrnpf PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.04	17.0	1	1	1
PRT	sp|P63037|DNJA1_MOUSE	DnaJ homolog subfamily A member 1 OS=Mus musculus (Mouse) OX=10090 GN=Dnaja1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.07	17.0	1	1	1
PRT	sp|Q8BFW7|LPP_MOUSE	Lipoma-preferred partner homolog OS=Mus musculus (Mouse) OX=10090 GN=Lpp PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null	520-UNIMOD:4,525-UNIMOD:4	0.04	17.0	1	1	1
PRT	sp|P62849|RS24_MOUSE	40S ribosomal protein S24 OS=Mus musculus (Mouse) OX=10090 GN=Rps24 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	17.0	null	22-UNIMOD:28	0.19	17.0	2	2	2
PRT	sp|Q9R0Y5|KAD1_MOUSE	Adenylate kinase isoenzyme 1 OS=Mus musculus (Mouse) OX=10090 GN=Ak1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null	187-UNIMOD:4	0.29	17.0	3	3	3
PRT	sp|P61164|ACTZ_MOUSE	Alpha-centractin OS=Mus musculus (Mouse) OX=10090 GN=Actr1a PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.05	17.0	2	1	0
PRT	sp|O70133|DHX9_MOUSE	ATP-dependent RNA helicase A OS=Mus musculus (Mouse) OX=10090 GN=Dhx9 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.01	17.0	1	1	1
PRT	sp|Q99M87|DNJA3_MOUSE	DnaJ homolog subfamily A member 3, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Dnaja3 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.05	17.0	1	1	1
PRT	sp|A2ATU0|DHTK1_MOUSE	Probable 2-oxoglutarate dehydrogenase E1 component DHKTD1, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Dhtkd1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null	430-UNIMOD:4	0.05	17.0	4	3	2
PRT	sp|Q99LD8|DDAH2_MOUSE	N(G),N(G)-dimethylarginine dimethylaminohydrolase 2 OS=Mus musculus (Mouse) OX=10090 GN=Ddah2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.03	17.0	1	1	1
PRT	sp|P63028|TCTP_MOUSE	Translationally-controlled tumor protein OS=Mus musculus (Mouse) OX=10090 GN=Tpt1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null	28-UNIMOD:4	0.17	17.0	2	2	2
PRT	sp|Q3U5Q7|CMPK2_MOUSE	UMP-CMP kinase 2, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Cmpk2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null	243-UNIMOD:4	0.03	17.0	1	1	1
PRT	sp|P47791|GSHR_MOUSE	Glutathione reductase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Gsr PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null	256-UNIMOD:4	0.13	17.0	4	4	4
PRT	sp|P03995|GFAP_MOUSE	Glial fibrillary acidic protein OS=Mus musculus (Mouse) OX=10090 GN=Gfap PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.02	16.0	1	1	1
PRT	sp|Q60870|REEP5_MOUSE	Receptor expression-enhancing protein 5 OS=Mus musculus (Mouse) OX=10090 GN=Reep5 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.06	16.0	1	1	1
PRT	sp|Q9R1P4|PSA1_MOUSE	Proteasome subunit alpha type-1 OS=Mus musculus (Mouse) OX=10090 GN=Psma1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.05	16.0	1	1	1
PRT	sp|P49312|ROA1_MOUSE	Heterogeneous nuclear ribonucleoprotein A1 OS=Mus musculus (Mouse) OX=10090 GN=Hnrnpa1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.05	16.0	1	1	1
PRT	sp|Q9D7P6|ISCU_MOUSE	Iron-sulfur cluster assembly enzyme ISCU, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Iscu PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.05	16.0	1	1	1
PRT	sp|Q9DBL1|ACDSB_MOUSE	Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Acadsb PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null	139-UNIMOD:4	0.13	16.0	3	3	3
PRT	sp|P58774|TPM2_MOUSE	Tropomyosin beta chain OS=Mus musculus (Mouse) OX=10090 GN=Tpm2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null	190-UNIMOD:4	0.04	16.0	1	1	1
PRT	sp|Q9WVJ2|PSD13_MOUSE	26S proteasome non-ATPase regulatory subunit 13 OS=Mus musculus (Mouse) OX=10090 GN=Psmd13 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null	114-UNIMOD:4	0.03	16.0	1	1	1
PRT	tr|E9PWZ3|E9PWZ3_MOUSE	Ribosomal protein L3-like OS=Mus musculus (Mouse) OX=10090 GN=Rpl3l PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null	253-UNIMOD:4	0.03	16.0	1	1	1
PRT	sp|P50171|DHB8_MOUSE	Estradiol 17-beta-dehydrogenase 8 OS=Mus musculus (Mouse) OX=10090 GN=Hsd17b8 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.12	16.0	2	2	2
PRT	sp|P50580|PA2G4_MOUSE	Proliferation-associated protein 2G4 OS=Mus musculus (Mouse) OX=10090 GN=Pa2g4 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.11	16.0	3	3	3
PRT	sp|Q9Z1Q9|SYVC_MOUSE	Valine--tRNA ligase OS=Mus musculus (Mouse) OX=10090 GN=Vars1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.01	16.0	1	1	1
PRT	sp|Q9Z2H7|GIPC2_MOUSE	PDZ domain-containing protein GIPC2 OS=Mus musculus (Mouse) OX=10090 GN=Gipc2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.09	16.0	2	2	2
PRT	sp|Q9CWF2|TBB2B_MOUSE	Tubulin beta-2B chain OS=Mus musculus (Mouse) OX=10090 GN=Tubb2b PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.03	16.0	1	1	1
PRT	tr|E9Q0S6|E9Q0S6_MOUSE	Tensin 1 OS=Mus musculus (Mouse) OX=10090 GN=Tns1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.01	16.0	1	1	1
PRT	sp|Q8BH95|ECHM_MOUSE	Enoyl-CoA hydratase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Echs1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.12	16.0	2	2	2
PRT	sp|Q9ET22|DPP2_MOUSE	Dipeptidyl peptidase 2 OS=Mus musculus (Mouse) OX=10090 GN=Dpp7 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.08	16.0	4	3	2
PRT	sp|Q9Z1Z0|USO1_MOUSE	General vesicular transport factor p115 OS=Mus musculus (Mouse) OX=10090 GN=Uso1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.01	16.0	1	1	1
PRT	sp|Q91WU5|AS3MT_MOUSE	Arsenite methyltransferase OS=Mus musculus (Mouse) OX=10090 GN=As3mt PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.07	16.0	2	2	2
PRT	sp|P07309|TTHY_MOUSE	Transthyretin OS=Mus musculus (Mouse) OX=10090 GN=Ttr PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.10	16.0	1	1	1
PRT	sp|Q91X52|DCXR_MOUSE	L-xylulose reductase OS=Mus musculus (Mouse) OX=10090 GN=Dcxr PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null	100-UNIMOD:4	0.05	16.0	2	1	0
PRT	sp|P46412|GPX3_MOUSE	Glutathione peroxidase 3 OS=Mus musculus (Mouse) OX=10090 GN=Gpx3 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null	156-UNIMOD:4	0.07	16.0	1	1	1
PRT	sp|O70325|GPX4_MOUSE	Phospholipid hydroperoxide glutathione peroxidase OS=Mus musculus (Mouse) OX=10090 GN=Gpx4 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null	102-UNIMOD:4	0.14	16.0	2	2	2
PRT	sp|Q9DCV7|K2C7_MOUSE	Keratin, type II cytoskeletal 7 OS=Mus musculus (Mouse) OX=10090 GN=Krt7 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.05	16.0	2	2	2
PRT	sp|P48036|ANXA5_MOUSE	Annexin A5 OS=Mus musculus (Mouse) OX=10090 GN=Anxa5 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.04	16.0	2	1	0
PRT	sp|Q8VDM4|PSMD2_MOUSE	26S proteasome non-ATPase regulatory subunit 2 OS=Mus musculus (Mouse) OX=10090 GN=Psmd2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null	448-UNIMOD:4	0.04	16.0	2	2	2
PRT	sp|P45878|FKBP2_MOUSE	Peptidyl-prolyl cis-trans isomerase FKBP2 OS=Mus musculus (Mouse) OX=10090 GN=Fkbp2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.09	16.0	1	1	1
PRT	sp|O70251|EF1B_MOUSE	Elongation factor 1-beta OS=Mus musculus (Mouse) OX=10090 GN=Eef1b PE=1 SV=5	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.06	16.0	1	1	1
PRT	sp|Q62348|TSN_MOUSE	Translin OS=Mus musculus (Mouse) OX=10090 GN=Tsn PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.07	16.0	1	1	1
PRT	sp|Q9Z2U0|PSA7_MOUSE	Proteasome subunit alpha type-7 OS=Mus musculus (Mouse) OX=10090 GN=Psma7 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.06	16.0	1	1	1
PRT	sp|P58389|PTPA_MOUSE	Serine/threonine-protein phosphatase 2A activator OS=Mus musculus (Mouse) OX=10090 GN=Ptpa PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.03	16.0	1	1	1
PRT	sp|Q9JLI6|SCLY_MOUSE	Selenocysteine lyase OS=Mus musculus (Mouse) OX=10090 GN=Scly PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.03	16.0	1	1	1
PRT	sp|Q9CWK8|SNX2_MOUSE	Sorting nexin-2 OS=Mus musculus (Mouse) OX=10090 GN=Snx2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.02	16.0	1	1	1
PRT	sp|P59999|ARPC4_MOUSE	Actin-related protein 2/3 complex subunit 4 OS=Mus musculus (Mouse) OX=10090 GN=Arpc4 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.07	16.0	1	1	1
PRT	sp|Q9QYB5|ADDG_MOUSE	Gamma-adducin OS=Mus musculus (Mouse) OX=10090 GN=Add3 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.02	16.0	1	1	1
PRT	sp|Q61033|LAP2A_MOUSE	Lamina-associated polypeptide 2, isoforms alpha/zeta OS=Mus musculus (Mouse) OX=10090 GN=Tmpo PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	null		0.02	16.0	1	1	1
PRT	sp|Q60972|RBBP4_MOUSE	Histone-binding protein RBBP4 OS=Mus musculus (Mouse) OX=10090 GN=Rbbp4 PE=1 SV=5	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.03	16.0	1	1	1
PRT	sp|Q8BJY1|PSMD5_MOUSE	26S proteasome non-ATPase regulatory subunit 5 OS=Mus musculus (Mouse) OX=10090 GN=Psmd5 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.03	16.0	1	1	1
PRT	sp|P46664|PURA2_MOUSE	Adenylosuccinate synthetase isozyme 2 OS=Mus musculus (Mouse) OX=10090 GN=Adss2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null	58-UNIMOD:4	0.06	16.0	2	2	2
PRT	sp|P30416|FKBP4_MOUSE	Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Mus musculus (Mouse) OX=10090 GN=Fkbp4 PE=1 SV=5	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.03	16.0	1	1	1
PRT	sp|Q02819|NUCB1_MOUSE	Nucleobindin-1 OS=Mus musculus (Mouse) OX=10090 GN=Nucb1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.03	16.0	1	1	1
PRT	sp|Q8QZY1|EIF3L_MOUSE	Eukaryotic translation initiation factor 3 subunit L OS=Mus musculus (Mouse) OX=10090 GN=Eif3l PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.02	16.0	1	1	1
PRT	sp|P62192|PRS4_MOUSE	26S proteasome regulatory subunit 4 OS=Mus musculus (Mouse) OX=10090 GN=Psmc1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.07	16.0	2	2	2
PRT	sp|O54950|AAKG1_MOUSE	5'-AMP-activated protein kinase subunit gamma-1 OS=Mus musculus (Mouse) OX=10090 GN=Prkag1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.06	16.0	1	1	1
PRT	sp|Q9Z2W0|DNPEP_MOUSE	Aspartyl aminopeptidase OS=Mus musculus (Mouse) OX=10090 GN=Dnpep PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null	267-UNIMOD:4,269-UNIMOD:4,278-UNIMOD:4	0.08	16.0	2	2	2
PRT	sp|Q8VC12|HUTU_MOUSE	Urocanate hydratase OS=Mus musculus (Mouse) OX=10090 GN=Uroc1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.07	16.0	3	3	3
PRT	sp|Q9D8N0|EF1G_MOUSE	Elongation factor 1-gamma OS=Mus musculus (Mouse) OX=10090 GN=Eef1g PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	16.0	null	2-UNIMOD:1	0.09	16.0	4	3	2
PRT	sp|O88343-2|S4A4-2_MOUSE	Isoform of O88343, Isoform 2 of Electrogenic sodium bicarbonate cotransporter 1 OS=Mus musculus (Mouse) OX=10090 GN=Slc4a4 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	null		0.02	16.0	1	1	1
PRT	sp|Q00PI9|HNRL2_MOUSE	Heterogeneous nuclear ribonucleoprotein U-like protein 2 OS=Mus musculus (Mouse) OX=10090 GN=Hnrnpul2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	null		0.02	16.0	1	1	1
PRT	sp|P28656|NP1L1_MOUSE	Nucleosome assembly protein 1-like 1 OS=Mus musculus (Mouse) OX=10090 GN=Nap1l1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.03	16.0	1	1	1
PRT	sp|P30115|GSTA3_MOUSE	Glutathione S-transferase A3 OS=Mus musculus (Mouse) OX=10090 GN=Gsta3 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	null	2-UNIMOD:1	0.06	16.0	1	1	1
PRT	sp|Q9Z0N1|IF2G_MOUSE	Eukaryotic translation initiation factor 2 subunit 3, X-linked OS=Mus musculus (Mouse) OX=10090 GN=Eif2s3x PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.03	16.0	1	1	1
PRT	sp|P54726|RD23A_MOUSE	UV excision repair protein RAD23 homolog A OS=Mus musculus (Mouse) OX=10090 GN=Rad23a PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.02	16.0	1	1	1
PRT	sp|O55023|IMPA1_MOUSE	Inositol monophosphatase 1 OS=Mus musculus (Mouse) OX=10090 GN=Impa1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.04	16.0	1	1	1
PRT	sp|Q30KP5|DFB18_MOUSE	Beta-defensin 18 OS=Mus musculus (Mouse) OX=10090 GN=Defb18 PE=3 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.12	16.0	2	1	0
PRT	tr|E9PXC0|E9PXC0_MOUSE	Signal recognition particle 54 kDa protein OS=Mus musculus (Mouse) OX=10090 GN=Srp54c PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.03	16.0	1	1	1
PRT	sp|Q02013|AQP1_MOUSE	Aquaporin-1 OS=Mus musculus (Mouse) OX=10090 GN=Aqp1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.03	15.0	1	1	1
PRT	sp|Q7TPR4|ACTN1_MOUSE	Alpha-actinin-1 OS=Mus musculus (Mouse) OX=10090 GN=Actn1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|P05063|ALDOC_MOUSE	Fructose-bisphosphate aldolase C OS=Mus musculus (Mouse) OX=10090 GN=Aldoc PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null	202-UNIMOD:4	0.02	15.0	1	1	1
PRT	sp|Q99KJ8|DCTN2_MOUSE	Dynactin subunit 2 OS=Mus musculus (Mouse) OX=10090 GN=Dctn2 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.07	15.0	2	2	2
PRT	sp|P02802|MT1_MOUSE	Metallothionein-1 OS=Mus musculus (Mouse) OX=10090 GN=Mt1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null	33-UNIMOD:4,34-UNIMOD:4,36-UNIMOD:4,37-UNIMOD:4,41-UNIMOD:4	0.21	15.0	1	1	1
PRT	sp|Q91WK2|EIF3H_MOUSE	Eukaryotic translation initiation factor 3 subunit H OS=Mus musculus (Mouse) OX=10090 GN=Eif3h PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.06	15.0	1	1	1
PRT	sp|P24472|GSTA4_MOUSE	Glutathione S-transferase A4 OS=Mus musculus (Mouse) OX=10090 GN=Gsta4 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.06	15.0	2	1	0
PRT	sp|P25444|RS2_MOUSE	40S ribosomal protein S2 OS=Mus musculus (Mouse) OX=10090 GN=Rps2 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.04	15.0	2	1	0
PRT	sp|P32848|PRVA_MOUSE	Parvalbumin alpha OS=Mus musculus (Mouse) OX=10090 GN=Pvalb PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.15	15.0	1	1	1
PRT	sp|Q9D0I9|SYRC_MOUSE	Arginine--tRNA ligase, cytoplasmic OS=Mus musculus (Mouse) OX=10090 GN=Rars1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null	502-UNIMOD:4,369-UNIMOD:4	0.04	15.0	2	2	2
PRT	sp|Q9WUU7|CATZ_MOUSE	Cathepsin Z OS=Mus musculus (Mouse) OX=10090 GN=Ctsz PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.04	15.0	1	1	1
PRT	sp|P60843|IF4A1_MOUSE	Eukaryotic initiation factor 4A-I OS=Mus musculus (Mouse) OX=10090 GN=Eif4a1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.03	15.0	1	1	1
PRT	sp|Q9QZ88|VPS29_MOUSE	Vacuolar protein sorting-associated protein 29 OS=Mus musculus (Mouse) OX=10090 GN=Vps29 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null	36-UNIMOD:4,41-UNIMOD:4	0.08	15.0	1	1	1
PRT	sp|P82343|RENBP_MOUSE	N-acylglucosamine 2-epimerase OS=Mus musculus (Mouse) OX=10090 GN=Renbp PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.05	15.0	1	1	1
PRT	sp|Q9DBG3|AP2B1_MOUSE	AP-2 complex subunit beta OS=Mus musculus (Mouse) OX=10090 GN=Ap2b1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|Q9D939|ST1C2_MOUSE	Sulfotransferase 1C2 OS=Mus musculus (Mouse) OX=10090 GN=Sult1c2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.03	15.0	1	1	1
PRT	sp|Q6PDM2|SRSF1_MOUSE	Serine/arginine-rich splicing factor 1 OS=Mus musculus (Mouse) OX=10090 GN=Srsf1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.04	15.0	1	1	1
PRT	sp|P22599|A1AT2_MOUSE	Alpha-1-antitrypsin 1-2 OS=Mus musculus (Mouse) OX=10090 GN=Serpina1b PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.03	15.0	1	1	1
PRT	sp|P53026|RL10A_MOUSE	60S ribosomal protein L10a OS=Mus musculus (Mouse) OX=10090 GN=Rpl10a PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null	164-UNIMOD:4	0.06	15.0	1	1	1
PRT	sp|P50285|FMO1_MOUSE	Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Mus musculus (Mouse) OX=10090 GN=Fmo1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.02	15.0	1	1	1
PRT	tr|F6RWR5|F6RWR5_MOUSE	Glutathione S-transferase pi 3 OS=Mus musculus (Mouse) OX=10090 GN=Gstp3 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.06	15.0	1	1	1
PRT	tr|A0A2I3BRL8|A0A2I3BRL8_MOUSE	RRM domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Gm7324 PE=4 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.04	15.0	1	1	1
PRT	sp|P99027|RLA2_MOUSE	60S acidic ribosomal protein P2 OS=Mus musculus (Mouse) OX=10090 GN=Rplp2 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.15	15.0	1	1	1
PRT	sp|O09164|SODE_MOUSE	Extracellular superoxide dismutase [Cu-Zn] OS=Mus musculus (Mouse) OX=10090 GN=Sod3 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.07	15.0	1	1	1
PRT	sp|Q9Z1G3|VATC1_MOUSE	V-type proton ATPase subunit C 1 OS=Mus musculus (Mouse) OX=10090 GN=Atp6v1c1 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.11	15.0	3	3	3
PRT	sp|Q3U1J4|DDB1_MOUSE	DNA damage-binding protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Ddb1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1000663, ProteinPilot, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|Q01768|NDKB_MOUSE	Nucleoside diphosphate kinase B OS=Mus musculus (Mouse) OX=10090 GN=Nme2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.07	15.0	1	1	1
PRT	sp|P48758|CBR1_MOUSE	Carbonyl reductase [NADPH] 1 OS=Mus musculus (Mouse) OX=10090 GN=Cbr1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	15.0	null	2-UNIMOD:1	0.10	15.0	2	2	2
PRT	sp|O70433|FHL2_MOUSE	Four and a half LIM domains protein 2 OS=Mus musculus (Mouse) OX=10090 GN=Fhl2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null	272-UNIMOD:4,275-UNIMOD:4	0.06	15.0	1	1	1
PRT	sp|O35226|PSMD4_MOUSE	26S proteasome non-ATPase regulatory subunit 4 OS=Mus musculus (Mouse) OX=10090 GN=Psmd4 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.04	15.0	1	1	1
PRT	sp|P46460|NSF_MOUSE	Vesicle-fusing ATPase OS=Mus musculus (Mouse) OX=10090 GN=Nsf PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null	599-UNIMOD:4	0.02	15.0	1	1	1
PRT	sp|O55125|NIPS1_MOUSE	Protein NipSnap homolog 1 OS=Mus musculus (Mouse) OX=10090 GN=Nipsnap1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null	83-UNIMOD:4	0.14	15.0	2	2	2
PRT	sp|P62911|RL32_MOUSE	60S ribosomal protein L32 OS=Mus musculus (Mouse) OX=10090 GN=Rpl32 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null	91-UNIMOD:4	0.08	15.0	1	1	1
PRT	sp|Q9D8E6|RL4_MOUSE	60S ribosomal protein L4 OS=Mus musculus (Mouse) OX=10090 GN=Rpl4 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.03	15.0	1	1	1
PRT	sp|Q9JHK4|PGTA_MOUSE	Geranylgeranyl transferase type-2 subunit alpha OS=Mus musculus (Mouse) OX=10090 GN=Rabggta PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null	99-UNIMOD:4	0.02	15.0	1	1	1
PRT	sp|Q9WUL7|ARL3_MOUSE	ADP-ribosylation factor-like protein 3 OS=Mus musculus (Mouse) OX=10090 GN=Arl3 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.10	15.0	1	1	1
PRT	sp|P97461|RS5_MOUSE	40S ribosomal protein S5 OS=Mus musculus (Mouse) OX=10090 GN=Rps5 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null	155-UNIMOD:4	0.07	15.0	2	1	0
PRT	sp|Q6ZWV3|RL10_MOUSE	60S ribosomal protein L10 OS=Mus musculus (Mouse) OX=10090 GN=Rpl10 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.07	15.0	1	1	1
PRT	sp|P53994|RAB2A_MOUSE	Ras-related protein Rab-2A OS=Mus musculus (Mouse) OX=10090 GN=Rab2a PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.07	15.0	1	1	1
PRT	sp|Q6PIC6|AT1A3_MOUSE	Sodium/potassium-transporting ATPase subunit alpha-3 OS=Mus musculus (Mouse) OX=10090 GN=Atp1a3 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.02	15.0	1	1	1
PRT	sp|O55222|ILK_MOUSE	Integrin-linked protein kinase OS=Mus musculus (Mouse) OX=10090 GN=Ilk PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.02	15.0	1	1	1
PRT	sp|Q8R519|ACMSD_MOUSE	2-amino-3-carboxymuconate-6-semialdehyde decarboxylase OS=Mus musculus (Mouse) OX=10090 GN=Acmsd PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.04	15.0	1	1	1
PRT	sp|Q9CWJ9|PUR9_MOUSE	Bifunctional purine biosynthesis protein PURH OS=Mus musculus (Mouse) OX=10090 GN=Atic PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null	101-UNIMOD:4	0.05	15.0	2	2	2
PRT	sp|Q06890|CLUS_MOUSE	Clusterin OS=Mus musculus (Mouse) OX=10090 GN=Clu PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.04	15.0	1	1	1
PRT	sp|Q9DC61|MPPA_MOUSE	Mitochondrial-processing peptidase subunit alpha OS=Mus musculus (Mouse) OX=10090 GN=Pmpca PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.03	15.0	1	1	1
PRT	sp|P61027|RAB10_MOUSE	Ras-related protein Rab-10 OS=Mus musculus (Mouse) OX=10090 GN=Rab10 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.06	15.0	1	1	1
PRT	sp|P16381|DDX3L_MOUSE	Putative ATP-dependent RNA helicase Pl10 OS=Mus musculus (Mouse) OX=10090 GN=D1Pas1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.02	15.0	1	1	1
PRT	sp|Q9DBG6|RPN2_MOUSE	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Mus musculus (Mouse) OX=10090 GN=Rpn2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.02	15.0	1	1	1
PRT	sp|P12367|KAP2_MOUSE	cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Mus musculus (Mouse) OX=10090 GN=Prkar2a PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.03	15.0	1	1	1
PRT	sp|P63276|RS17_MOUSE	40S ribosomal protein S17 OS=Mus musculus (Mouse) OX=10090 GN=Rps17 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.17	15.0	1	1	1
PRT	sp|P17427|AP2A2_MOUSE	AP-2 complex subunit alpha-2 OS=Mus musculus (Mouse) OX=10090 GN=Ap2a2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.04	15.0	2	2	2
PRT	sp|Q8VE95|CH082_MOUSE	UPF0598 protein C8orf82 homolog OS=Mus musculus (Mouse) OX=10090 GN=MGI:1925941 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.08	15.0	1	1	1
PRT	sp|P17426|AP2A1_MOUSE	AP-2 complex subunit alpha-1 OS=Mus musculus (Mouse) OX=10090 GN=Ap2a1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.02	15.0	1	1	1
PRT	sp|Q99LT0|DPY30_MOUSE	Protein dpy-30 homolog OS=Mus musculus (Mouse) OX=10090 GN=Dpy30 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.21	15.0	1	1	1
PRT	sp|P58044|IDI1_MOUSE	Isopentenyl-diphosphate Delta-isomerase 1 OS=Mus musculus (Mouse) OX=10090 GN=Idi1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.09	15.0	1	1	1
PRT	sp|Q9DBT9|M2GD_MOUSE	Dimethylglycine dehydrogenase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Dmgdh PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.04	15.0	2	2	2
PRT	sp|Q8VDK1-2|NIT1-2_MOUSE	Isoform of Q8VDK1, Isoform 2 of Deaminated glutathione amidase OS=Mus musculus (Mouse) OX=10090 GN=Nit1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	null	248-UNIMOD:385,248-UNIMOD:4,255-UNIMOD:4	0.04	15.0	1	1	0
PRT	sp|P55264-2|ADK-2_MOUSE	Isoform of P55264, Isoform Short of Adenosine kinase OS=Mus musculus (Mouse) OX=10090 GN=Adk PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	null	2-UNIMOD:1	0.07	15.0	1	1	1
PRT	sp|Q9CZ42-2|NNRD-2_MOUSE	Isoform of Q9CZ42, Isoform 2 of ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Mus musculus (Mouse) OX=10090 GN=Naxd PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	null	1-UNIMOD:1	0.03	15.0	1	1	1
PRT	sp|Q501J6|DDX17_MOUSE	Probable ATP-dependent RNA helicase DDX17 OS=Mus musculus (Mouse) OX=10090 GN=Ddx17 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.02	15.0	2	1	0
PRT	sp|Q63844|MK03_MOUSE	Mitogen-activated protein kinase 3 OS=Mus musculus (Mouse) OX=10090 GN=Mapk3 PE=1 SV=5	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null	179-UNIMOD:4	0.04	15.0	1	1	1
PRT	sp|P62897|CYC_MOUSE	Cytochrome c, somatic OS=Mus musculus (Mouse) OX=10090 GN=Cycs PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.21	15.0	2	2	2
PRT	sp|Q6ZWU9|RS27_MOUSE	40S ribosomal protein S27 OS=Mus musculus (Mouse) OX=10090 GN=Rps27 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.14	15.0	1	1	1
PRT	sp|P70372|ELAV1_MOUSE	ELAV-like protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Elavl1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.04	15.0	1	1	1
PRT	sp|P16045|LEG1_MOUSE	Galectin-1 OS=Mus musculus (Mouse) OX=10090 GN=Lgals1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	null	2-UNIMOD:1,3-UNIMOD:4,17-UNIMOD:4	0.14	15.0	1	1	1
PRT	sp|Q99L60|VATC2_MOUSE	V-type proton ATPase subunit C 2 OS=Mus musculus (Mouse) OX=10090 GN=Atp6v1c2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	null	2-UNIMOD:1	0.03	15.0	1	1	1
PRT	sp|O70250|PGAM2_MOUSE	Phosphoglycerate mutase 2 OS=Mus musculus (Mouse) OX=10090 GN=Pgam2 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null	153-UNIMOD:4	0.07	15.0	1	1	1
PRT	sp|Q9WUK2|IF4H_MOUSE	Eukaryotic translation initiation factor 4H OS=Mus musculus (Mouse) OX=10090 GN=Eif4h PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.06	15.0	1	1	1
PRT	sp|E9Q9A9|OAS2_MOUSE	2'-5'-oligoadenylate synthase 2 OS=Mus musculus (Mouse) OX=10090 GN=Oas2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	null	413-UNIMOD:4	0.02	15.0	1	1	1
PRT	sp|B9EKR1|PTPRZ_MOUSE	Receptor-type tyrosine-protein phosphatase zeta OS=Mus musculus (Mouse) OX=10090 GN=Ptprz1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|Q9CQ40|RM49_MOUSE	39S ribosomal protein L49, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Mrpl49 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	null	1-UNIMOD:1,1-UNIMOD:35	0.09	15.0	1	1	1
PRT	sp|Q402B2|WDR93_MOUSE	WD repeat-containing protein 93 OS=Mus musculus (Mouse) OX=10090 GN=Wdr93 PE=2 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	null	638-UNIMOD:4,643-UNIMOD:35,650-UNIMOD:35	0.03	15.0	1	1	1
PRT	sp|Q9JIB0|MOG1_MOUSE	Ran guanine nucleotide release factor OS=Mus musculus (Mouse) OX=10090 GN=Rangrf PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	null		0.07	15.0	1	1	1
PRT	sp|Q8BX02|KANK2_MOUSE	KN motif and ankyrin repeat domain-containing protein 2 OS=Mus musculus (Mouse) OX=10090 GN=Kank2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|Q99NB9|SF3B1_MOUSE	Splicing factor 3B subunit 1 OS=Mus musculus (Mouse) OX=10090 GN=Sf3b1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null	867-UNIMOD:35	0.01	15.0	1	1	1
PRT	sp|Q69Z23|DYH17_MOUSE	Dynein heavy chain 17, axonemal OS=Mus musculus (Mouse) OX=10090 GN=Dnah17 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.00	15.0	1	1	1
PRT	sp|P60954|NOL4_MOUSE	Nucleolar protein 4 OS=Mus musculus (Mouse) OX=10090 GN=Nol4 PE=2 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.02	15.0	1	1	1
PRT	sp|Q8BTT6|DIEXF_MOUSE	Digestive organ expansion factor homolog OS=Mus musculus (Mouse) OX=10090 GN=Diexf PE=2 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|Q61879|MYH10_MOUSE	Myosin-10 OS=Mus musculus (Mouse) OX=10090 GN=Myh10 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|Q8BGZ8|ZPLD1_MOUSE	Zona pellucida-like domain-containing protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Zpld1 PE=2 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null	235-UNIMOD:4,255-UNIMOD:4	0.07	15.0	1	1	1
PRT	sp|P35487|ODPAT_MOUSE	Pyruvate dehydrogenase E1 component subunit alpha, testis-specific form, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Pdha2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null	283-UNIMOD:35	0.03	15.0	1	1	1
PRT	sp|Q9CR00|PSMD9_MOUSE	26S proteasome non-ATPase regulatory subunit 9 OS=Mus musculus (Mouse) OX=10090 GN=Psmd9 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null	215-UNIMOD:4	0.06	15.0	1	1	1
PRT	sp|Q922F4|TBB6_MOUSE	Tubulin beta-6 chain OS=Mus musculus (Mouse) OX=10090 GN=Tubb6 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.04	15.0	1	1	1
PRT	sp|O55029|COPB2_MOUSE	Coatomer subunit beta' OS=Mus musculus (Mouse) OX=10090 GN=Copb2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null	56-UNIMOD:4	0.02	14.0	2	2	2
PRT	sp|Q9CQM9|GLRX3_MOUSE	Glutaredoxin-3 OS=Mus musculus (Mouse) OX=10090 GN=Glrx3 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.04	14.0	1	1	1
PRT	sp|Q99PL5|RRBP1_MOUSE	Ribosome-binding protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Rrbp1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.01	14.0	1	1	1
PRT	sp|Q9ES97|RTN3_MOUSE	Reticulon-3 OS=Mus musculus (Mouse) OX=10090 GN=Rtn3 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.01	14.0	1	1	1
PRT	sp|Q8BIJ6|SYIM_MOUSE	Isoleucine--tRNA ligase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Iars2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	14.0	null	91-UNIMOD:385,91-UNIMOD:4	0.02	14.0	2	2	2
PRT	sp|P63254|CRIP1_MOUSE	Cysteine-rich protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Crip1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.10	14.0	1	1	1
PRT	sp|P62301|RS13_MOUSE	40S ribosomal protein S13 OS=Mus musculus (Mouse) OX=10090 GN=Rps13 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.07	14.0	1	1	1
PRT	sp|P00375|DYR_MOUSE	Dihydrofolate reductase OS=Mus musculus (Mouse) OX=10090 GN=Dhfr PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.06	14.0	1	1	1
PRT	sp|P14094|AT1B1_MOUSE	Sodium/potassium-transporting ATPase subunit beta-1 OS=Mus musculus (Mouse) OX=10090 GN=Atp1b1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.04	14.0	1	1	1
PRT	sp|P61957|SUMO2_MOUSE	Small ubiquitin-related modifier 2 OS=Mus musculus (Mouse) OX=10090 GN=Sumo2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.14	14.0	1	1	1
PRT	sp|P60764|RAC3_MOUSE	Ras-related C3 botulinum toxin substrate 3 OS=Mus musculus (Mouse) OX=10090 GN=Rac3 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null	157-UNIMOD:4	0.06	14.0	1	1	1
PRT	sp|P51150|RAB7A_MOUSE	Ras-related protein Rab-7a OS=Mus musculus (Mouse) OX=10090 GN=Rab7a PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.14	14.0	2	2	2
PRT	sp|P27600|GNA12_MOUSE	Guanine nucleotide-binding protein subunit alpha-12 OS=Mus musculus (Mouse) OX=10090 GN=Gna12 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.03	14.0	1	1	1
PRT	sp|P11679|K2C8_MOUSE	Keratin, type II cytoskeletal 8 OS=Mus musculus (Mouse) OX=10090 GN=Krt8 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.02	14.0	1	1	1
PRT	sp|Q3ULD5|MCCB_MOUSE	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Mccc2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.02	14.0	1	1	1
PRT	sp|Q9ESE1|LRBA_MOUSE	Lipopolysaccharide-responsive and beige-like anchor protein OS=Mus musculus (Mouse) OX=10090 GN=Lrba PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.00	14.0	1	1	1
PRT	sp|Q99JY9|ARP3_MOUSE	Actin-related protein 3 OS=Mus musculus (Mouse) OX=10090 GN=Actr3 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null	408-UNIMOD:4	0.03	14.0	1	1	1
PRT	sp|Q8CI51|PDLI5_MOUSE	PDZ and LIM domain protein 5 OS=Mus musculus (Mouse) OX=10090 GN=Pdlim5 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null	462-UNIMOD:4,465-UNIMOD:4	0.02	14.0	1	1	1
PRT	sp|P60335|PCBP1_MOUSE	Poly(rC)-binding protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Pcbp1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null	109-UNIMOD:4,158-UNIMOD:4	0.09	14.0	2	2	2
PRT	sp|Q9D8W5|PSD12_MOUSE	26S proteasome non-ATPase regulatory subunit 12 OS=Mus musculus (Mouse) OX=10090 GN=Psmd12 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.02	14.0	1	1	1
PRT	sp|Q3TC72|FAHD2_MOUSE	Fumarylacetoacetate hydrolase domain-containing protein 2A OS=Mus musculus (Mouse) OX=10090 GN=Fahd2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.04	14.0	1	1	1
PRT	tr|E9PX29|E9PX29_MOUSE	Spectrin beta chain OS=Mus musculus (Mouse) OX=10090 GN=Sptbn4 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.00	14.0	1	1	1
PRT	sp|Q8BFY9|TNPO1_MOUSE	Transportin-1 OS=Mus musculus (Mouse) OX=10090 GN=Tnpo1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.01	14.0	1	1	1
PRT	sp|Q8BTY1|KAT1_MOUSE	Kynurenine--oxoglutarate transaminase 1 OS=Mus musculus (Mouse) OX=10090 GN=Kyat1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.03	14.0	1	1	1
PRT	sp|Q9CQX8|RT36_MOUSE	28S ribosomal protein S36, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Mrps36 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.22	14.0	1	1	1
PRT	sp|Q9WUM3|COR1B_MOUSE	Coronin-1B OS=Mus musculus (Mouse) OX=10090 GN=Coro1b PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null	41-UNIMOD:4	0.03	14.0	1	1	1
PRT	tr|E9PV38|E9PV38_MOUSE	Carboxylic ester hydrolase OS=Mus musculus (Mouse) OX=10090 GN=Ces2g PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.03	14.0	1	1	1
PRT	sp|Q8BKZ9|ODPX_MOUSE	Pyruvate dehydrogenase protein X component, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Pdhx PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.02	14.0	1	1	1
PRT	sp|P61211|ARL1_MOUSE	ADP-ribosylation factor-like protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Arl1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.07	14.0	1	1	1
PRT	sp|Q14DH7|ACSS3_MOUSE	Acyl-CoA synthetase short-chain family member 3, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Acss3 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.03	14.0	1	1	1
PRT	sp|Q8R016|BLMH_MOUSE	Bleomycin hydrolase OS=Mus musculus (Mouse) OX=10090 GN=Blmh PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.03	14.0	1	1	1
PRT	sp|Q78ZA7|NP1L4_MOUSE	Nucleosome assembly protein 1-like 4 OS=Mus musculus (Mouse) OX=10090 GN=Nap1l4 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.03	14.0	1	1	1
PRT	sp|P29387|GBB4_MOUSE	Guanine nucleotide-binding protein subunit beta-4 OS=Mus musculus (Mouse) OX=10090 GN=Gnb4 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.04	14.0	1	1	1
PRT	sp|P11862|GAS2_MOUSE	Growth arrest-specific protein 2 OS=Mus musculus (Mouse) OX=10090 GN=Gas2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null	121-UNIMOD:4	0.04	14.0	1	1	1
PRT	sp|Q9JLZ3|AUHM_MOUSE	Methylglutaconyl-CoA hydratase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Auh PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null	113-UNIMOD:4	0.05	14.0	1	1	1
PRT	sp|Q9R1P3|PSB2_MOUSE	Proteasome subunit beta type-2 OS=Mus musculus (Mouse) OX=10090 GN=Psmb2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.07	14.0	1	1	1
PRT	sp|P40336|VP26A_MOUSE	Vacuolar protein sorting-associated protein 26A OS=Mus musculus (Mouse) OX=10090 GN=Vps26a PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.04	14.0	1	1	1
PRT	sp|Q99KK7|DPP3_MOUSE	Dipeptidyl peptidase 3 OS=Mus musculus (Mouse) OX=10090 GN=Dpp3 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.03	14.0	1	1	1
PRT	sp|Q8VCM7|FIBG_MOUSE	Fibrinogen gamma chain OS=Mus musculus (Mouse) OX=10090 GN=Fgg PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.05	14.0	1	1	1
PRT	sp|P14685|PSMD3_MOUSE	26S proteasome non-ATPase regulatory subunit 3 OS=Mus musculus (Mouse) OX=10090 GN=Psmd3 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.03	14.0	1	1	1
PRT	sp|Q9EPU0|RENT1_MOUSE	Regulator of nonsense transcripts 1 OS=Mus musculus (Mouse) OX=10090 GN=Upf1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.01	14.0	1	1	1
PRT	sp|Q61792|LASP1_MOUSE	LIM and SH3 domain protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Lasp1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.06	14.0	1	1	1
PRT	sp|Q9DAS9|GBG12_MOUSE	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12 OS=Mus musculus (Mouse) OX=10090 GN=Gng12 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.24	14.0	1	1	1
PRT	sp|Q8BHB9|CLIC6_MOUSE	Chloride intracellular channel protein 6 OS=Mus musculus (Mouse) OX=10090 GN=Clic6 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null	533-UNIMOD:4	0.03	14.0	1	1	1
PRT	sp|Q61081|CDC37_MOUSE	Hsp90 co-chaperone Cdc37 OS=Mus musculus (Mouse) OX=10090 GN=Cdc37 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.06	14.0	1	1	1
PRT	sp|Q9D892|ITPA_MOUSE	Inosine triphosphate pyrophosphatase OS=Mus musculus (Mouse) OX=10090 GN=Itpa PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null	33-UNIMOD:4	0.11	14.0	1	1	1
PRT	sp|Q3TMH2|SCRN3_MOUSE	Secernin-3 OS=Mus musculus (Mouse) OX=10090 GN=Scrn3 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.03	14.0	1	1	1
PRT	sp|Q571I9|A16A1_MOUSE	Aldehyde dehydrogenase family 16 member A1 OS=Mus musculus (Mouse) OX=10090 GN=Aldh16a1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.02	14.0	1	1	1
PRT	sp|O88986|KBL_MOUSE	2-amino-3-ketobutyrate coenzyme A ligase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Gcat PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.04	14.0	2	1	0
PRT	sp|P23116|EIF3A_MOUSE	Eukaryotic translation initiation factor 3 subunit A OS=Mus musculus (Mouse) OX=10090 GN=Eif3a PE=1 SV=5	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.01	14.0	1	1	1
PRT	sp|Q8VDQ1|PTGR2_MOUSE	Prostaglandin reductase 2 OS=Mus musculus (Mouse) OX=10090 GN=Ptgr2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.04	14.0	1	1	1
PRT	sp|Q3UPH1|PRRC1_MOUSE	Protein PRRC1 OS=Mus musculus (Mouse) OX=10090 GN=Prrc1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.04	14.0	1	1	1
PRT	sp|Q9QYJ0|DNJA2_MOUSE	DnaJ homolog subfamily A member 2 OS=Mus musculus (Mouse) OX=10090 GN=Dnaja2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.06	14.0	1	1	1
PRT	sp|A2AUU0-5|METL8-5_MOUSE	Isoform of A2AUU0, Isoform 5 of mRNA N(3)-methylcytidine methyltransferase METTL8 OS=Mus musculus (Mouse) OX=10090 GN=Mettl8 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.04	14.0	1	1	1
PRT	sp|Q3TXS7|PSMD1_MOUSE	26S proteasome non-ATPase regulatory subunit 1 OS=Mus musculus (Mouse) OX=10090 GN=Psmd1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.02	14.0	1	1	1
PRT	sp|Q9DCT8|CRIP2_MOUSE	Cysteine-rich protein 2 OS=Mus musculus (Mouse) OX=10090 GN=Crip2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null	57-UNIMOD:4	0.05	14.0	1	1	1
PRT	tr|E9PVU0|E9PVU0_MOUSE	Isoform of Q64331, Unconventional myosin-VI OS=Mus musculus (Mouse) OX=10090 GN=Myo6 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	null	1229-UNIMOD:28	0.01	14.0	1	1	1
PRT	sp|P14824|ANXA6_MOUSE	Annexin A6 OS=Mus musculus (Mouse) OX=10090 GN=Anxa6 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	null	114-UNIMOD:385,114-UNIMOD:4	0.01	14.0	1	1	1
PRT	sp|Q99L04|DHRS1_MOUSE	Dehydrogenase/reductase SDR family member 1 OS=Mus musculus (Mouse) OX=10090 GN=Dhrs1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	null	235-UNIMOD:385,235-UNIMOD:4	0.06	14.0	1	1	1
PRT	sp|O55135|IF6_MOUSE	Eukaryotic translation initiation factor 6 OS=Mus musculus (Mouse) OX=10090 GN=Eif6 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.10	14.0	1	1	1
PRT	sp|Q8BWY3|ERF1_MOUSE	Eukaryotic peptide chain release factor subunit 1 OS=Mus musculus (Mouse) OX=10090 GN=Etf1 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.03	14.0	1	1	1
PRT	sp|Q9ESL0|SCO2B_MOUSE	Succinyl-CoA:3-ketoacid coenzyme A transferase 2B, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Oxct2b PE=2 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	null	367-UNIMOD:28,376-UNIMOD:4	0.04	14.0	1	1	1
PRT	sp|O88543|CSN3_MOUSE	COP9 signalosome complex subunit 3 OS=Mus musculus (Mouse) OX=10090 GN=Cops3 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	null	2-UNIMOD:1	0.03	14.0	1	1	1
PRT	sp|P56959|FUS_MOUSE	RNA-binding protein FUS OS=Mus musculus (Mouse) OX=10090 GN=Fus PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.03	14.0	1	1	1
PRT	sp|Q9D531|NXNL2_MOUSE	Nucleoredoxin-like protein 2 OS=Mus musculus (Mouse) OX=10090 GN=Nxnl2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	null	1-UNIMOD:1,1-UNIMOD:35	0.06	14.0	1	1	1
PRT	tr|E0CYI9|E0CYI9_MOUSE	Isoform of Q8CHG3, GRIP domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Gcc2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	null	3-UNIMOD:1	0.01	14.0	1	1	1
PRT	sp|Q80Z37|TOPRS_MOUSE	E3 ubiquitin-protein ligase Topors OS=Mus musculus (Mouse) OX=10090 GN=Topors PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	null		0.01	14.0	1	1	1
PRT	sp|Q8R4X3|RBM12_MOUSE	RNA-binding protein 12 OS=Mus musculus (Mouse) OX=10090 GN=Rbm12 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.01	14.0	1	1	1
PRT	sp|Q06335|APLP2_MOUSE	Amyloid-like protein 2 OS=Mus musculus (Mouse) OX=10090 GN=Aplp2 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.01	14.0	1	1	1
PRT	sp|Q8C9J3|SPEF2_MOUSE	Sperm flagellar protein 2 OS=Mus musculus (Mouse) OX=10090 GN=Spef2 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	null		0.01	14.0	1	1	1
PRT	sp|P97458|PROP1_MOUSE	Homeobox protein prophet of Pit-1 OS=Mus musculus (Mouse) OX=10090 GN=Prop1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	null		0.06	14.0	1	1	1
PRT	tr|G3UWV2|G3UWV2_MOUSE	Isoform of Q9ESZ8, General transcription factor II-I (Fragment) OS=Mus musculus (Mouse) OX=10090 GN=Gtf2i PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	null		0.16	14.0	1	1	1
PRT	sp|Q9WUZ9|ENTP5_MOUSE	Ectonucleoside triphosphate diphosphohydrolase 5 OS=Mus musculus (Mouse) OX=10090 GN=Entpd5 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.02	14.0	1	1	1
PRT	sp|A2AG50|MA7D2_MOUSE	MAP7 domain-containing protein 2 OS=Mus musculus (Mouse) OX=10090 GN=Map7d2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.01	14.0	1	1	1
PRT	sp|Q8K327|CHAP1_MOUSE	Chromosome alignment-maintaining phosphoprotein 1 OS=Mus musculus (Mouse) OX=10090 GN=Champ1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.01	14.0	1	1	1
PRT	sp|Q8BG32|PSD11_MOUSE	26S proteasome non-ATPase regulatory subunit 11 OS=Mus musculus (Mouse) OX=10090 GN=Psmd11 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null	202-UNIMOD:4	0.03	14.0	1	1	1
PRT	sp|A0A087WPF7|AUTS2_MOUSE	Autism susceptibility gene 2 protein homolog OS=Mus musculus (Mouse) OX=10090 GN=Auts2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.01	14.0	1	1	1
PRT	tr|Q8VFQ1|Q8VFQ1_MOUSE	Olfactory receptor OS=Mus musculus (Mouse) OX=10090 GN=Olfr123 PE=2 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.03	14.0	1	1	1
PRT	tr|Q8BTS3|Q8BTS3_MOUSE	GB1/RHD3-type G domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Gbp9 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.02	14.0	1	1	1
PRT	tr|Q9WV19|Q9WV19_MOUSE	Cytochrome P450, family 2, subfamily g, polypeptide 1 OS=Mus musculus (Mouse) OX=10090 GN=Cyp2g1 PE=2 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null	447-UNIMOD:35	0.03	14.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	LLSHCLLVTLASHHPADFTPAVHASLDK	1	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	54	5-UNIMOD:4	ms_run[1]:scan=1.1.3012.2	49.09523	6	3049.584741	3049.580761	K	F	101	129
PSM	LLSHCLLVTLASHHPADFTPAVHASLDK	2	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	54	5-UNIMOD:4	ms_run[1]:scan=1.1.3012.4	49.09858	5	3049.586118	3049.580761	K	F	101	129
PSM	VADALANAAGHLDDLPGALSALSDLHAHK	3	tr|Q91VB8|Q91VB8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	52		ms_run[1]:scan=1.1.3434.2	60.92408	5	2862.464118	2862.462420	K	L	63	92
PSM	AHCLSEVEHDTMPADLPAIAADFVEDQEVCK	4	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	51	3-UNIMOD:4,30-UNIMOD:4	ms_run[1]:scan=1.1.3583.7	65.12943	4	3496.576894	3496.558507	K	N	311	342
PSM	IGPSEVENALMEHPAVSETAVISSPDPSRGEVVK	5	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	49		ms_run[1]:scan=1.1.3162.16	53.32817	4	3530.756894	3530.756278	R	A	474	508
PSM	LLSHCLLVTLASHHPADFTPAVHASLDK	6	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	48	5-UNIMOD:4	ms_run[1]:scan=1.1.3019.6	49.29012	5	3049.586118	3049.580761	K	F	101	129
PSM	YFDSFGDLSSASAIMGNAK	7	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	48		ms_run[1]:scan=1.1.3502.14	62.84042	2	1979.896247	1979.893493	R	V	42	61
PSM	NDANPETHAFVTSPEIVTALAIAGTLK	8	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	48		ms_run[1]:scan=1.1.3769.18	70.3928	3	2779.444271	2779.439225	R	F	480	507
PSM	YFDSFGDLSSASAIMGNAK	9	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	47		ms_run[1]:scan=1.1.3502.13	62.83875	2	1979.896247	1979.893493	R	V	42	61
PSM	KVITAFNDGLNHLDSLK	10	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	46		ms_run[1]:scan=1.1.2749.8	41.72017	3	1884.008471	1884.010512	K	G	67	84
PSM	AGAPPGLFNVVQGGAATGQFLCHHR	11	sp|Q9JLJ2|AL9A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	46	22-UNIMOD:4	ms_run[1]:scan=1.1.3070.13	50.7282	4	2561.265694	2561.270995	K	E	199	224
PSM	VAVLGASGGIGQPLSLLLK	12	sp|P08249|MDHM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	46		ms_run[1]:scan=1.1.3742.16	69.62005	2	1792.081847	1792.082221	K	N	27	46
PSM	RVIISAPSADAPMFVMGVNHEK	13	tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	45		ms_run[1]:scan=1.1.2912.6	46.31635	4	2368.204494	2368.203157	K	Y	116	138
PSM	KPLVIIAEDVDGEALSTLVLNR	14	sp|P63038|CH60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	45		ms_run[1]:scan=1.1.3636.8	66.64518	3	2364.321071	2364.326427	R	L	269	291
PSM	VAVLGASGGIGQPLSLLLK	15	sp|P08249|MDHM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	45		ms_run[1]:scan=1.1.3740.14	69.56351	2	1792.081847	1792.082221	K	N	27	46
PSM	VGDPAEDFGTFFSAVIDAK	16	sp|Q8CHT0|AL4A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	45		ms_run[1]:scan=1.1.3857.11	72.85715	2	1984.941647	1984.941824	K	A	376	395
PSM	LCYVALDFEQEMATAASSSSLEK	17	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	45	2-UNIMOD:4	ms_run[1]:scan=1.1.3720.10	69.00507	3	2549.165771	2549.166557	K	S	216	239
PSM	VAPEEHPVLLTEAPLNPK	18	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	44		ms_run[1]:scan=1.1.2746.15	41.64478	3	1953.063971	1953.057128	R	A	96	114
PSM	VAPEEHPVLLTEAPLNPK	19	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	44		ms_run[1]:scan=1.1.2750.9	41.75473	3	1953.063971	1953.057128	R	A	96	114
PSM	IYELAAGGTAVGTGLNTR	20	sp|P97807|FUMH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	44		ms_run[1]:scan=1.1.2850.21	44.57818	2	1762.914247	1762.921363	R	I	266	284
PSM	IADQCPSSLAIQENANALAR	21	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	44	5-UNIMOD:4	ms_run[1]:scan=1.1.2857.15	44.77393	3	2141.051171	2141.053516	R	Y	154	174
PSM	YFDSFGDLSSASAIMGNAK	22	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	44		ms_run[1]:scan=1.1.3509.18	63.0312	2	1979.896247	1979.893493	R	V	42	61
PSM	TALLDAAGVASLLTTAEAVVTEIPK	23	sp|P63038|CH60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	44		ms_run[1]:scan=1.1.4071.2	77.08822	3	2453.366171	2453.362872	R	E	527	552
PSM	VIVVGNPANTNCLTASK	24	sp|P14152|MDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	43	12-UNIMOD:4	ms_run[1]:scan=1.1.2626.21	38.28853	2	1756.910247	1756.914169	K	S	126	143
PSM	LVQDVANNTNEEAGDGTTTATVLAR	25	sp|P63038|CH60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	43		ms_run[1]:scan=1.1.2708.21	40.58022	3	2559.236171	2559.241253	K	S	97	122
PSM	DATNVGDEGGFAPNILENK	26	sp|P17182|ENOA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	43		ms_run[1]:scan=1.1.3143.21	52.79363	2	1959.914847	1959.917400	K	E	203	222
PSM	GIHVEIPGAQAESLGPLQVAR	27	sp|Q9DCW4|ETFB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	43		ms_run[1]:scan=1.1.3137.9	52.6115	3	2141.154371	2141.159302	R	V	86	107
PSM	LLSHCLLVTLASHHPADFTPAVHASLDK	28	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	43	5-UNIMOD:4	ms_run[1]:scan=1.1.3018.3	49.26153	5	3049.586118	3049.580761	K	F	101	129
PSM	SPTGLTLGSLVDEIQR	29	sp|Q9DBM2|ECHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	43		ms_run[1]:scan=1.1.3489.20	62.46786	2	1684.894047	1684.899565	K	Y	68	84
PSM	VIHDNFGIVEGLMTTVHAITATQK	30	tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	43		ms_run[1]:scan=1.1.3719.3	68.9712	4	2594.355294	2594.352658	K	T	161	185
PSM	VIHDNFGIVEGLMTTVHAITATQK	31	tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	43		ms_run[1]:scan=1.1.3726.2	69.15857	4	2594.355294	2594.352658	K	T	161	185
PSM	ATDLLLDDSLVSLFGNR	32	sp|P99029|PRDX5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	43		ms_run[1]:scan=1.1.3829.6	72.05807	2	1847.963047	1847.962893	K	R	156	173
PSM	IPENVSLQDAAVLPVSYGTAILAVDHR	33	sp|Q3UNZ8|QORL2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	43		ms_run[1]:scan=1.1.3713.21	68.81696	3	2847.515171	2847.513058	R	A	132	159
PSM	DDDIAALVVDNGSGMCK	34	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	43	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=1.1.3678.11	67.82943	2	1820.7933	1820.7915	M	A	2	19
PSM	APAAIGPYSQAVQVDR	35	sp|P52760|RIDA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	42		ms_run[1]:scan=1.1.2664.20	39.34647	2	1641.842047	1641.847470	K	T	14	30
PSM	FLHDPSATQGFVGCALSSNIQR	36	sp|P17563|SBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	42	14-UNIMOD:4	ms_run[1]:scan=1.1.2981.18	48.25483	3	2404.152671	2404.159378	R	F	255	277
PSM	FAAEHTIFASNTSSLQITNIANATTR	37	sp|Q61425|HCDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	42		ms_run[1]:scan=1.1.3179.20	53.8028	3	2778.391571	2778.393672	K	Q	137	163
PSM	AHCLSEVEHDTMPADLPAIAADFVEDQEVCK	38	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	42	3-UNIMOD:4,12-UNIMOD:35,30-UNIMOD:4	ms_run[1]:scan=1.1.3441.9	61.1236	4	3512.567294	3512.553422	K	N	311	342
PSM	HEIIQTLQMTDGLIPLEIR	39	sp|P17563|SBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	42		ms_run[1]:scan=1.1.3600.10	65.59769	3	2219.200871	2219.198389	R	F	236	255
PSM	AIVAGDEVAQEVDAVAPDCSFLK	40	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	42	19-UNIMOD:4	ms_run[1]:scan=1.1.3507.8	62.96628	3	2403.165971	2403.162792	R	I	156	179
PSM	VAVLGASGGIGQPLSLLLK	41	sp|P08249|MDHM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	42		ms_run[1]:scan=1.1.3740.15	69.56435	2	1792.081847	1792.082221	K	N	27	46
PSM	DPEAPIFQVADYGIVADLFK	42	sp|Q99LC5|ETFA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	42		ms_run[1]:scan=1.1.3936.2	74.98325	3	2207.114471	2207.115037	K	V	302	322
PSM	EFVEEFIWPAVQSSALYEDR	43	sp|P16460|ASSY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	42		ms_run[1]:scan=1.1.3815.13	71.66838	3	2414.148371	2414.143043	K	Y	67	87
PSM	GQDLGDTTTLEDPSVITEILSAFQK	44	sp|Q99NB1|ACS2L_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	42		ms_run[1]:scan=1.1.3931.5	74.83798	3	2677.336871	2677.333422	R	Y	649	674
PSM	VNQIGSVTESIQACK	45	sp|P21550|ENOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	42	14-UNIMOD:4	ms_run[1]:scan=1.1.2607.20	37.76863	2	1632.808247	1632.814121	K	L	344	359
PSM	HIDCASVYGNETEIGEALK	46	sp|Q9JII6|AK1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	41	4-UNIMOD:4	ms_run[1]:scan=1.1.2778.19	42.537	3	2104.967771	2104.973535	R	E	43	62
PSM	AHIMPAEFSSCPLNSDEAVNK	47	sp|Q91V76|CK054_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	41	11-UNIMOD:4	ms_run[1]:scan=1.1.2727.14	41.11827	3	2316.042671	2316.051467	K	W	216	237
PSM	FNNFSLNLNTNHGHILVDYSK	48	sp|P06745|G6PI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	41		ms_run[1]:scan=1.1.2942.3	47.16587	4	2446.208494	2446.202957	R	N	37	58
PSM	KYTPEQVAMATVTALHR	49	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	41		ms_run[1]:scan=1.1.2894.15	45.81733	3	1914.999671	1914.998567	K	T	243	260
PSM	AMGAAQVVVTDLSASR	50	sp|Q64442|DHSO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	41		ms_run[1]:scan=1.1.2985.11	48.35828	2	1574.799847	1574.808641	K	L	194	210
PSM	SYELPDGQVITIGNER	51	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	41		ms_run[1]:scan=1.1.3185.21	53.96862	2	1789.882847	1789.884643	K	F	239	255
PSM	VADALANAAGHLDDLPGALSALSDLHAHK	52	tr|Q91VB8|Q91VB8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	41		ms_run[1]:scan=1.1.3441.2	61.11108	5	2862.464118	2862.462420	K	L	63	92
PSM	VAMQDATAQMAMLQFISSGLPK	53	sp|Q99KI0|ACON_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	41		ms_run[1]:scan=1.1.3841.7	72.3896	3	2337.155771	2337.153096	R	V	96	118
PSM	ASPAAGGVVIVGSGLIGR	54	sp|Q99KP3|CRYL1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	41	1-UNIMOD:1	ms_run[1]:scan=1.1.3646.14	66.92675	2	1621.9101	1621.9146	M	S	2	20
PSM	APSSSSVGISEWLDQK	55	sp|Q99LC5|ETFA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	40		ms_run[1]:scan=1.1.3073.19	50.81798	2	1689.813647	1689.820980	K	L	188	204
PSM	LGLDFPNLPYLIDGSHK	56	sp|P10649|GSTM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	40		ms_run[1]:scan=1.1.3643.2	66.83415	3	1897.996271	1897.993799	K	I	53	70
PSM	TIYISGQVGLDPSSGQLVPGGVVEEAK	57	sp|P52760|RIDA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	40		ms_run[1]:scan=1.1.3438.11	61.0438	3	2699.402771	2699.401777	R	Q	30	57
PSM	AHCLSEVEHDTMPADLPAIAADFVEDQEVCK	58	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	40	3-UNIMOD:4,30-UNIMOD:4	ms_run[1]:scan=1.1.3576.17	64.93974	4	3496.576894	3496.558507	K	N	311	342
PSM	PAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGK	59	sp|P34884|MIF_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	40	24-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.3437.6	61.01535	4	3725.810094	3725.800409	K	I	34	68
PSM	VLVCGAGPVGMVTLLVAK	60	sp|Q64442|DHSO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	40	4-UNIMOD:4	ms_run[1]:scan=1.1.3710.14	68.72659	2	1783.006247	1783.009984	K	A	176	194
PSM	GQETSTNPIASIFAWSR	61	sp|O88844|IDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	40		ms_run[1]:scan=1.1.3721.3	69.04018	2	1863.906647	1863.911526	K	G	322	339
PSM	ALMLQGVDLLADAVAVTMGPK	62	sp|P63038|CH60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	40		ms_run[1]:scan=1.1.3912.2	74.35088	3	2112.128771	2112.132284	R	G	38	59
PSM	YGGWVDQNSPVLLDEPVLGSMAK	63	sp|Q91WR5|AK1CL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	40		ms_run[1]:scan=1.1.3676.17	67.77007	3	2474.215571	2474.215162	R	K	224	247
PSM	LCYVALDFEQEMATAASSSSLEK	64	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	40	2-UNIMOD:4	ms_run[1]:scan=1.1.3727.8	69.19302	3	2549.165771	2549.166557	K	S	216	239
PSM	VIVVGNPANTNCLTASK	65	sp|P14152|MDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	39	12-UNIMOD:4	ms_run[1]:scan=1.1.2632.21	38.45585	2	1756.910247	1756.914169	K	S	126	143
PSM	VAPEEHPVLLTEAPLNPK	66	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	39		ms_run[1]:scan=1.1.2744.21	41.59495	2	1953.051047	1953.057128	R	A	96	114
PSM	AGESVLVHGASGGVGLATCQIAR	67	sp|P47199|QOR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	39	19-UNIMOD:4	ms_run[1]:scan=1.1.2730.18	41.20065	3	2209.118471	2209.127350	R	A	148	171
PSM	STEPCAHLLVSSIGVVGTAEQNR	68	sp|O35215|DOPD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	39	5-UNIMOD:4	ms_run[1]:scan=1.1.2999.19	48.74818	3	2424.204071	2424.206723	K	T	53	76
PSM	NETLGGTCLNVGCIPSK	69	sp|O08749|DLDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	39	8-UNIMOD:4,13-UNIMOD:4	ms_run[1]:scan=1.1.2831.21	44.04347	2	1818.855047	1818.860419	K	A	73	90
PSM	RPCFSALTVDETYVPK	70	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	39	3-UNIMOD:4	ms_run[1]:scan=1.1.2846.13	44.45844	3	1881.930071	1881.929485	R	E	509	525
PSM	KYTPEQVAMATVTALHR	71	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	39		ms_run[1]:scan=1.1.2900.16	45.9859	3	1914.999671	1914.998567	K	T	243	260
PSM	QIDDVLSVASVRPAVLQVECHPYLAQNELIAHCHAR	72	sp|Q9JII6|AK1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	39	20-UNIMOD:4,33-UNIMOD:4	ms_run[1]:scan=1.1.3205.12	54.5276	6	4108.101741	4108.073488	R	G	168	204
PSM	DTVLLEELGQASGLVLER	73	sp|Q9DCS2|MTL26_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	39		ms_run[1]:scan=1.1.3834.2	72.18808	3	1941.035771	1941.041872	R	M	171	189
PSM	VPPETIDSVIVGNVMQSSSDAAYLAR	74	sp|Q8BWT1|THIM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	39		ms_run[1]:scan=1.1.3729.15	69.25391	3	2718.352871	2718.353446	K	H	46	72
PSM	GAAQNIIPASTGAAK	75	tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=1.1.2284.14	28.82368	2	1368.727447	1368.736128	R	A	199	214
PSM	GILAADESVGTMGNR	76	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=1.1.2629.17	38.36907	2	1489.714247	1489.719492	K	L	29	44
PSM	NQVAMNPTNTVFDAK	77	sp|P63017|HSP7C_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=1.1.2682.19	39.85197	2	1648.781447	1648.787906	K	R	57	72
PSM	IYELAAGGTAVGTGLNTR	78	sp|P97807|FUMH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=1.1.2844.20	44.40827	2	1762.914247	1762.921363	R	I	266	284
PSM	VCLIGCGFSTGYGSAVK	79	sp|P00329|ADH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	38	2-UNIMOD:4,6-UNIMOD:4	ms_run[1]:scan=1.1.3009.14	49.02788	2	1774.830047	1774.838227	K	V	170	187
PSM	GIHVEIPGAQAESLGPLQVAR	80	sp|Q9DCW4|ETFB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=1.1.3143.11	52.78528	3	2141.154371	2141.159302	R	V	86	107
PSM	GPAVGIDLGTTYSCVGVFQHGK	81	sp|P63017|HSP7C_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	38	14-UNIMOD:4	ms_run[1]:scan=1.1.3114.18	51.96668	3	2262.100271	2262.110303	K	V	4	26
PSM	IPNIYAIGDVVAGPMLAHK	82	sp|O08749|DLDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=1.1.3523.6	63.41683	3	1978.070171	1978.071004	K	A	347	366
PSM	GQETSTNPIASIFAWSR	83	sp|O88844|IDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=1.1.3715.14	68.87083	2	1863.906647	1863.911526	K	G	322	339
PSM	TAFDEAIAELDTLSEESYK	84	sp|P63101|1433Z_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=1.1.3826.6	71.9688	3	2130.987671	2130.984476	K	D	194	213
PSM	ALNVEPDGTGLTCSLAPNILSQL	85	sp|P99029|PRDX5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	38	13-UNIMOD:4	ms_run[1]:scan=1.1.3870.4	73.20107	3	2382.210071	2382.210077	K	-	188	211
PSM	CCAEANPPACYGTVLAEFQPLVEEPK	86	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	38	1-UNIMOD:4,2-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.3706.20	68.62045	3	2949.339971	2949.334702	K	N	384	410
PSM	SFVQNYPVVSIEDPFDQDDWGAWQK	87	sp|P17182|ENOA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=1.1.3805.10	71.39972	3	2969.355971	2969.350804	K	F	282	307
PSM	AADISQWAGPLCLQEVDEPPQHALR	88	sp|P70296|PEBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	38	1-UNIMOD:1,12-UNIMOD:4	ms_run[1]:scan=1.1.3725.8	69.1475	3	2842.3735	2842.3703	M	V	2	27
PSM	LIQFHFHWGSSDGQGSEHTVNK	89	sp|P00920|CAH2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=1.1.2616.8	38.00229	4	2510.170494	2510.172720	R	K	90	112
PSM	APQVSTPTLVEAAR	90	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=1.1.2591.18	37.32225	2	1438.772247	1438.777993	K	N	439	453
PSM	LEGTNVQEAQNILK	91	sp|Q9Z2I8|SUCB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=1.1.2690.20	40.06827	2	1555.813247	1555.820586	R	S	394	408
PSM	ASAELALGENNEVLK	92	sp|P05202|AATM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=1.1.2730.19	41.20148	2	1556.796247	1556.804602	K	S	108	123
PSM	APAAIGPYSQAVQVDR	93	sp|P52760|RIDA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=1.1.2671.20	39.54137	2	1641.842047	1641.847470	K	T	14	30
PSM	KVITAFNDGLNHLDSLK	94	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=1.1.2756.15	41.91697	3	1884.008471	1884.010512	K	G	67	84
PSM	SGYQQAASEHGLVVIAPDTSPR	95	sp|Q9R0P3|ESTD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=1.1.2676.17	39.68177	3	2282.124971	2282.129124	K	G	65	87
PSM	ASGEPVVLSGQITGLTEGQHGFHVHQYGDNTQGCTSAGPHFNPHSK	96	sp|P08228|SODC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	37	34-UNIMOD:4	ms_run[1]:scan=1.1.2728.11	41.14708	7	4840.2722	4840.2432	K	K	25	71
PSM	LGPALATGNVVVMK	97	sp|P47738|ALDH2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=1.1.2879.18	45.40233	2	1368.773847	1368.779907	K	V	198	212
PSM	VPTPNVSVVDLTCR	98	sp|P16858|G3P_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	37	13-UNIMOD:4	ms_run[1]:scan=1.1.2969.17	47.92333	2	1555.798447	1555.802828	R	L	233	247
PSM	RPCFSALTVDETYVPK	99	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	37	3-UNIMOD:4	ms_run[1]:scan=1.1.2839.14	44.26517	3	1881.930071	1881.929485	R	E	509	525
PSM	WTTAPKPTMADELYDQNYPIHSVEDR	100	sp|Q9D964|GATM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=1.1.2950.16	47.38835	4	3076.428494	3076.423651	K	H	210	236
PSM	HVLSTFGPVPEFSGATVER	101	sp|Q99KP3|CRYL1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=1.1.3022.12	49.37265	3	2029.022171	2029.026891	K	V	261	280
PSM	GGNASNSCTVLSLLGAR	102	sp|P97328|KHK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	37	8-UNIMOD:4	ms_run[1]:scan=1.1.3188.17	54.04753	2	1675.824047	1675.831168	R	C	40	57
PSM	GLVYETSVLDPDEGIR	103	tr|Q80X68|Q80X68_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=1.1.3151.19	53.02335	2	1761.878047	1761.878495	K	F	77	93
PSM	LLSHCLLVTLASHHPADFTPAVHASLDK	104	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	37	5-UNIMOD:4	ms_run[1]:scan=1.1.3019.2	49.28343	6	3049.584741	3049.580761	K	F	101	129
PSM	AIVAGDEVAQEVDAVAPDCSFLK	105	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	37	19-UNIMOD:4	ms_run[1]:scan=1.1.3500.14	62.78107	3	2403.165971	2403.162792	R	I	156	179
PSM	ENTLNQLVGAAFGAAGQR	106	sp|Q9EQ20|MMSA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=1.1.3549.3	64.16225	3	1815.919871	1815.922760	K	C	299	317
PSM	DQSPASHEIATNLGDFAISLYR	107	sp|P07758|A1AT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=1.1.3573.8	64.84735	3	2404.170971	2404.165903	K	E	36	58
PSM	ADHQPLTEASYVNLPTIALCNTDSPLR	108	sp|P14206|RSSA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	37	20-UNIMOD:4	ms_run[1]:scan=1.1.3437.7	61.0187	3	2995.467071	2995.470936	R	Y	129	156
PSM	SLADELALVDVLEDK	109	sp|P16125|LDHB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=1.1.3801.13	71.28415	2	1628.849847	1628.850883	K	L	44	59
PSM	DLVSSLTSGLLTIGDR	110	sp|Q91V92|ACLY_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=1.1.3878.6	73.42993	2	1645.881647	1645.888666	K	F	909	925
PSM	IGVAIGDQILDLSVIK	111	sp|P35505|FAAA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=1.1.3746.12	69.72698	2	1652.968647	1652.971273	R	H	32	48
PSM	LCYVALDFEQEMATAASSSSLEK	112	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	37	2-UNIMOD:4	ms_run[1]:scan=1.1.3722.3	69.0545	3	2549.165771	2549.166557	K	S	216	239
PSM	VPPETIDSVIVGNVMQSSSDAAYLAR	113	sp|Q8BWT1|THIM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=1.1.3722.6	69.06202	3	2718.352871	2718.353446	K	H	46	72
PSM	CCAEANPPACYGTVLAEFQPLVEEPK	114	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	37	1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.3854.7	72.76714	3	2932.3129	2932.3076	K	N	384	410
PSM	AGWNAYIDSLMADGTCQDAAIVGYK	115	sp|P62962|PROF1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	37	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=1.1.3918.4	74.53011	3	2731.2311	2731.2253	M	D	2	27
PSM	VNADEVGGEALGR	116	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=1.1.2341.15	30.4002	2	1285.619047	1285.626243	K	L	19	32
PSM	VNADEVGGEALGR	117	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=1.1.2333.7	30.18555	2	1285.619047	1285.626243	K	L	19	32
PSM	VNADEVGGEALGR	118	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=1.1.2334.14	30.21497	2	1285.619047	1285.626243	K	L	19	32
PSM	VIQCFAETGQVQK	119	sp|Q68FD5|CLH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	36	4-UNIMOD:4	ms_run[1]:scan=1.1.2353.10	30.7327	2	1506.741447	1506.750064	K	I	488	501
PSM	IGGHGAEYGAEALER	120	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=1.1.2202.6	26.56453	3	1528.718771	1528.727020	K	M	18	33
PSM	LGGEVSCLVAGTK	121	sp|Q99LC5|ETFA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	36	7-UNIMOD:4	ms_run[1]:scan=1.1.2596.17	37.45932	2	1289.656047	1289.664937	R	C	47	60
PSM	ETTIQGLDGLSER	122	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=1.1.2744.18	41.59245	2	1417.698047	1417.704888	K	C	122	135
PSM	NAVTQEFGPVPDTAR	123	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=1.1.2685.18	39.93139	2	1600.778047	1600.784535	R	Y	634	649
PSM	ESAAIYFTSGTSGPPK	124	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=1.1.2679.20	39.76955	2	1611.772847	1611.778053	R	M	214	230
PSM	VGLIGSCTNSSYEDMGR	125	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	36	7-UNIMOD:4	ms_run[1]:scan=1.1.2740.21	41.48287	2	1844.795847	1844.803298	R	S	379	396
PSM	ALQASALAAWGGK	126	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=1.1.2840.11	44.29038	2	1242.664847	1242.672071	R	A	305	318
PSM	VVAFSGDNPASLAGMR	127	sp|Q3TNA1|XYLB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=1.1.2971.16	47.97763	2	1590.775647	1590.782426	K	L	289	305
PSM	KYTPEQVAMATVTALHR	128	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=1.1.2906.14	46.15408	3	1914.999671	1914.998567	K	T	243	260
PSM	FTQAGSEVSALLGR	129	sp|P56480|ATPB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=1.1.3009.10	49.0212	2	1434.738447	1434.746693	R	I	311	325
PSM	LGEYGFQNAILVR	130	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=1.1.3156.13	53.16163	2	1478.783847	1478.788164	K	Y	422	435
PSM	GVVDSEDIPLNLSR	131	sp|Q9CQN1|TRAP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=1.1.3033.17	49.67863	2	1512.773447	1512.778387	R	E	391	405
PSM	TPDFESTGLYSAMPR	132	sp|Q9D964|GATM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=1.1.3079.18	50.98813	2	1670.754447	1670.761022	K	D	155	170
PSM	SYELPDGQVITIGNER	133	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=1.1.3192.20	54.1615	2	1789.882847	1789.884643	K	F	239	255
PSM	QAGIAQLYGIAGSTNVTGDQVK	134	sp|Q9QXD6|F16P1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=1.1.3143.12	52.78612	3	2190.123371	2190.128061	R	K	51	73
PSM	AAVAWEAGKPLSIEEIEVAPPK	135	sp|P28474|ADHX_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=1.1.3205.15	54.5301	3	2304.233171	2304.236549	K	A	10	32
PSM	TLNDELEIIEGMK	136	sp|P63038|CH60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=1.1.3442.6	61.14472	2	1503.742447	1503.749061	K	F	206	219
PSM	FYAYNPLAGGLLTGK	137	sp|Q8CG76|ARK72_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=1.1.3437.3	61.00702	2	1583.827447	1583.834780	R	Y	230	245
PSM	GHYTEGAELVDSVLDVVR	138	sp|P68372|TBB4B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=1.1.3483.9	62.28708	3	1957.971971	1957.974521	K	K	104	122
PSM	DVGGIVLANACGPCIGQWDR	139	sp|Q99KI0|ACON_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	36	11-UNIMOD:4,14-UNIMOD:4	ms_run[1]:scan=1.1.3498.9	62.71967	3	2157.009071	2157.009543	R	K	438	458
PSM	ASAFALQEQPVVNAVIDDATK	140	sp|Q9D2G2|ODO2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=1.1.3540.12	63.91197	3	2186.120471	2186.121913	K	E	288	309
PSM	DLYANTVLSGGTTMYPGIADR	141	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=1.1.3471.11	61.94763	3	2214.063071	2214.062684	K	M	292	313
PSM	TTSLELFMYLNEVAGK	142	sp|P16460|ASSY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=1.1.3780.14	70.70451	2	1814.907847	1814.912438	R	H	245	261
PSM	VNPTVFFDITADDEPLGR	143	sp|P17742|PPIA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	36		ms_run[1]:scan=1.1.3690.17	68.17613	2	2004.9837	2004.9787	M	V	2	20
PSM	DGPLNMILDDGGDLTNLIHTK	144	sp|P50247|SAHH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=1.1.3782.6	70.75233	3	2251.105871	2251.115448	K	Y	122	143
PSM	CCAEANPPACYGTVLAEFQPLVEEPK	145	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	36	1-UNIMOD:4,2-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.3700.17	68.45094	3	2949.339971	2949.334702	K	N	384	410
PSM	ATPDSLALFTGLGLSENK	146	sp|Q8BML9|SYQ_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	36	1-UNIMOD:1	ms_run[1]:scan=1.1.3896.3	73.90366	2	1874.9613	1874.9620	M	A	2	20
PSM	EAFQEALAAAGDK	147	sp|P10639|THIO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=1.1.2739.15	41.44965	2	1319.628447	1319.635745	K	L	9	22
PSM	DTCFSTEGPNLVTR	148	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	35	3-UNIMOD:4	ms_run[1]:scan=1.1.2773.20	42.39835	2	1595.718047	1595.724971	K	C	589	603
PSM	MISSYVGENAEFER	149	sp|Q9D0K2|SCOT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=1.1.2721.20	40.95333	2	1630.724047	1630.729722	R	Q	111	125
PSM	GEVITTYCPANNEPIAR	150	sp|Q9DBF1|AL7A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	35	8-UNIMOD:4	ms_run[1]:scan=1.1.2657.14	39.15812	2	1903.903447	1903.909812	R	V	63	80
PSM	NANSLGGGFHCWTCDVR	151	sp|Q9D964|GATM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	35	11-UNIMOD:4,14-UNIMOD:4	ms_run[1]:scan=1.1.2657.7	39.14643	3	1949.817671	1949.826099	R	R	397	414
PSM	GLEVTAYSPLGSSDR	152	sp|Q9JII6|AK1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=1.1.2888.20	45.654	2	1550.751247	1550.757651	R	A	204	219
PSM	ELGEYGLQAYTEVK	153	sp|P47738|ALDH2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=1.1.2981.17	48.254	2	1598.776647	1598.782804	R	T	495	509
PSM	AVLGPLVGAVDQGTSSTR	154	sp|Q64516|GLPK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=1.1.2990.14	48.4947	2	1726.909247	1726.921363	K	F	7	25
PSM	VTNEPILAFSQGSPER	155	sp|Q8CHT0|AL4A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=1.1.2898.20	45.93232	2	1743.872847	1743.879164	K	D	31	47
PSM	QSLIYHVASQQIQTLEK	156	sp|Q9DCY0|KEG1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=1.1.2908.13	46.20982	3	1985.046971	1985.058191	R	L	239	256
PSM	LAGQIFLGGSIVR	157	sp|P17563|SBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=1.1.3132.12	52.47105	2	1329.768447	1329.776871	R	G	345	358
PSM	APNSPDVLEIEFK	158	sp|P16460|ASSY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=1.1.3120.14	52.13218	2	1457.733847	1457.740210	K	K	216	229
PSM	LGEYGFQNAILVR	159	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=1.1.3163.12	53.35128	2	1478.783847	1478.788164	K	Y	422	435
PSM	AVLDVAETGTEAAAATGVIGGIRK	160	sp|P07759|SPA3K_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=1.1.3144.16	52.81832	3	2269.215971	2269.227775	K	A	361	385
PSM	LSQTFPNADFAEITK	161	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=1.1.3099.19	51.5539	2	1680.829047	1680.835902	R	L	243	258
PSM	VGDAIPSVEVFEGEPGK	162	sp|P99029|PRDX5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=1.1.3128.17	52.36245	2	1728.852047	1728.857031	K	K	54	71
PSM	VLNNMEIGTSLYDEEGAK	163	sp|P09411|PGK1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=1.1.3012.9	49.11027	2	1981.917447	1981.930273	K	I	247	265
PSM	HVLSTFGPVPEFSGATVER	164	sp|Q99KP3|CRYL1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=1.1.3021.11	49.34397	3	2029.022171	2029.026891	K	V	261	280
PSM	LLQDSGAPDGTLNIIHGQHDAVNFICDHPDIK	165	sp|Q9EQ20|MMSA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	35	26-UNIMOD:4	ms_run[1]:scan=1.1.3098.19	51.52623	5	3509.710118	3509.699767	K	A	224	256
PSM	LLYECNPIAYVMEK	166	sp|Q9QXD6|F16P1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	35	5-UNIMOD:4	ms_run[1]:scan=1.1.3483.18	62.29458	2	1741.839447	1741.841915	R	A	278	292
PSM	IGIASQALGIAQASLDCAVK	167	sp|Q07417|ACADS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	35	17-UNIMOD:4	ms_run[1]:scan=1.1.3610.7	65.88239	3	1985.061971	1985.061562	R	Y	273	293
PSM	HPDEPVLLEEPVVLALAEK	168	sp|Q9JII6|AK1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=1.1.3566.8	64.6493	3	2097.140471	2097.135772	R	H	222	241
PSM	VGFPEVMLGILPGAR	169	sp|Q9DBM2|ECHP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=1.1.3780.9	70.70035	2	1554.853647	1554.859220	R	G	118	133
PSM	DLADELALVDVMEDK	170	sp|P06151|LDHA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=1.1.3816.11	71.6943	2	1674.802647	1674.802218	K	L	43	58
PSM	ATDLLLDDSLVSLFGNR	171	sp|P99029|PRDX5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=1.1.3832.12	72.14687	2	1847.963047	1847.962893	K	R	156	173
PSM	LIDMLSEAGLPVIEATSFVSPK	172	sp|P38060|HMGCL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=1.1.3836.10	72.24989	3	2316.222371	2316.228687	R	W	59	81
PSM	LLTMEINPDYAAITQQMLDFAGLQDK	173	sp|O88587|COMT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=1.1.3896.4	73.9095	3	2938.454171	2938.445632	R	V	129	155
PSM	EEEIAALVIDNGSGMCK	174	sp|P63260|ACTG_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	35	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=1.1.3818.19	71.75655	2	1877.8482	1876.8542	M	A	2	19
PSM	AELSEEALLSVLPTIR	175	sp|P56399|UBP5_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	35	1-UNIMOD:1	ms_run[1]:scan=1.1.3964.2	75.5752	2	1781.9738	1781.9770	M	V	2	18
PSM	IIYGGSVTGATCK	176	sp|P17751|TPIS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34	12-UNIMOD:4	ms_run[1]:scan=1.1.2278.20	28.6628	2	1325.656047	1325.664937	R	E	257	270
PSM	GAAQNIIPASTGAAK	177	tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=1.1.2277.21	28.63568	2	1368.727447	1368.736128	R	A	199	214
PSM	LEEGPPVTTVLTR	178	sp|P35486|ODPA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=1.1.2791.19	42.90771	2	1410.764447	1410.771845	R	E	46	59
PSM	APQVSTPTLVEAAR	179	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=1.1.2598.20	37.5169	2	1438.772247	1438.777993	K	N	439	453
PSM	THLPGFVEQAGALK	180	sp|P99029|PRDX5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=1.1.2650.5	38.95268	3	1466.781671	1466.788164	K	A	99	113
PSM	AEAEAQAEELSFPR	181	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=1.1.2705.19	40.49337	2	1546.715447	1546.726351	R	S	929	943
PSM	APNSPDVLEIEFKK	182	sp|P16460|ASSY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=1.1.2762.8	42.07987	3	1585.830671	1585.835174	K	G	216	230
PSM	LIGPNCPGVINPGECK	183	sp|Q9WUM5|SUCA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34	6-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=1.1.2650.19	38.96437	2	1723.834047	1723.838562	R	I	167	183
PSM	VVLAAADLGTEAGVQR	184	sp|Q64105|SPRE_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=1.1.2803.20	43.2473	2	1568.844847	1568.852221	K	L	64	80
PSM	WVVIGDENYGEGSSR	185	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=1.1.2857.21	44.77895	2	1666.752247	1666.758714	R	E	657	672
PSM	VNAGDQPGADLGPLITPQAK	186	sp|Q9EQ20|MMSA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=1.1.2988.14	48.44588	2	1961.017647	1961.021805	R	E	345	365
PSM	FSGWYDADLSPAGHEEAK	187	sp|Q9DBJ1|PGAM1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=1.1.2800.15	43.15768	3	1978.868771	1978.869721	R	R	22	40
PSM	RIQEITEQLDITTSEYEK	188	sp|P63038|CH60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=1.1.2882.17	45.4842	3	2195.091671	2195.095758	K	E	370	388
PSM	LLSHCLLVTLASHHPADFTPAVHASLDK	189	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34	5-UNIMOD:4	ms_run[1]:scan=1.1.3005.12	48.912	5	3049.586118	3049.580761	K	F	101	129
PSM	TIILYDTNLPDVSAK	190	sp|P97328|KHK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=1.1.3204.16	54.50238	2	1661.882247	1661.887603	R	D	109	124
PSM	FSSETWQNLGTLQR	191	sp|Q8VCR7|ABHEB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=1.1.3002.21	48.83525	2	1665.805447	1665.811084	R	L	43	57
PSM	SSGLPITSAVDLEDAAK	192	sp|Q9Z2I8|SUCB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=1.1.3123.19	52.2215	2	1672.843047	1672.851946	K	K	408	425
PSM	LSQTFPNADFAEITK	193	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=1.1.3106.18	51.74682	2	1680.829047	1680.835902	R	L	243	258
PSM	YFDSFGDLSSASAIMGNAK	194	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34	15-UNIMOD:35	ms_run[1]:scan=1.1.3199.21	54.3634	2	1995.885047	1995.888408	R	V	42	61
PSM	AYHEQLSVAEITNACFEPANQMVK	195	sp|P05213|TBA1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34	15-UNIMOD:4	ms_run[1]:scan=1.1.3122.19	52.19307	3	2749.278371	2749.283987	K	C	281	305
PSM	DNVINLEVVLPDGR	196	sp|Q7TNG8|LDHD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=1.1.3516.15	63.22257	2	1551.819847	1551.825671	R	L	185	199
PSM	TCGFDFSGALEDISK	197	sp|P05202|AATM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34	2-UNIMOD:4	ms_run[1]:scan=1.1.3465.19	61.79012	2	1645.724247	1645.729388	K	I	186	201
PSM	ALTVPELTQQMFDAK	198	sp|P68372|TBB4B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=1.1.3437.4	61.00952	2	1690.851447	1690.860008	R	N	283	298
PSM	VLSSYPINTLVGAPIIYR	199	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=1.1.3590.4	65.31123	3	1975.121171	1975.114249	K	M	300	318
PSM	HPDEPVLLEEPVVLALAEK	200	sp|Q9JII6|AK1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=1.1.3552.7	64.25134	3	2097.140471	2097.135772	R	H	222	241
PSM	ILQNIQVFDFTFSPEEMK	201	sp|Q9JII6|AK1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=1.1.3777.10	70.61459	3	2185.074371	2185.076543	R	Q	270	288
PSM	LAGVTALSCWLPLR	202	sp|P97823|LYPA1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34	9-UNIMOD:4	ms_run[1]:scan=1.1.3724.4	69.11647	2	1555.850247	1555.854469	K	A	136	150
PSM	DLLQTELSGFLDVQK	203	sp|P56565|S10A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=1.1.3816.13	71.69597	2	1704.890847	1704.893417	K	D	36	51
PSM	NGDGEVSYEEFEAFFK	204	sp|P97816|S100G_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=1.1.3681.14	67.91376	2	1866.794047	1866.794825	K	K	60	76
PSM	EEIFGPVLVVLETETLDEAIK	205	sp|Q9EQ20|MMSA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=1.1.3927.2	74.72662	3	2343.244271	2343.246111	K	I	416	437
PSM	SNLVGMGVIPLEYLPGETADSLGLTGR	206	sp|P28271|ACOC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=1.1.3832.11	72.1452	3	2758.413671	2758.421132	R	E	806	833
PSM	NDANPETHAFVTSPEIVTALAIAGTLK	207	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=1.1.3771.17	70.44936	3	2779.444271	2779.439225	R	F	480	507
PSM	DCVGPEVENACANPAAGTVILLENLR	208	sp|P09411|PGK1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34	2-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=1.1.3797.19	71.1766	3	2781.348371	2781.342564	K	F	98	124
PSM	TALLDAAGVASLLTTAEAVVTEIPKEEK	209	sp|P63038|CH60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=1.1.3908.6	74.24975	3	2839.551671	2839.543021	R	D	527	555
PSM	QFSYTHICAGASAFGK	210	sp|Q99LC5|ETFA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	34	1-UNIMOD:28,8-UNIMOD:4	ms_run[1]:scan=1.1.3074.20	50.84695	2	1726.7679	1726.7768	K	N	102	118
PSM	MEAGGLGCAVCVLTGASR	211	tr|G3UXX3|G3UXX3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	34	1-UNIMOD:1,8-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=1.1.3791.19	71.00777	2	1850.8422	1849.8482	-	G	1	19
PSM	LGGSAVISLEGKPL	212	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=1.1.2983.8	48.30445	2	1339.763247	1339.771117	K	-	153	167
PSM	VNADEVGGEALGR	213	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=1.1.2348.18	30.59378	2	1285.619047	1285.626243	K	L	19	32
PSM	VNADEVGGEALGR	214	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=1.1.2328.21	30.04955	2	1285.619047	1285.626243	K	L	19	32
PSM	NQVAVVTGGGTGIGK	215	sp|Q99MZ7|PECR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=1.1.2282.15	28.76977	2	1356.727647	1356.736128	K	A	18	33
PSM	TRPTVAAGAVGLAQR	216	sp|P45952|ACADM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=1.1.2196.12	26.40055	3	1466.822471	1466.831760	R	A	280	295
PSM	LGDVYVNDAFGTAHR	217	sp|P09041|PGK2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=1.1.2666.10	39.39318	3	1633.778771	1633.784869	K	A	157	172
PSM	VGIPVVAVESDPK	218	sp|Q9DBM2|ECHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=1.1.2786.15	42.76215	2	1308.720447	1308.728917	R	Q	317	330
PSM	EAFQEALAAAGDK	219	sp|P10639|THIO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=1.1.2745.13	41.61587	2	1319.628447	1319.635745	K	L	9	22
PSM	VGVPTETGALTLNR	220	sp|Q8BWT1|THIM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=1.1.2735.17	41.33762	2	1426.770047	1426.777993	R	L	77	91
PSM	YHTSQSGDEMTSLSEYVSR	221	sp|P11499|HS90B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=1.1.2705.17	40.49168	3	2175.930371	2175.937877	R	M	457	476
PSM	VILSSSSSCLLPSK	222	sp|Q99KP3|CRYL1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33	9-UNIMOD:4	ms_run[1]:scan=1.1.2739.18	41.45217	2	1476.777847	1476.785781	R	L	117	131
PSM	IYQIYEGTAQIQR	223	sp|P45952|ACADM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=1.1.2695.21	40.20893	2	1581.807247	1581.815107	K	L	396	409
PSM	NHYQAEVFSVNFAESEEAKK	224	sp|P07758|A1AT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=1.1.2640.20	38.6821	3	2326.080971	2326.086590	K	V	154	174
PSM	VGDAIPSVEVFEGEPGKK	225	sp|P99029|PRDX5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=1.1.2839.12	44.2635	3	1856.954171	1856.951994	K	V	54	72
PSM	VAVSADPNVPNVIVTR	226	sp|Q99PT1|GDIR1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=1.1.2865.21	45.00827	2	1649.907047	1649.910070	R	L	59	75
PSM	FSSETWQNLGTLQR	227	sp|Q8VCR7|ABHEB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=1.1.2996.21	48.66453	2	1665.805447	1665.811084	R	L	43	57
PSM	AGQQGLSVAFDLATHR	228	sp|P16332|MUTA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=1.1.2920.7	46.54185	3	1669.845971	1669.853618	K	G	127	143
PSM	AVLGPLVGAVDQGTSSTR	229	sp|Q64516|GLPK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=1.1.2983.12	48.31112	2	1726.909247	1726.921363	K	F	7	25
PSM	VITAFNDGLNHLDSLK	230	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=1.1.2987.3	48.40558	3	1755.915371	1755.915549	K	G	68	84
PSM	AETFTFHSDICTLPEK	231	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33	11-UNIMOD:4	ms_run[1]:scan=1.1.2805.14	43.29802	3	1894.885271	1894.877115	K	E	528	544
PSM	VNAGDQPGADLGPLITPQAK	232	sp|Q9EQ20|MMSA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=1.1.2981.21	48.25735	2	1961.017647	1961.021805	R	E	345	365
PSM	KISSVQSIVPALEIANAHR	233	sp|P63038|CH60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=1.1.2856.19	44.74858	3	2032.134371	2032.142923	K	K	250	269
PSM	IADQCPSSLAIQENANALAR	234	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33	5-UNIMOD:4	ms_run[1]:scan=1.1.2851.17	44.60335	3	2141.051171	2141.053516	R	Y	154	174
PSM	SIVNNGHSFNVEFDDSQDNAVLK	235	sp|P00920|CAH2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=1.1.2948.16	47.33593	3	2548.174871	2548.183010	K	G	58	81
PSM	VSDLAGLDVGWK	236	sp|Q9DBM2|ECHP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=1.1.3109.9	51.82202	2	1258.651247	1258.655752	R	V	516	528
PSM	KIEPELEGSSAVTSHDSSTNGLISFIK	237	sp|P06745|G6PI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=1.1.3015.5	49.18345	4	2845.437294	2845.434533	K	Q	524	551
PSM	TIQNLASIQSFQIK	238	sp|Q91XE0|GLYAT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=1.1.3145.17	52.84793	2	1589.871647	1589.877707	K	H	114	128
PSM	SAPDFTATAVVDGAFK	239	sp|Q61171|PRDX2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=1.1.3202.15	54.44427	2	1595.778647	1595.783138	K	E	11	27
PSM	IINEPTAAAIAYGLDK	240	sp|P16627|HS71L_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=1.1.3116.17	52.02167	2	1658.881047	1658.887937	R	G	174	190
PSM	LISWYDNEYGYSNR	241	tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=1.1.3021.16	49.35065	2	1778.780647	1778.790014	K	V	308	322
PSM	SYELPDGQVITIGNER	242	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=1.1.3178.19	53.77448	2	1789.882847	1789.884643	K	F	239	255
PSM	RFDEILEASDGIMVAR	243	sp|P52480|KPYM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=1.1.3183.7	53.90205	3	1820.905571	1820.909084	R	G	279	295
PSM	VSHALAEGLGVIACIGEK	244	sp|P17751|TPIS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33	14-UNIMOD:4	ms_run[1]:scan=1.1.3120.7	52.12635	3	1822.960271	1822.961119	K	L	164	182
PSM	HSMNPFCEIAVEEAVR	245	sp|Q9DCW4|ETFB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33	7-UNIMOD:4	ms_run[1]:scan=1.1.3016.4	49.20612	3	1887.852071	1887.860753	K	L	36	52
PSM	DATNVGDEGGFAPNILENK	246	sp|P17182|ENOA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=1.1.3137.21	52.62152	2	1959.914847	1959.917400	K	E	203	222
PSM	FTASAGIQVVGDDLTVTNPK	247	sp|P17182|ENOA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=1.1.3156.10	53.15913	3	2032.042871	2032.047686	K	R	307	327
PSM	SHSNQLVTDCISAMNPDTVLR	248	sp|Q9Z0S1|BPNT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33	10-UNIMOD:4	ms_run[1]:scan=1.1.3034.16	49.70615	3	2357.109971	2357.110379	R	V	197	218
PSM	TGQATVASGIPAGWMGLDCGTESSKK	249	sp|P09411|PGK1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33	19-UNIMOD:4	ms_run[1]:scan=1.1.3006.21	48.94757	3	2608.221371	2608.226137	K	Y	298	324
PSM	LVSDEMVVELIEK	250	sp|Q9WTP6|KAD2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=1.1.3502.6	62.82957	2	1502.782847	1502.790197	K	N	73	86
PSM	NTMSLLAANNLLAGLR	251	sp|Q91Z53|GRHPR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=1.1.3649.16	67.0119	2	1670.903647	1670.913775	R	G	303	319
PSM	AVFVDLEPTVIDEVR	252	sp|P05213|TBA1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=1.1.3484.19	62.32398	2	1700.894647	1700.898502	R	T	65	80
PSM	HPDEPVLLEEPVVLALAEK	253	sp|Q9JII6|AK1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=1.1.3560.7	64.48043	3	2097.140471	2097.135772	R	H	222	241
PSM	KADCTITMADSDLLALMTGK	254	sp|P32020|NLTP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33	4-UNIMOD:4	ms_run[1]:scan=1.1.3601.11	65.6273	3	2154.036071	2154.037063	K	M	492	512
PSM	HEIIQTLQMTDGLIPLEIR	255	sp|P17563|SBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=1.1.3606.12	65.77171	3	2219.200871	2219.198389	R	F	236	255
PSM	ADYAQLLEDMQNAFR	256	sp|P50516|VATA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=1.1.3807.16	71.4497	2	1783.815247	1783.819934	K	S	599	614
PSM	DCGTDVLDLWTLMQK	257	sp|Q9DB29|IAH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33	2-UNIMOD:4	ms_run[1]:scan=1.1.3863.10	73.01663	2	1793.826047	1793.832807	R	D	172	187
PSM	VAEQTPLTALYVANLIK	258	sp|P47738|ALDH2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=1.1.3703.17	68.53463	2	1843.043847	1843.045501	K	E	212	229
PSM	LNLPINIIGLAPLCENMPSGK	259	sp|Q9CPY7|AMPL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33	14-UNIMOD:4	ms_run[1]:scan=1.1.3804.3	71.35944	3	2263.209071	2263.206846	K	A	322	343
PSM	TALLDAAGVASLLTTAEAVVTEIPKEEK	260	sp|P63038|CH60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=1.1.3902.6	74.08027	3	2839.551671	2839.543021	R	D	527	555
PSM	TIVAINKDPEAPIFQVADYGIVADLFK	261	sp|Q99LC5|ETFA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=1.1.3821.17	71.84015	3	2946.576071	2946.574262	K	V	295	322
PSM	IVQEIPQLLDAAASPLIAEQEVLEALPK	262	sp|Q8BLF1|NCEH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=1.1.3925.3	74.6916	3	2997.662171	2997.663805	R	T	312	340
PSM	CVQSNIVLLTQAFR	263	sp|D3Z7P3|GLSK_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	33	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.3885.2	73.60352	2	1630.8459	1630.8496	K	R	208	222
PSM	MEAVLNELVSVEDLK	264	sp|Q9CQ92|FIS1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	33	1-UNIMOD:1	ms_run[1]:scan=1.1.4062.2	76.99226	2	1729.8757	1729.8803	-	N	1	16
PSM	NQVAVVTGGGTGIGK	265	sp|Q99MZ7|PECR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.2289.20	28.96095	2	1356.727647	1356.736128	K	A	18	33
PSM	GGGALVENTTTGLSR	266	sp|Q60866|PTER_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.2352.20	30.70578	2	1431.721447	1431.731771	K	D	91	106
PSM	IIAEGANGPTTPEADK	267	sp|P26443|DHE3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.2178.21	25.90015	2	1582.775247	1582.783866	K	I	400	416
PSM	EIVHIQAGQCGNQIGAK	268	sp|P99024|TBB5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32	10-UNIMOD:4	ms_run[1]:scan=1.1.2281.12	28.74127	3	1821.910571	1821.915566	R	F	3	20
PSM	DFTPAAQAAFQK	269	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.2654.16	39.07297	2	1293.628647	1293.635351	K	V	122	134
PSM	EIYGQTETGLICR	270	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32	12-UNIMOD:4	ms_run[1]:scan=1.1.2663.18	39.31745	2	1538.733447	1538.739893	R	V	360	373
PSM	MLLEYTDSSYDEK	271	sp|P10649|GSTM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.2779.20	42.56618	2	1592.683847	1592.691605	R	R	19	32
PSM	ETVSEESNVLCLSK	272	sp|P58252|EF2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32	11-UNIMOD:4	ms_run[1]:scan=1.1.2682.18	39.8503	2	1593.747847	1593.755603	R	S	581	595
PSM	EIIAVSCGPSQCQETIR	273	sp|Q9DCW4|ETFB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32	7-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.2627.21	38.31667	2	1946.913647	1946.918997	K	T	60	77
PSM	LVQDVANNTNEEAGDGTTTATVLAR	274	sp|P63038|CH60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.2702.20	40.40854	3	2559.236171	2559.241253	K	S	97	122
PSM	ADLINNLGTIAK	275	sp|P07901|HS90A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.2926.8	46.714	2	1241.692047	1241.697952	K	S	101	113
PSM	FLASVSTVLTSK	276	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.2940.7	47.11372	2	1251.699847	1251.707454	K	Y	129	141
PSM	FLASVSTVLTSK	277	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.2947.5	47.30055	2	1251.699847	1251.707454	K	Y	129	141
PSM	SVAADFIQQGIR	278	sp|Q8JZV9|BDH2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.2888.12	45.64732	2	1303.679247	1303.688450	K	C	160	172
PSM	FAIQDISVEETSAK	279	sp|O88990|ACTN3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.2927.18	46.75087	2	1536.761047	1536.767154	R	E	147	161
PSM	FLHDPSATQGFVGCALSSNIQR	280	sp|P17563|SBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32	14-UNIMOD:4	ms_run[1]:scan=1.1.2989.11	48.46943	3	2404.152671	2404.159378	R	F	255	277
PSM	KGVLFGVPGAFTPGCSK	281	sp|P99029|PRDX5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32	15-UNIMOD:4	ms_run[1]:scan=1.1.2929.7	46.79878	3	1720.892171	1720.897063	K	T	82	99
PSM	KISSVQSIVPALEIANAHR	282	sp|P63038|CH60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.2856.5	44.7369	4	2032.131694	2032.142923	K	K	250	269
PSM	VAGHPDVVINNAAGNFISPSER	283	sp|Q9CQ62|DECR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.2803.19	43.24647	3	2263.129271	2263.134544	K	L	134	156
PSM	LLSHCLLVTLASHHPADFTPAVHASLDK	284	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32	5-UNIMOD:4	ms_run[1]:scan=1.1.3006.9	48.93755	5	3049.586118	3049.580761	K	F	101	129
PSM	LGGVEFNIDLPNK	285	sp|O08997|ATOX1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.3185.13	53.96195	2	1414.743847	1414.745630	K	K	26	39
PSM	GSQGGLSQDFVEALK	286	sp|Q7TNG8|LDHD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.3059.17	50.41462	2	1534.751647	1534.762737	R	A	22	37
PSM	ANATEFGLASGVFTR	287	sp|Q8R0Y6|AL1L1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.3132.16	52.47438	2	1539.758847	1539.768157	R	D	827	842
PSM	VDFPQDQLATLTGR	288	sp|P08249|MDHM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.3207.16	54.58817	2	1559.786047	1559.794371	K	I	216	230
PSM	VDFPQDQLATLTGR	289	sp|P08249|MDHM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.3201.18	54.41817	2	1559.786047	1559.794371	K	I	216	230
PSM	ISSVQSIVPALEIANAHR	290	sp|P63038|CH60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.3105.10	51.71235	3	1904.041271	1904.047960	K	K	251	269
PSM	LLIQSEFPSLLK	291	sp|P97816|S100G_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.3456.8	61.53482	2	1386.807247	1386.812253	K	A	34	46
PSM	LICCDILDVLDK	292	sp|P62259|1433E_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32	3-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=1.1.3568.16	64.71215	2	1475.731847	1475.736388	K	H	95	107
PSM	ALPFWNEEIVPQIK	293	sp|Q9DBJ1|PGAM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.3619.16	66.1503	2	1682.902447	1682.903193	R	E	163	177
PSM	KLDILSNDLVINMLK	294	sp|Q9QXD6|F16P1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.3568.3	64.7013	3	1727.985971	1727.985543	K	S	73	88
PSM	VASLIGVEGGHLIDSSLGVLR	295	sp|P31428|DPEP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.3438.5	61.03378	3	2091.156671	2091.168804	K	T	134	155
PSM	HPDEPVLLEEPVVLALAEK	296	sp|Q9JII6|AK1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.3572.9	64.81953	3	2097.140471	2097.135772	R	H	222	241
PSM	LFLYEPAGTETFSVESISK	297	sp|Q91XE4|ACY3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.3516.11	63.21923	3	2117.053571	2117.056853	R	N	153	172
PSM	TTVLLADMNDFGTVNEIYK	298	sp|P52760|RIDA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.3582.4	65.09317	3	2143.050371	2143.050722	K	T	79	98
PSM	IDATQVEVNPFGETPEGQVVCFDAK	299	sp|Q9Z2I8|SUCB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32	21-UNIMOD:4	ms_run[1]:scan=1.1.3513.19	63.14012	3	2749.292171	2749.290512	K	I	236	261
PSM	MPIPVIQAFGILK	300	sp|P97807|FUMH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.3774.5	70.52393	2	1425.835647	1425.841779	R	R	85	98
PSM	SLADELALVDVLEDK	301	sp|P16125|LDHB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.3808.11	71.47276	2	1628.849847	1628.850883	K	L	44	59
PSM	VLVCGAGPVGMVTLLVAK	302	sp|Q64442|DHSO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32	4-UNIMOD:4	ms_run[1]:scan=1.1.3716.13	68.896	2	1783.006247	1783.009984	K	A	176	194
PSM	NAPAIIFIDELDAIAPK	303	sp|Q01853|TERA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.3840.16	72.36951	2	1809.985247	1809.987651	K	R	296	313
PSM	IQEGVESLAGYADIFLR	304	sp|Q99MN9|PCCB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.3781.17	70.73431	2	1879.959047	1879.967979	R	N	168	185
PSM	EEIFGPVLTVYVYPDDK	305	sp|Q8CHT0|AL4A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.3712.15	68.78858	2	1982.985447	1982.987711	K	Y	445	462
PSM	IEAELQDICNDVLELLDK	306	sp|Q9CQV8|1433B_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32	9-UNIMOD:4	ms_run[1]:scan=1.1.3889.2	73.7283	3	2129.050271	2129.056202	K	Y	88	106
PSM	VPTANLENVLPLAEDFTEILSR	307	sp|P21614|VTDB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.3913.4	74.38848	3	2440.283471	2440.284956	K	C	243	265
PSM	NAIDDGCVVPGAGAVEVALAEALIK	308	sp|P80317|TCPZ_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32	7-UNIMOD:4	ms_run[1]:scan=1.1.3867.6	73.12476	3	2451.268271	2451.267926	K	Y	400	425
PSM	LLDVPILLTEQYPEGLGPTVPELGAQGIRPVSK	309	sp|P85094|ISC2A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.3771.13	70.44603	4	3498.940494	3498.933772	R	T	50	83
PSM	CCAEANPPACYGTVLAEFQPLVEEPK	310	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	32	1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.3853.16	72.74157	3	2932.3129	2932.3076	K	N	384	410
PSM	QTANVLSGACGLHR	311	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	32	1-UNIMOD:28,10-UNIMOD:4	ms_run[1]:scan=1.1.2656.6	39.12612	2	1465.7032	1465.7091	K	G	92	106
PSM	VNQIGSVTESIQACK	312	sp|P21550|ENOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32	14-UNIMOD:4	ms_run[1]:scan=1.1.2601.19	37.5991	2	1632.808247	1632.814121	K	L	344	359
PSM	IAAFADAAVDPIDFPLAPAYAVPK	313	sp|Q8QZT1|THIL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.3800.15	71.25757	3	2442.274871	2442.283499	R	V	309	333
PSM	STGSVVGQQPFGGAR	314	sp|Q8CHT0|AL4A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.2346.19	30.53897	2	1446.712047	1446.721541	K	A	509	524
PSM	IGGHGAEYGAEALER	315	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.2209.12	26.75545	3	1528.718771	1528.727020	K	M	18	33
PSM	GDVTTQVALQPALK	316	sp|P09671|SODM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.2691.19	40.0951	2	1439.790447	1439.798394	K	F	76	90
PSM	ESAAIYFTSGTSGPPK	317	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.2679.10	39.76122	3	1611.774971	1611.778053	R	M	214	230
PSM	ESAAIYFTSGTSGPPK	318	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.2673.21	39.59932	2	1611.772847	1611.778053	R	M	214	230
PSM	IEDLSQQAQLAAAEK	319	sp|P70670|NACAM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.2600.21	37.5731	2	1613.816447	1613.826065	K	F	2100	2115
PSM	APAAIGPYSQAVQVDR	320	sp|P52760|RIDA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.2657.10	39.15145	2	1641.842047	1641.847470	K	T	14	30
PSM	DQTNDQVTIDSALATQK	321	sp|P54071|IDHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.2772.21	42.37118	2	1846.887447	1846.890851	R	Y	90	107
PSM	EVYMGNVIQGGEGQAPTR	322	sp|Q8QZT1|THIL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.2686.18	39.9601	2	1904.897247	1904.905061	K	Q	85	103
PSM	FDALTMHVQPQVAAQQK	323	sp|Q62468|VILI_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.2661.6	39.2574	3	1910.957771	1910.967267	K	M	375	392
PSM	RPSANCDPYAVTEAIVR	324	sp|P15105|GLNA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31	6-UNIMOD:4	ms_run[1]:scan=1.1.2679.14	39.76455	3	1917.927971	1917.936696	R	T	341	358
PSM	VAPEEHPVLLTEAPLNPK	325	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.2751.19	41.78507	2	1953.051047	1953.057128	R	A	96	114
PSM	TSRPENAIIYSNNEDFQVGQAK	326	sp|P40142|TKT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.2635.20	38.54002	3	2480.185271	2480.193181	R	V	472	494
PSM	TGQSYLAAGLLK	327	sp|Q99MZ7|PECR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.2829.13	43.97975	2	1220.668247	1220.676488	K	N	6	18
PSM	IMNTFSVVPSPK	328	sp|P68372|TBB4B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.2841.11	44.31798	2	1318.687447	1318.695509	R	V	163	175
PSM	VIQGSLDSLPQAVR	329	sp|Q9Z2V4|PCKGC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.2809.18	43.41212	2	1481.811247	1481.820192	K	K	15	29
PSM	GYLGPEQLPDCLK	330	sp|P08249|MDHM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31	11-UNIMOD:4	ms_run[1]:scan=1.1.2975.16	48.0855	2	1488.723447	1488.728266	K	G	79	92
PSM	VCIVGSGNWGSAIAK	331	sp|P13707|GPDA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31	2-UNIMOD:4	ms_run[1]:scan=1.1.2893.17	45.79108	2	1517.756247	1517.766048	K	I	6	21
PSM	AVVQVFEGTSGIDAK	332	sp|P62814|VATB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.2818.17	43.66847	2	1519.779647	1519.788223	K	K	94	109
PSM	EFGASECISPQDFSK	333	sp|P28474|ADHX_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31	7-UNIMOD:4	ms_run[1]:scan=1.1.2855.21	44.7216	2	1700.728447	1700.735202	K	S	234	249
PSM	FDEFFSQGCAPGYEK	334	sp|Q921I1|TRFE_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31	9-UNIMOD:4	ms_run[1]:scan=1.1.2950.18	47.3917	2	1780.728647	1780.740287	K	N	498	513
PSM	NHYQAEVFSVNFAESEEAK	335	sp|P07758|A1AT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.2851.18	44.60418	3	2197.984871	2197.991627	K	K	154	173
PSM	ENVHVFEVEGNSDELDEPIK	336	sp|Q80W22|THNS2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.2899.18	45.95935	3	2298.063371	2298.065186	K	A	184	204
PSM	WTTAPKPTMADELYDQNYPIHSVEDR	337	sp|Q9D964|GATM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.2943.9	47.20032	4	3076.428494	3076.423651	K	H	210	236
PSM	LGQLNIDISNIK	338	sp|Q64516|GLPK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.3069.10	50.69715	2	1326.741647	1326.750716	K	A	75	87
PSM	VFDYSEYWEGAR	339	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.3160.11	53.27037	2	1520.652447	1520.657209	R	G	831	843
PSM	AFDNDVDALCNLR	340	sp|Q99MN9|PCCB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31	10-UNIMOD:4	ms_run[1]:scan=1.1.3016.7	49.2128	2	1521.678847	1521.688192	R	E	262	275
PSM	SIITLDGGALVQVQK	341	sp|P04117|FABP4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.3152.18	53.05153	2	1540.874047	1540.882458	K	W	83	98
PSM	VINEPTAAALAYGLDK	342	sp|P38647|GRP75_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.3074.19	50.8461	2	1644.864047	1644.872287	R	S	219	235
PSM	TIILYDTNLPDVSAK	343	sp|P97328|KHK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.3198.20	54.33365	2	1661.882247	1661.887603	R	D	109	124
PSM	LSQTFPNADFAEITK	344	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.3092.17	51.35954	2	1680.829047	1680.835902	R	L	243	258
PSM	VAGALAEEGMGLEEITK	345	sp|Q8VC30|TKFC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.3078.19	50.96015	2	1716.847047	1716.860402	K	R	163	180
PSM	HSMNPFCEIAVEEAVR	346	sp|Q9DCW4|ETFB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31	7-UNIMOD:4	ms_run[1]:scan=1.1.3023.6	49.39875	3	1887.852071	1887.860753	K	L	36	52
PSM	ISSVQSIVPALEIANAHR	347	sp|P63038|CH60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.3112.9	51.9041	3	1904.041271	1904.047960	K	K	251	269
PSM	YVRPGGGFEPNFTLFEK	348	sp|P11352|GPX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.3132.9	52.46853	3	1956.969671	1956.973398	K	C	96	113
PSM	AFVVLAPEFLSHDRDQLTK	349	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.3108.4	51.79042	4	2185.151294	2185.153154	K	V	508	527
PSM	AAVPSGASTGIYEALELRDNDK	350	sp|P17182|ENOA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.3004.17	48.88822	3	2276.122271	2276.128455	R	T	33	55
PSM	IILDLISESPIK	351	sp|P61979|HNRPK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.3486.5	62.36932	2	1339.788847	1339.796269	K	G	208	220
PSM	DLDVAVLVGSMPR	352	sp|P14152|MDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.3642.4	66.80838	2	1370.715447	1370.722786	K	R	80	93
PSM	IAEVGGVPYLLPLVNK	353	sp|Q91V76|CK054_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.3605.14	65.74475	2	1680.980247	1680.981444	R	K	59	75
PSM	IVPLQGAQMLQMLEK	354	sp|Q91XE0|GLYAT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	31		ms_run[1]:scan=1.1.3579.11	65.0175	2	1697.9207	1697.9203	M	S	2	17
PSM	AIWNVINWENVTER	355	sp|P09671|SODM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.3602.16	65.66023	2	1742.873047	1742.874019	K	Y	203	217
PSM	ALALAQEILPQAPIAVR	356	sp|Q3TLP5|ECHD2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.3507.13	62.9738	2	1773.042847	1773.051255	R	L	228	245
PSM	VKPIWPIGMFSGYVDNPK	357	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.3477.12	62.11753	3	2047.056971	2047.060105	R	K	415	433
PSM	VKPIWPIGMFSGYVDNPK	358	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.3483.11	62.28875	3	2047.056971	2047.060105	R	K	415	433
PSM	KAQGTGELTQLLNSLCTAIK	359	sp|Q9QXD6|F16P1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31	16-UNIMOD:4	ms_run[1]:scan=1.1.3599.6	65.56641	3	2145.145871	2145.146354	R	A	24	44
PSM	ASYISSAQLDQPDPGAVAAAAIFR	360	sp|Q8VC30|TKFC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.3598.13	65.54266	3	2418.222971	2418.217939	R	A	544	568
PSM	ISALQSAGVVVSMSPAQLGTTIYK	361	sp|Q9WUM5|SUCA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.3561.13	64.51348	3	2420.297471	2420.298497	K	E	315	339
PSM	VGWEQLLTTIAR	362	sp|P57780|ACTN4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.3735.7	69.41389	2	1385.764447	1385.766700	R	T	735	747
PSM	NSDQFVTSVLDGVVLPK	363	sp|Q91WU0|CES1F_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.3708.12	68.67509	2	1816.948847	1816.957080	K	D	313	330
PSM	DFSSVFQYLREEEPF	364	sp|Q99L13|3HIDH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.3882.5	73.54739	2	1891.859047	1891.862845	K	-	321	336
PSM	ILPESSILFLCDLQEK	365	sp|P85094|ISC2A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31	11-UNIMOD:4	ms_run[1]:scan=1.1.3710.21	68.73244	2	1903.993447	1903.996502	R	F	11	27
PSM	ILPESSILFLCDLQEK	366	sp|P85094|ISC2A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31	11-UNIMOD:4	ms_run[1]:scan=1.1.3716.17	68.90102	2	1903.993447	1903.996502	R	F	11	27
PSM	VAAFDLDGVLALPSIAGAFR	367	sp|P34914|HYES_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.3869.12	73.18752	2	2002.087447	2002.088763	R	R	5	25
PSM	LSDLLAPISEQIQEVITFR	368	sp|P40124|CAP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.3881.9	73.51023	3	2171.179871	2171.183785	K	E	100	119
PSM	HGEEVTPEDVLSAAMYPDVFAQFK	369	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.3787.7	70.89325	3	2679.251471	2679.252669	R	D	998	1022
PSM	VNQIGSVTESIQACK	370	sp|P21550|ENOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31	14-UNIMOD:4	ms_run[1]:scan=1.1.2614.18	37.95597	2	1632.808247	1632.814121	K	L	344	359
PSM	ASPAAGGVVIVGSGLIGR	371	sp|Q99KP3|CRYL1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	31	1-UNIMOD:1	ms_run[1]:scan=1.1.3640.12	66.76318	2	1621.9101	1621.9146	M	S	2	20
PSM	ASGVAVSDGVIK	372	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	31	1-UNIMOD:1	ms_run[1]:scan=1.1.2816.11	43.60618	2	1143.6071	1143.6130	M	V	2	14
PSM	QMEQISQFLQAAER	373	sp|Q9WVA4|TAGL2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	31	1-UNIMOD:28	ms_run[1]:scan=1.1.3879.6	73.46146	2	1660.7815	1660.7874	K	Y	89	103
PSM	QATVGDVNTDRPGLLDLK	374	sp|P31786|ACBP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	31	1-UNIMOD:28	ms_run[1]:scan=1.1.3120.21	52.13803	2	1893.9725	1893.9791	K	G	34	52
PSM	QVAASTAQLLVACK	375	sp|P26039|TLN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31	13-UNIMOD:4	ms_run[1]:scan=1.1.2659.18	39.21018	2	1457.775647	1458.786449	K	V	2430	2444
PSM	KHHLDGETEEER	376	sp|P10649|GSTM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.1577.16	9.18715	3	1478.667371	1478.674984	R	I	83	95
PSM	IGGHGAEYGAEALER	377	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.2216.16	26.94965	3	1528.718771	1528.727020	K	M	18	33
PSM	VVAGVAAALAHK	378	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.2234.12	27.44113	2	1105.651647	1105.660778	K	Y	134	146
PSM	AAGCDFNNVVK	379	sp|P52760|RIDA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30	4-UNIMOD:4	ms_run[1]:scan=1.1.2241.19	27.63712	2	1193.542047	1193.549907	K	T	68	79
PSM	GAEAANVTGPGGVPVQGSK	380	sp|P62960|YBOX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.2275.21	28.57948	2	1694.847647	1694.858763	K	Y	117	136
PSM	VMLGETNPADSKPGTIR	381	sp|P15532|NDKA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.2321.20	29.85188	3	1784.904971	1784.909084	R	G	89	106
PSM	LPMGMTAENLAAK	382	sp|Q8BWT1|THIM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.2711.15	40.66113	2	1345.663247	1345.673393	K	Y	159	172
PSM	HIDCASVYGNETEIGEALK	383	sp|Q9JII6|AK1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30	4-UNIMOD:4	ms_run[1]:scan=1.1.2772.15	42.36618	3	2104.967771	2104.973535	R	E	43	62
PSM	THLPGFVEQAGALK	384	sp|P99029|PRDX5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.2644.7	38.78497	3	1466.781671	1466.788164	K	A	99	113
PSM	TTPSYVAFTDTER	385	sp|P16627|HS71L_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.2653.18	39.0469	2	1486.687047	1486.693989	R	L	39	52
PSM	DTCFSTEGPNLVTR	386	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30	3-UNIMOD:4	ms_run[1]:scan=1.1.2779.21	42.56702	2	1595.718047	1595.724971	K	C	589	603
PSM	HLEINPDHPIVETLR	387	sp|P11499|HS90B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.2600.15	37.5681	3	1781.931971	1781.942433	K	Q	625	640
PSM	QATVGDVNTDRPGLLDLK	388	sp|P31786|ACBP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.2762.17	42.08738	3	1911.002771	1911.006155	K	G	34	52
PSM	EIIAVSCGPSQCQETIR	389	sp|Q9DCW4|ETFB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30	7-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.2633.21	38.48412	2	1946.913647	1946.918997	K	T	60	77
PSM	DAGQISGLNVLR	390	sp|P38647|GRP75_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.2939.6	47.08345	2	1241.663247	1241.672800	K	V	207	219
PSM	LADMALALESAR	391	sp|Q07417|ACADS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.2982.4	48.27417	2	1259.646447	1259.654372	K	L	314	326
PSM	VDYAGVTVDELGK	392	sp|P70296|PEBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.2866.17	45.03358	2	1364.677447	1364.682361	R	V	27	40
PSM	TPYTDVNIVTIR	393	sp|Q9D6R2|IDH3A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.2910.18	46.27055	2	1390.740047	1390.745630	K	E	135	147
PSM	VVDSLQLTGTKPVATPVDWK	394	sp|O08709|PRDX6_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.2985.6	48.35245	3	2153.164271	2153.173221	R	K	163	183
PSM	PFVELETNLPASR	395	sp|O35215|DOPD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	30		ms_run[1]:scan=1.1.2979.14	48.19493	2	1471.7606	1471.7666	M	I	2	15
PSM	STEPCAHLLVSSIGVVGTAEQNR	396	sp|O35215|DOPD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30	5-UNIMOD:4	ms_run[1]:scan=1.1.2999.20	48.74902	3	2424.204071	2424.206723	K	T	53	76
PSM	VITAFNDGLNHLDSLK	397	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.2980.7	48.21745	3	1755.915371	1755.915549	K	G	68	84
PSM	YADLTEDQLPSCESLK	398	sp|Q9DBJ1|PGAM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30	12-UNIMOD:4	ms_run[1]:scan=1.1.2862.21	44.92227	2	1867.843247	1867.850960	R	D	142	158
PSM	DKDDDLPQFTSAGESFNK	399	sp|Q9CPY7|AMPL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.2818.14	43.66595	3	2012.890271	2012.896330	K	L	44	62
PSM	KISSVQSIVPALEIANAHR	400	sp|P63038|CH60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.2862.3	44.90725	4	2032.131694	2032.142923	K	K	250	269
PSM	YLGTQPEPDIVGLDSGHIR	401	sp|P52196|THTR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.2905.17	46.12843	3	2066.037071	2066.043269	R	G	188	207
PSM	RIQEITEQLDITTSEYEK	402	sp|P63038|CH60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.2875.16	45.28943	3	2195.091671	2195.095758	K	E	370	388
PSM	NHYQAEVFSVNFAESEEAK	403	sp|P07758|A1AT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.2845.15	44.43198	3	2197.984871	2197.991627	K	K	154	173
PSM	TDIANLAEEFK	404	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.3124.9	52.24165	2	1249.611247	1249.619033	R	D	313	324
PSM	MAENLGFLGSLK	405	sp|Q9Z2I8|SUCB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.3193.8	54.17993	2	1278.655647	1278.664209	R	N	208	220
PSM	LDNNTELSFFAK	406	sp|O88844|IDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.3065.11	50.58293	2	1397.674847	1397.682696	K	A	346	358
PSM	FLTEELSLDQDR	407	sp|O35215|DOPD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.3020.8	49.31452	2	1464.699047	1464.709639	K	I	84	96
PSM	VPSENVLGEVGDGFK	408	sp|P50544|ACADV_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.3019.10	49.29678	2	1545.763247	1545.767488	K	V	318	333
PSM	VTLMEEGFNPTVIK	409	sp|O35488|S27A2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.3172.19	53.6061	2	1576.810847	1576.817081	K	D	576	590
PSM	TCEDWVDGISQFK	410	sp|Q8R164|BPHL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30	2-UNIMOD:4	ms_run[1]:scan=1.1.3197.19	54.30408	2	1583.687647	1583.692609	K	Q	205	218
PSM	AIVAIENPADVSVISSR	411	sp|P14206|RSSA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.3128.18	52.36329	2	1739.931247	1739.941764	R	N	64	81
PSM	VFLTTAEVISQQVSDK	412	sp|P06801|MAOX_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.3132.18	52.47605	2	1763.917647	1763.930531	K	H	477	493
PSM	VSHALAEGLGVIACIGEK	413	sp|P17751|TPIS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30	14-UNIMOD:4	ms_run[1]:scan=1.1.3126.7	52.29702	3	1822.960271	1822.961119	K	L	164	182
PSM	ISGETIFVTAPHEATAGIIGVNR	414	sp|Q68FD5|CLH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.3137.13	52.61483	3	2352.235871	2352.243760	R	K	298	321
PSM	TPALIVYGDQDPMGSSSFQHLK	415	sp|Q8VCR7|ABHEB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.3073.16	50.81548	3	2390.153771	2390.157647	K	Q	152	174
PSM	ITSLAQLNAANHDAAIFPGGFGAAK	416	sp|Q9D172|GAL3A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.3197.20	54.30492	3	2454.262271	2454.265558	K	N	115	140
PSM	GGELGLAMASFLK	417	sp|O55137|ACOT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.3498.5	62.71633	2	1292.672647	1292.679859	K	G	234	247
PSM	DLDVAVLVGSMPR	418	sp|P14152|MDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.3636.4	66.6385	2	1370.715447	1370.722786	K	R	80	93
PSM	GLGGVNVEELFGISK	419	sp|Q9Z2V4|PCKGC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.3628.10	66.40657	2	1517.806447	1517.808959	K	E	568	583
PSM	DAVLNAWAEDVDLR	420	sp|P52480|KPYM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.3499.14	62.75255	2	1585.770247	1585.773636	K	V	476	490
PSM	EILVGDVGATITDPFK	421	sp|Q9R0P5|DEST_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.3529.17	63.5991	2	1673.884447	1673.887603	K	H	54	70
PSM	KAQGTGELTQLLNSLCTAIK	422	sp|Q9QXD6|F16P1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30	16-UNIMOD:4	ms_run[1]:scan=1.1.3600.9	65.59685	3	2145.145871	2145.146354	R	A	24	44
PSM	SAPQPSLAATPNPGASQVYAALLPR	423	sp|Q3TNA1|XYLB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.3435.9	60.96252	3	2476.309271	2476.307423	K	Y	510	535
PSM	GLVLIAFSQYLQK	424	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.3700.7	68.44258	2	1478.846447	1478.849701	K	C	45	58
PSM	SINPDEAVAYGAAVQAAILSGDK	425	sp|P63017|HSP7C_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.3753.13	69.92638	3	2259.136871	2259.138292	K	S	362	385
PSM	YDGNVYENLFEWAK	426	sp|Q9R0H0|ACOX1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.3681.12	67.91043	2	1746.785447	1746.788952	R	K	624	638
PSM	EQGYDVIAYLANIGQK	427	sp|P16460|ASSY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.3717.12	68.92635	2	1780.913847	1780.899565	K	E	26	42
PSM	VAVLGASGGIGQPLSLLLK	428	sp|P08249|MDHM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.3736.16	69.45067	2	1792.081847	1792.082221	K	N	27	46
PSM	FVEFFGPGVAQLSIADR	429	sp|P28271|ACOC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.3656.18	67.218	2	1851.945847	1851.951935	K	A	277	294
PSM	LAMQEFMILPVGASSFR	430	sp|P17182|ENOA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.3771.19	70.45103	2	1895.960647	1895.963762	K	E	163	180
PSM	VGDPAEDFGTFFSAVIDAK	431	sp|Q8CHT0|AL4A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.3859.4	72.89688	3	1984.940171	1984.941824	K	A	376	395
PSM	ANYLASPPLVIAYAIAGTVR	432	sp|P28271|ACOC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.3856.5	72.82256	3	2059.140971	2059.146612	R	I	548	568
PSM	AAFDDAIAELDTLSEESYK	433	sp|P62259|1433E_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.3781.4	70.72346	3	2086.952771	2086.958262	K	D	197	216
PSM	DCPVSSYNEWDPLEEVIVGR	434	sp|Q9D964|GATM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30	2-UNIMOD:4	ms_run[1]:scan=1.1.3816.8	71.6918	3	2363.076671	2363.073977	K	A	63	83
PSM	DDAVALVDVIAPSDFVLNSPIAK	435	sp|Q9EPL9|ACOX3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.3866.6	73.09582	3	2368.238171	2368.252593	K	A	635	658
PSM	EADIDGDGQVNYEEFVQMMTAK	436	sp|P0DP26|CALM1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.3763.13	70.21463	3	2489.073071	2489.072656	R	-	128	150
PSM	LTLVCSTAPGPLELDLTGDLESFKK	437	sp|Q99PT1|GDIR1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30	5-UNIMOD:4	ms_run[1]:scan=1.1.3667.12	67.51472	3	2703.403271	2703.404085	R	Q	75	100
PSM	DQFPEVYVPTVFENYVADIEVDGK	438	tr|Q9CR99|Q9CR99_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.3893.4	73.84423	3	2772.320171	2772.317044	K	Q	28	52
PSM	CCAEANPPACYGTVLAEFQPLVEEPK	439	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30	1-UNIMOD:4,2-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.3712.14	68.78692	3	2949.339971	2949.334702	K	N	384	410
PSM	ENGTITAANASTLNDGAAALVLMTAEAAQR	440	sp|Q8QZT1|THIL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	30	1-UNIMOD:27	ms_run[1]:scan=1.1.3912.6	74.36423	3	2927.4392	2926.4452	K	L	271	301
PSM	YPIEHGIITNWDDMEK	441	sp|P62737|ACTA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.2911.15	46.29597	3	1959.913871	1959.903664	K	I	71	87
PSM	QSLETICLLLAYK	442	sp|P62141|PP1B_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	30	1-UNIMOD:28,7-UNIMOD:4	ms_run[1]:scan=1.1.3907.3	74.21951	2	1533.8027	1533.8107	K	I	98	111
PSM	QIEINTISASFGGLASR	443	sp|P51855|GSHB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	30	1-UNIMOD:28	ms_run[1]:scan=1.1.3808.17	71.47777	2	1745.8859	1745.8943	K	T	142	159
PSM	QATVGDVNTDRPGLLDLK	444	sp|P31786|ACBP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	30	1-UNIMOD:28	ms_run[1]:scan=1.1.3126.20	52.30787	2	1893.9725	1893.9791	K	G	34	52
PSM	QLTEHAVEGDCDFHILK	445	sp|P29699|FETUA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	30	1-UNIMOD:28,11-UNIMOD:4	ms_run[1]:scan=1.1.2954.13	47.4946	3	1993.9145	1993.9199	R	Q	104	121
PSM	DIELVMSQANVSR	446	sp|P70670|NACAM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.2982.6	48.27918	2	1461.723247	1460.729328	K	A	2152	2165
PSM	VVAGVAAALAHK	447	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.2225.18	27.20115	2	1105.651647	1105.660778	K	Y	134	146
PSM	VVAGVAAALAHK	448	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.2232.15	27.38888	2	1105.651647	1105.660778	K	Y	134	146
PSM	AIQDAGCQVLK	449	sp|P40936|INMT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29	7-UNIMOD:4	ms_run[1]:scan=1.1.2268.17	28.38027	2	1201.603047	1201.612508	K	C	225	236
PSM	VLEDNSVPQVK	450	sp|Q9D051|ODPB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.2285.9	28.84888	2	1226.641047	1226.650667	K	D	337	348
PSM	VNADEVGGEALGR	451	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.2355.15	30.78477	2	1285.622047	1285.626243	K	L	19	32
PSM	YTDQSGEEEEDYESEEQLQHR	452	sp|Q8K1Z0|COQ9_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.2313.21	29.62838	3	2600.033471	2600.042279	R	I	77	98
PSM	IMDPNIVGNEHYDVAR	453	sp|P56480|ATPB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.2637.12	38.59044	3	1841.865971	1841.873032	R	G	407	423
PSM	ENVLIGEGAGFK	454	sp|P45952|ACADM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.2716.12	40.80307	2	1232.632047	1232.640102	K	I	260	272
PSM	MVVDSAYEVIK	455	sp|P16125|LDHB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.2794.14	42.98772	2	1252.632247	1252.637325	K	L	234	245
PSM	DFTPAAQAAFQK	456	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.2661.7	39.25907	2	1293.628647	1293.635351	K	V	122	134
PSM	SFLVGSAAQSLSK	457	sp|Q9R0H0|ACOX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.2710.16	40.63308	2	1293.684647	1293.692866	R	A	283	296
PSM	HTTIFEVLPEK	458	sp|Q921I1|TRFE_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.2679.16	39.76622	2	1312.694247	1312.702703	K	A	226	237
PSM	EHALLAYTLGVK	459	sp|P10126|EF1A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.2742.15	41.53422	2	1313.726447	1313.734337	R	Q	135	147
PSM	GILAADESVGTMGNR	460	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.2635.18	38.53835	2	1489.714247	1489.719492	K	L	29	44
PSM	LEGTNVQEAQNILK	461	sp|Q9Z2I8|SUCB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.2683.10	39.8757	2	1555.813247	1555.820586	R	S	394	408
PSM	IYQIYEGTAQIQR	462	sp|P45952|ACADM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.2688.20	40.01358	2	1581.807247	1581.815107	K	L	396	409
PSM	APNSPDVLEIEFKK	463	sp|P16460|ASSY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.2756.19	41.9203	2	1585.826447	1585.835174	K	G	216	230
PSM	GGHVNLTMLGAMQVSK	464	sp|Q9D0K2|SCOT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.2771.8	42.33207	3	1641.822371	1641.833082	R	Y	391	407
PSM	DGFNPAHVEAGLYGSR	465	sp|P17563|SBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.2789.10	42.84375	3	1688.783771	1688.790683	K	I	212	228
PSM	ELGATECINPQDYSK	466	sp|P00329|ADH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29	7-UNIMOD:4	ms_run[1]:scan=1.1.2614.19	37.9568	2	1723.766247	1723.772316	K	P	235	250
PSM	VIVVGNPANTNCLTASK	467	sp|P14152|MDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29	12-UNIMOD:4	ms_run[1]:scan=1.1.2628.14	38.33872	3	1756.907771	1756.914169	K	S	126	143
PSM	EVYMGNVIQGGEGQAPTR	468	sp|Q8QZT1|THIL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.2693.21	40.15248	2	1904.897247	1904.905061	K	Q	85	103
PSM	LHTVYQSVELPETHQMLR	469	sp|Q07417|ACADS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.2662.9	39.28945	3	2180.098271	2180.104823	R	Q	25	43
PSM	AGESVLVHGASGGVGLATCQIAR	470	sp|P47199|QOR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29	19-UNIMOD:4	ms_run[1]:scan=1.1.2737.18	41.39513	3	2209.118471	2209.127350	R	A	148	171
PSM	ASGEPVVLSGQITGLTEGQHGFHVHQYGDNTQGCTSAGPHFNPHSK	471	sp|P08228|SODC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29	34-UNIMOD:4	ms_run[1]:scan=1.1.2726.19	41.09278	6	4840.273341	4840.243677	K	K	25	71
PSM	ENPTTFMGHYLHEVAR	472	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.2836.5	44.17305	4	1900.880494	1900.889017	K	R	153	169
PSM	SSGLPITSAVDLEDAAKK	473	sp|Q9Z2I8|SUCB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.2860.12	44.85743	3	1800.935771	1800.946909	K	A	408	426
PSM	YSLEPVAAELK	474	sp|P09411|PGK1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.2848.9	44.5115	2	1218.641647	1218.649604	K	S	76	87
PSM	ALQASALAAWGGK	475	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.2847.12	44.48572	2	1242.664847	1242.672071	R	A	305	318
PSM	TLAFASVDLTNK	476	sp|Q9CQR4|ACO13_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.2939.8	47.08678	2	1278.670647	1278.681967	K	T	112	124
PSM	LEEGPPVTTVLTR	477	sp|P35486|ODPA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.2797.13	43.0711	2	1410.764447	1410.771845	R	E	46	59
PSM	NFHFVHSSADVDSVVSGTLR	478	sp|Q8CHT0|AL4A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.2838.17	44.23972	3	2173.050671	2173.055231	K	S	318	338
PSM	HNDDEQYAWESSAGGSFTVR	479	sp|P07901|HS90A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.2808.19	43.38515	3	2254.947371	2254.951553	K	T	154	174
PSM	VPTPNVSVVDLTCR	480	sp|P16858|G3P_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29	13-UNIMOD:4	ms_run[1]:scan=1.1.2976.18	48.1146	2	1555.798447	1555.802828	R	L	233	247
PSM	VPTPNVSVVDLTCR	481	sp|P16858|G3P_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29	13-UNIMOD:4	ms_run[1]:scan=1.1.2982.7	48.28168	2	1555.798447	1555.802828	R	L	233	247
PSM	VVLAAADLGTEAGVQR	482	sp|Q64105|SPRE_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.2797.19	43.0761	2	1568.844847	1568.852221	K	L	64	80
PSM	GILFVGSGVSGGEEGAR	483	sp|Q9DCD0|6PGD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.2882.21	45.48753	2	1590.790847	1590.800185	K	Y	120	137
PSM	IGVVVGNCYGFVGNR	484	sp|Q9DBM2|ECHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29	8-UNIMOD:4	ms_run[1]:scan=1.1.2945.11	47.25343	2	1609.797447	1609.803496	K	M	464	479
PSM	VTNEPILAFSQGSPER	485	sp|Q8CHT0|AL4A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.2892.20	45.76565	2	1743.872847	1743.879164	K	D	31	47
PSM	VITAFNDGLNHLDSLK	486	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.2981.8	48.2465	3	1755.915371	1755.915549	K	G	68	84
PSM	NPDDITQEEYGEFYK	487	sp|P11499|HS90B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.2901.21	46.01838	2	1846.787847	1846.789740	R	S	292	307
PSM	AAVDAGFVPNDMQVGQTGK	488	sp|Q99LC5|ETFA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.2875.21	45.29362	2	1903.900647	1903.909812	R	I	250	269
PSM	SLGYAYVNFQQPADAER	489	sp|P29341|PABP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.2990.17	48.4997	2	1927.897047	1927.906441	R	A	51	68
PSM	MTDSFTEQADQVTADVGK	490	sp|Q8BVI4|DHPR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.2894.21	45.82235	2	1941.857247	1941.862587	K	L	53	71
PSM	HFIEQGINVCLCQSYAK	491	sp|P05202|AATM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29	10-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.2808.16	43.38265	3	2065.964771	2065.971367	R	N	263	280
PSM	ERVEAVNMAEGIIHDTETK	492	sp|P38647|GRP75_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.2869.15	45.11812	3	2141.041571	2141.042283	K	M	577	596
PSM	GNDISSGTVLSDYVGSGPPSGTGLHR	493	sp|P70296|PEBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.2961.21	47.69887	3	2529.204071	2529.209559	K	Y	94	120
PSM	GRELPTAFDYVEFTR	494	sp|P16546|SPTN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.3112.8	51.90327	3	1799.871071	1799.884249	K	S	2453	2468
PSM	KEPGAYDWSSIVQHACELEGDR	495	sp|P40936|INMT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29	16-UNIMOD:4	ms_run[1]:scan=1.1.3202.9	54.43925	4	2546.148894	2546.149602	K	S	101	123
PSM	FVEGLPINDFSR	496	sp|P14152|MDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.3158.10	53.21357	2	1392.699247	1392.703765	K	E	299	311
PSM	VNLLSFTGSTQVGK	497	sp|Q9DBF1|AL7A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.3069.14	50.70049	2	1449.773247	1449.782744	R	E	267	281
PSM	VLGPLIGVQVPQEK	498	sp|Q61133|GSTT2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.3089.13	51.27103	2	1475.862647	1475.871165	K	V	118	132
PSM	LLLINNAATLGDVSK	499	sp|Q64105|SPRE_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.3146.16	52.87593	2	1540.874047	1540.882458	R	G	96	111
PSM	ALDIAENEMPGLMR	500	sp|P50247|SAHH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.3169.14	53.5183	2	1558.739047	1558.748349	K	M	21	35
PSM	LYTLVLTDPDAPSR	501	sp|P70296|PEBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.3101.18	51.60812	2	1559.812047	1559.819523	K	K	63	77
PSM	VFLTTAEVISQQVSDK	502	sp|P06801|MAOX_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.3126.18	52.3062	2	1763.917647	1763.930531	K	H	477	493
PSM	VCLIGCGFSTGYGSAVK	503	sp|P00329|ADH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29	2-UNIMOD:4,6-UNIMOD:4	ms_run[1]:scan=1.1.3003.19	48.86185	2	1774.830047	1774.838227	K	V	170	187
PSM	LISWYDNEYGYSNR	504	tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.3018.2	49.2582	3	1778.779571	1778.790014	K	V	308	322
PSM	SGNSVTLLVLDGDSYEK	505	sp|Q9JIL4|NHRF3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.3175.20	53.69195	2	1795.881047	1795.883974	K	A	78	95
PSM	VSHALAEGLGVIACIGEK	506	sp|P17751|TPIS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29	14-UNIMOD:4	ms_run[1]:scan=1.1.3114.21	51.96918	2	1822.951447	1822.961119	K	L	164	182
PSM	NALPTPSDDPTALMTDPK	507	sp|P11352|GPX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.3009.15	49.02955	2	1882.891447	1882.898244	R	Y	129	147
PSM	ILATPPQEDAPSVDIANIR	508	sp|P40142|TKT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.3105.11	51.71318	3	2019.053471	2019.063670	K	M	284	303
PSM	AVATLQGEGLSVTGIVCHVGK	509	sp|Q99LB2|DHRS4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29	17-UNIMOD:4	ms_run[1]:scan=1.1.3029.18	49.56743	3	2095.100471	2095.109575	R	A	73	94
PSM	VIISAPSADAPMFVMGVNHEK	510	tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.3140.12	52.70007	3	2212.093871	2212.102046	R	Y	117	138
PSM	FAAEHTIFASNTSSLQITNIANATTR	511	sp|Q61425|HCDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.3173.21	53.63595	3	2778.391571	2778.393672	K	Q	137	163
PSM	ALQLGTLFSPAEALK	512	sp|P42125|ECI1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.3547.12	64.11332	2	1557.870247	1557.876644	R	V	192	207
PSM	APFALQVNTLPLNFDK	513	sp|Q61838|PZP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.3612.17	65.94855	2	1786.959247	1786.961771	K	A	1358	1374
PSM	YVWLVYEQEQPLSCDEPILSNK	514	sp|P70296|PEBP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29	14-UNIMOD:4	ms_run[1]:scan=1.1.3607.21	65.8079	3	2709.304271	2709.299620	R	S	120	142
PSM	YFDSFGDLSSASAIMGNAK	515	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.3507.3	62.96212	3	1979.892371	1979.893493	R	V	42	61
PSM	FLSQPFQVAEVFTGHMGK	516	sp|P56480|ATPB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.3462.6	61.69675	3	2021.992271	2022.003318	R	L	463	481
PSM	WGEAGAEYVVESTGVFTTMEK	517	tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.3597.12	65.51303	3	2290.049471	2290.046365	K	A	85	106
PSM	YHDFGCALLANLFASEGQPGK	518	sp|Q91V76|CK054_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29	6-UNIMOD:4	ms_run[1]:scan=1.1.3646.10	66.92342	3	2294.076371	2294.079003	K	V	149	170
PSM	DLAILLGMLDPVEK	519	sp|O08709|PRDX6_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.3908.4	74.24392	2	1525.839247	1525.842567	R	D	109	123
PSM	IEQLSPFPFDLLLK	520	sp|Q60597|ODO1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.3849.6	72.6197	2	1658.928247	1658.928346	R	E	930	944
PSM	EVGDGTTSVVIIAAELLK	521	sp|P11983|TCPA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.3855.6	72.7959	2	1814.001847	1814.003696	K	N	85	103
PSM	ASDVVLGFAELEGYLQK	522	sp|Q8K157|GALM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.3780.16	70.7062	2	1837.940247	1837.946181	K	Q	52	69
PSM	TVMDDFAQFLDTCCK	523	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29	13-UNIMOD:4,14-UNIMOD:4	ms_run[1]:scan=1.1.3748.15	69.78516	2	1849.770447	1849.768493	K	A	570	585
PSM	TVMDDFAQFLDTCCK	524	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29	13-UNIMOD:4,14-UNIMOD:4	ms_run[1]:scan=1.1.3746.19	69.73283	2	1849.770447	1849.768493	K	A	570	585
PSM	ITVVGVGQVGMACAISILGK	525	sp|P16125|LDHB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29	13-UNIMOD:4	ms_run[1]:scan=1.1.3763.21	70.22131	2	1972.080447	1972.084940	K	S	24	44
PSM	VLDALFPCVQGGTTAIPGAFGCGK	526	sp|P50516|VATA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29	8-UNIMOD:4,22-UNIMOD:4	ms_run[1]:scan=1.1.3674.12	67.70887	3	2435.195471	2435.197738	R	T	233	257
PSM	AFAGDIANQLATDAVQIFGGYGFNTEYPVEK	527	sp|P45952|ACADM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.3933.3	74.89215	4	3305.590494	3305.588074	K	L	359	390
PSM	HIADLAGNPEVILPVPAFNVINGGSHAGNK	528	sp|P17182|ENOA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.3465.11	61.78343	4	3021.570094	3020.583204	R	L	133	163
PSM	AHRFPALTPEQK	529	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	29	1-UNIMOD:1	ms_run[1]:scan=1.1.2310.12	29.53762	3	1435.7442	1435.7562	M	K	2	14
PSM	AHRFPALTPEQK	530	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	29	1-UNIMOD:1	ms_run[1]:scan=1.1.2303.11	29.34593	3	1435.7442	1435.7562	M	K	2	14
PSM	QEPGLGFSFELTEQQK	531	sp|P45952|ACADM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	29	1-UNIMOD:28	ms_run[1]:scan=1.1.3737.14	69.4808	2	1819.8601	1819.8623	K	E	31	47
PSM	CPALYWLSGLTCTEQNFISK	532	sp|Q9R0P3|ESTD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	29	1-UNIMOD:385,1-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.4117.2	77.60635	3	2370.1027	2370.1019	K	S	45	65
PSM	QSPVDIDTATAQHDPALQPLLISYDK	533	sp|P00920|CAH2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	29	1-UNIMOD:28	ms_run[1]:scan=1.1.3658.20	67.27202	3	2818.4024	2818.4020	R	A	28	54
PSM	CIALAQLLVEQNFPAIAIHR	534	sp|Q9Z1N5|DX39B_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	29	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.3953.4	75.27538	3	2259.2108	2259.2193	R	G	300	320
PSM	SNVNDGVAQSTR	535	sp|P17751|TPIS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.1767.21	14.45623	2	1246.581247	1246.590192	K	I	245	257
PSM	KHPDASVNFSEFSK	536	sp|P63158|HMGB1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.2261.15	28.1848	3	1591.753871	1591.763071	K	K	30	44
PSM	KQTALAELVK	537	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.2190.18	26.2368	2	1099.652447	1099.660110	K	H	549	559
PSM	RTALVANTSNMPVAAR	538	sp|P50516|VATA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.2260.20	28.16143	3	1670.879171	1670.888623	K	E	308	324
PSM	AAGCDFNNVVK	539	sp|P52760|RIDA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28	4-UNIMOD:4	ms_run[1]:scan=1.1.2234.13	27.44282	2	1193.542047	1193.549907	K	T	68	79
PSM	DHGGALGPEEFK	540	sp|P57780|ACTN4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.2233.14	27.42083	2	1255.573847	1255.583316	K	A	781	793
PSM	ELISNSSDALDK	541	sp|P07901|HS90A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.2338.14	30.31767	2	1290.622447	1290.630326	R	I	47	59
PSM	AAPAAAAAMAPPGPR	542	sp|Q8BMF4|ODP2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.2335.7	30.23937	2	1318.670447	1318.681590	K	V	392	407
PSM	LVNADGEAVYCK	543	sp|P24270|CATA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28	11-UNIMOD:4	ms_run[1]:scan=1.1.2216.20	26.953	2	1337.620447	1337.628552	K	F	222	234
PSM	ENYGELADCCTK	544	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28	9-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.2261.21	28.18982	2	1458.568047	1458.575530	R	Q	106	118
PSM	EQAGGDATENFEDVGHSTDAR	545	sp|P56395|CYB5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.2307.20	29.46227	3	2204.907971	2204.920647	R	E	53	74
PSM	LLADPTGAFGK	546	sp|P99029|PRDX5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.2725.5	41.05377	2	1088.576847	1088.586610	R	A	145	156
PSM	VAFITGGGTGLGK	547	sp|Q9CQ62|DECR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.2652.14	39.01568	2	1176.641047	1176.650273	K	A	61	74
PSM	TLADAEGDVFR	548	sp|Q9EQ20|MMSA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.2681.14	39.81908	2	1192.569447	1192.572417	K	G	130	141
PSM	ELHDVDLAEVKPLVEK	549	sp|Q62433|NDRG1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.2738.11	41.41795	3	1832.977871	1832.988380	R	G	4	20
PSM	LGGEVSCLVAGTK	550	sp|Q99LC5|ETFA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28	7-UNIMOD:4	ms_run[1]:scan=1.1.2590.16	37.29248	2	1289.656047	1289.664937	R	C	47	60
PSM	MLLQQDLSSYK	551	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.2794.17	42.99022	2	1324.665047	1324.669688	R	F	318	329
PSM	GNPTVEVDLYTAK	552	sp|P17182|ENOA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.2694.18	40.1781	2	1405.703047	1405.708910	R	G	16	29
PSM	GNPTVEVDLYTAK	553	sp|P17182|ENOA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.2687.11	39.98555	2	1405.703047	1405.708910	R	G	16	29
PSM	LEEGPPVTTVLTR	554	sp|P35486|ODPA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.2785.16	42.73432	2	1410.764447	1410.771845	R	E	46	59
PSM	GILAADESVGTMGNR	555	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.2623.21	38.2045	2	1489.714247	1489.719492	K	L	29	44
PSM	HVTIVVGTSGDTGSAAIESVQGSK	556	sp|Q80W22|THNS2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.2627.20	38.31583	3	2299.161671	2299.165569	K	N	134	158
PSM	EIYGQTETGLICR	557	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28	12-UNIMOD:4	ms_run[1]:scan=1.1.2656.7	39.12862	2	1538.733447	1538.739893	R	V	360	373
PSM	APNSPDVLEIEFKK	558	sp|P16460|ASSY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.2768.5	42.24483	3	1585.830671	1585.835174	K	G	216	230
PSM	DTCFSTEGPNLVTR	559	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28	3-UNIMOD:4	ms_run[1]:scan=1.1.2767.20	42.22938	2	1595.718047	1595.724971	K	C	589	603
PSM	AHIMPAEFSSCPLNSDEAVNK	560	sp|Q91V76|CK054_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28	11-UNIMOD:4	ms_run[1]:scan=1.1.2721.19	40.9525	3	2316.042671	2316.051467	K	W	216	237
PSM	KVEFVLDLPK	561	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.2876.9	45.3114	2	1186.689047	1186.696161	R	T	544	554
PSM	QITINDLPVGR	562	sp|P35700|PRDX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.2863.10	44.9418	2	1224.673847	1224.682636	R	S	141	152
PSM	FLASVSTVLTSK	563	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.2960.11	47.66202	2	1251.699847	1251.707454	K	Y	129	141
PSM	FLASVSTVLTSK	564	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.2938.8	47.05715	2	1251.699847	1251.707454	K	Y	129	141
PSM	FLASVSTVLTSK	565	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.2954.9	47.49127	2	1251.699847	1251.707454	K	Y	129	141
PSM	KWDTCAPEVILHAVGGK	566	sp|Q9Z0S1|BPNT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28	5-UNIMOD:4	ms_run[1]:scan=1.1.2983.6	48.30112	3	1879.955771	1879.961454	K	L	245	262
PSM	LADMALALESAR	567	sp|Q07417|ACADS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.2976.13	48.11042	2	1259.646447	1259.654372	K	L	314	326
PSM	EVGADFTIQVGK	568	sp|Q64442|DHSO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.2823.14	43.80919	2	1262.641247	1262.650667	K	E	215	227
PSM	ENPTTFMGHYLHEVAR	569	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.2836.18	44.1839	3	1900.886471	1900.889017	K	R	153	169
PSM	AAIGDTLVQDIR	570	sp|Q9CXN7|PBLD2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.2888.10	45.64565	2	1270.680447	1270.688115	K	Y	142	154
PSM	EGMNIVEAMER	571	sp|P17742|PPIA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.2924.14	46.66198	2	1277.570247	1277.574407	K	F	134	145
PSM	LFDSNNDGKLELTEMAR	572	sp|P12658|CALB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.2887.15	45.62182	3	1951.926371	1951.930941	K	L	153	170
PSM	TGELNFVSCMR	573	sp|Q91V76|CK054_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28	9-UNIMOD:4	ms_run[1]:scan=1.1.2847.16	44.48907	2	1312.580447	1312.590392	R	Q	179	190
PSM	MLLQQDLSSYK	574	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.2796.17	43.04632	2	1324.665047	1324.669688	R	F	318	329
PSM	IAEEFEVELER	575	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.2951.18	47.4164	2	1362.657647	1362.666711	K	G	1044	1055
PSM	VDYAGVTVDELGK	576	sp|P70296|PEBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.2860.19	44.86327	2	1364.677447	1364.682361	R	V	27	40
PSM	LSSLDVVHAALVNK	577	sp|Q91XE0|GLYAT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.2898.4	45.91897	3	1464.822071	1464.830029	K	F	170	184
PSM	SGNIINMSSVASSIK	578	sp|Q8JZV9|BDH2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.2940.11	47.12038	2	1506.764447	1506.771193	K	G	125	140
PSM	LGDVISIQPCPDVK	579	sp|Q01853|TERA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28	10-UNIMOD:4	ms_run[1]:scan=1.1.2893.19	45.79275	2	1539.789847	1539.796680	R	Y	96	110
PSM	ILGADTSVDLEETGR	580	sp|Q03265|ATPA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.2797.20	43.07693	2	1574.772247	1574.778781	R	V	59	74
PSM	AMGAAQVVVTDLSASR	581	sp|Q64442|DHSO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.2992.15	48.54882	2	1574.799847	1574.808641	K	L	194	210
PSM	GILFVGSGVSGGEEGAR	582	sp|Q9DCD0|6PGD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.2888.21	45.65483	2	1590.790847	1590.800185	K	Y	120	137
PSM	IGVVVGNCYGFVGNR	583	sp|Q9DBM2|ECHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28	8-UNIMOD:4	ms_run[1]:scan=1.1.2952.16	47.44217	2	1609.797447	1609.803496	K	M	464	479
PSM	VTNGAFTGEISPGMIK	584	sp|P17751|TPIS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.2899.21	45.96187	2	1620.807047	1620.818143	K	D	120	136
PSM	GWVKPVIGSEYPLEK	585	sp|P47199|QOR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.2814.6	43.54467	3	1700.904971	1700.913758	K	A	295	310
PSM	KGVLFGVPGAFTPGCSK	586	sp|P99029|PRDX5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28	15-UNIMOD:4	ms_run[1]:scan=1.1.2935.6	46.97045	3	1720.892171	1720.897063	K	T	82	99
PSM	VITAFNDGLNHLDSLK	587	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.2994.6	48.59615	3	1755.915371	1755.915549	K	G	68	84
PSM	FDEFFSQGCAPGYEK	588	sp|Q921I1|TRFE_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28	9-UNIMOD:4	ms_run[1]:scan=1.1.2957.20	47.5843	2	1780.728647	1780.740287	K	N	498	513
PSM	NETLGGTCLNVGCIPSK	589	sp|O08749|DLDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28	8-UNIMOD:4,13-UNIMOD:4	ms_run[1]:scan=1.1.2825.21	43.87225	2	1818.855047	1818.860419	K	A	73	90
PSM	NPDDITNEEYGEFYK	590	sp|P07901|HS90A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.2877.20	45.34837	2	1832.770447	1832.774089	R	S	301	316
PSM	HCQEFLGSSEVINWK	591	sp|Q9DCY0|KEG1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28	2-UNIMOD:4	ms_run[1]:scan=1.1.2854.12	44.68533	3	1832.847071	1832.851569	K	Q	84	99
PSM	NTGTEAPDYLATVDVDPK	592	sp|P17563|SBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.2970.21	47.95383	2	1904.896247	1904.900353	R	S	35	53
PSM	VCIDSEHSSDTLLATLNK	593	sp|O08997|ATOX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28	2-UNIMOD:4	ms_run[1]:scan=1.1.2850.16	44.57402	3	2001.959171	2001.967721	K	T	40	58
PSM	HFIEQGINVCLCQSYAK	594	sp|P05202|AATM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28	10-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.2815.15	43.5809	3	2065.964771	2065.971367	R	N	263	280
PSM	IADQCPSSLAIQENANALAR	595	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28	5-UNIMOD:4	ms_run[1]:scan=1.1.2863.14	44.94513	3	2141.051171	2141.053516	R	Y	154	174
PSM	DAGTIAGLNVLR	596	sp|P63017|HSP7C_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.3087.6	51.20837	2	1198.659847	1198.666986	K	I	160	172
PSM	SGAMSQALNFIK	597	sp|Q62468|VILI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.3012.5	49.10025	2	1265.636247	1265.643808	R	A	309	321
PSM	VISTLSVGVDHLALDEIK	598	sp|Q91Z53|GRHPR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.3206.11	54.55552	3	1908.053171	1908.056794	R	K	77	95
PSM	FPVGAALLTGDGR	599	sp|P56389|CDD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.3059.9	50.40795	2	1272.672447	1272.682636	R	I	36	49
PSM	MVLVLQQLEDK	600	sp|Q61133|GSTT2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.3159.6	53.23737	2	1314.712847	1314.721724	R	F	139	150
PSM	LLYAFAEATVPK	601	sp|Q99MN9|PCCB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.3080.12	51.01208	2	1321.725247	1321.728189	K	I	417	429
PSM	DPEGYFHFIGR	602	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.3004.2	48.8757	3	1336.611071	1336.620036	K	S	452	463
PSM	DDGSWEVIEGYR	603	sp|P26443|DHE3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.3157.9	53.18888	2	1424.615247	1424.620824	R	A	125	137
PSM	FTQAGSEVSALLGR	604	sp|P56480|ATPB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.3003.14	48.85769	2	1434.738447	1434.746693	R	I	311	325
PSM	VPSENVLGEVGDGFK	605	sp|P50544|ACADV_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.3026.16	49.48423	2	1545.763247	1545.767488	K	V	318	333
PSM	RAFPAWADTSILSR	606	sp|Q9EQ20|MMSA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.3007.5	48.96218	3	1589.823371	1589.831425	K	Q	88	102
PSM	IIPGFMCQGGDFTR	607	sp|P17742|PPIA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28	7-UNIMOD:4	ms_run[1]:scan=1.1.3088.19	51.24755	2	1597.731647	1597.738119	R	H	56	70
PSM	TSLSPGSGVVTYYLR	608	sp|P28271|ACOC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.3082.18	51.07483	2	1598.823247	1598.830422	K	E	469	484
PSM	YVVVTGITPTPLGEGK	609	sp|Q922D8|C1TC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.3015.7	49.18847	2	1629.899047	1629.897774	K	S	371	387
PSM	GVNLPGAAVDLPAVSEK	610	sp|P52480|KPYM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.3096.17	51.46967	2	1635.872447	1635.883186	K	D	208	225
PSM	SAVYPTSAVQMEAALR	611	sp|Q9D6Y7|MSRA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.3009.13	49.02622	2	1692.842847	1692.850506	R	S	157	173
PSM	ETTDTDTADQVIASFK	612	sp|P57780|ACTN4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.3089.17	51.27438	2	1740.806647	1740.805390	R	V	839	855
PSM	VDLFYLHAPDHSTPVEETLR	613	sp|Q8CG76|ARK72_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.3031.5	49.61223	4	2338.154494	2338.159361	R	A	143	163
PSM	GADFLVTEVENGGSLGSK	614	sp|P52480|KPYM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.3192.19	54.16067	2	1778.860247	1778.868659	K	K	189	207
PSM	KVDFVSGLYTLCGAGDIK	615	sp|O09173|HGD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28	12-UNIMOD:4	ms_run[1]:scan=1.1.3207.8	54.58148	3	1941.980171	1941.987000	K	S	109	127
PSM	FTASAGIQVVGDDLTVTNPK	616	sp|P17182|ENOA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.3163.8	53.34795	3	2032.042871	2032.047686	K	R	307	327
PSM	IPIFSAAGLPHNEIAAQICR	617	sp|P62814|VATB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28	19-UNIMOD:4	ms_run[1]:scan=1.1.3194.15	54.21447	3	2177.135171	2177.141543	K	Q	189	209
PSM	VGSHITGGDIYGIVNENSLIK	618	sp|P50516|VATA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.3101.15	51.6056	3	2185.150571	2185.137898	R	H	143	164
PSM	HTGPGILSMANAGPNTNGSQFFICTAK	619	sp|P17742|PPIA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28	24-UNIMOD:4	ms_run[1]:scan=1.1.3172.21	53.60777	3	2790.322871	2790.321769	K	T	92	119
PSM	LLSHCLLVTLASHHPADFTPAVHASLDK	620	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28	5-UNIMOD:4	ms_run[1]:scan=1.1.3026.8	49.47672	5	3049.586118	3049.580761	K	F	101	129
PSM	VKPIWPIGMFSGYVDNPK	621	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.3489.14	62.46287	3	2047.056971	2047.060105	R	K	415	433
PSM	DLDVAVLVGSMPR	622	sp|P14152|MDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.3649.7	67.00439	2	1370.715447	1370.722786	K	R	80	93
PSM	GLETIASDVVSLASK	623	sp|Q8BMF4|ODP2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.3604.11	65.71357	2	1488.800847	1488.803539	K	A	528	543
PSM	TFVSITPAEVGVLVGK	624	sp|P62962|PROF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.3516.16	63.2234	2	1615.913247	1615.918509	K	D	39	55
PSM	DSLLQDGEFTMDLR	625	sp|P62962|PROF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.3511.15	63.081	2	1638.749447	1638.755937	R	T	76	90
PSM	ALTVPELTQQMFDAK	626	sp|P68372|TBB4B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.3444.13	61.20073	2	1690.851447	1690.860008	R	N	283	298
PSM	HGYPLILYDVFPDVCK	627	sp|Q99L13|3HIDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28	15-UNIMOD:4	ms_run[1]:scan=1.1.3556.6	64.36573	3	1934.954471	1934.960057	K	E	60	76
PSM	VLSSYPINTLVGAPIIYR	628	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.3590.21	65.32542	2	1975.116447	1975.114249	K	M	300	318
PSM	GSASSALELTEEELATAEAVR	629	sp|Q8R0Y6|AL1L1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.3552.8	64.25217	3	2133.042371	2133.043722	K	S	308	329
PSM	AVLTSQETLFGGSDCTGNFCLFK	630	sp|Q921I1|TRFE_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28	15-UNIMOD:4,20-UNIMOD:4	ms_run[1]:scan=1.1.3633.12	66.56233	3	2551.169171	2551.172311	K	S	619	642
PSM	RPLIDQVVQTALSETQDPEEVSVTVK	631	sp|Q68FD5|CLH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.3617.17	66.09325	3	2880.507971	2880.508033	R	A	968	994
PSM	RPLIDQVVQTALSETQDPEEVSVTVK	632	sp|Q68FD5|CLH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.3611.21	65.92302	3	2880.507971	2880.508033	R	A	968	994
PSM	SGDAAIVDMVPGKPMCVESFSDYPPLGR	633	sp|P10126|EF1A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28	16-UNIMOD:4	ms_run[1]:scan=1.1.3479.21	62.18253	3	2994.390671	2994.392551	K	F	396	424
PSM	ELQNLIQELLQAR	634	sp|P12658|CALB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.3831.9	72.11134	2	1566.869447	1566.872956	K	K	35	48
PSM	DAMLNAAFALAADISSK	635	sp|O35459|ECH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.3872.7	73.26002	2	1707.849047	1707.850172	K	S	250	267
PSM	DINLASFIEQVAVSMT	636	sp|P61458|PHS_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.4777.2	82.45603	2	1736.864047	1736.865487	R	-	89	105
PSM	VNPTVFFDITADDEPLGR	637	sp|P17742|PPIA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	28		ms_run[1]:scan=1.1.3684.15	68.00208	2	2004.9837	2004.9787	M	V	2	20
PSM	VAIYMPVSPLAVAAMLACAR	638	sp|Q99NB1|ACS2L_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28	18-UNIMOD:4	ms_run[1]:scan=1.1.3891.4	73.77721	3	2103.101471	2103.104295	R	I	161	181
PSM	TAFDEAIAELDTLNEDSYK	639	sp|P68254|1433T_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.3778.7	70.64105	3	2143.976471	2143.979725	K	D	194	213
PSM	DLDKPFLLPVESVYSIPGR	640	sp|Q8BFR5|EFTU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.3654.6	67.15192	3	2144.148671	2144.151757	R	G	253	272
PSM	INALTAASEAACLIVSVDETIK	641	sp|P80313|TCPH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28	12-UNIMOD:4	ms_run[1]:scan=1.1.3883.4	73.56953	3	2288.188571	2288.193364	R	N	500	522
PSM	IPEFNTIIGQLPDFSAIDLIR	642	sp|P28825|MEP1A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.3892.4	73.81115	3	2371.274171	2371.278748	K	L	231	252
PSM	NSGMPPGAAAIAVLPVTLDTPMNR	643	sp|Q8BVI4|DHPR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.3688.6	68.11485	3	2392.223471	2392.224287	K	K	165	189
PSM	YNLTPTIFFCATPPDDGNLCR	644	sp|Q64442|DHSO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28	10-UNIMOD:4,20-UNIMOD:4	ms_run[1]:scan=1.1.3673.6	67.68024	3	2471.121071	2471.124967	R	F	111	132
PSM	AFELYDQDGNGYIDENELDALLK	645	sp|P12658|CALB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.3792.17	71.03413	3	2644.219871	2644.218058	K	D	194	217
PSM	EQGYDVIAYLANIGQKEDFEEAR	646	sp|P16460|ASSY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.3690.15	68.1728	3	2657.269871	2657.260926	K	K	26	49
PSM	HGEEVTPEDVLSAAMYPDVFAQFK	647	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.3792.18	71.03497	3	2679.251471	2679.252669	R	D	998	1022
PSM	CMALSTAILVGEAK	648	sp|Q9EQ20|MMSA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.3815.7	71.66338	2	1445.7279	1445.7253	R	K	317	331
PSM	EEEIAALVIDNGSGMCK	649	sp|P63260|ACTG_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=1.1.3824.18	71.92292	2	1877.8482	1876.8542	M	A	2	19
PSM	MQLIMLCYNPDFEK	650	sp|P10649|GSTM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28	7-UNIMOD:4	ms_run[1]:scan=1.1.3506.8	62.94515	2	1800.821047	1800.824885	R	Q	109	123
PSM	FNNFSLNLNTNHGHILVDYSK	651	sp|P06745|G6PI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.2942.6	47.17588	3	2447.188571	2446.202957	R	N	37	58
PSM	QVSLLGWSDGGITALIAAAK	652	sp|Q8R164|BPHL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:28	ms_run[1]:scan=1.1.4007.2	76.37125	2	1953.0555	1953.0566	K	Y	132	152
PSM	MFCLQSSQALQVLENSLR	653	sp|Q9DCY0|KEG1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:1,3-UNIMOD:4	ms_run[1]:scan=1.1.3972.2	75.6902	3	2165.0555	2165.0604	-	K	1	19
PSM	LGGSAVISLEGKPL	654	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.2977.11	48.13642	2	1339.763247	1339.771117	K	-	153	167
PSM	ATFEEVSVLGFEEFDK	655	sp|Q9CQM5|TXD17_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:1	ms_run[1]:scan=1.1.3915.2	74.44054	2	1887.8743	1887.8773	M	A	2	18
PSM	RVAEDDEDDDVDTK	656	sp|P26350|PTMA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.1757.16	14.1715	3	1620.663371	1620.675104	K	K	90	104
PSM	KHGGPADEER	657	sp|P08228|SODC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.1563.15	8.802466	2	1094.500447	1094.510485	K	H	71	81
PSM	AAQAHEDIIHGSGK	658	sp|P47199|QOR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.1711.8	12.90208	3	1432.693271	1432.705891	K	T	310	324
PSM	TATPQQAQEVHEK	659	sp|P17751|TPIS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.1715.20	13.01437	2	1465.705847	1465.716121	K	L	226	239
PSM	VVAGVAAALAHK	660	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2231.3	27.35202	3	1105.649771	1105.660778	K	Y	134	146
PSM	VLEACSIACNK	661	sp|P50431|GLYC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27	5-UNIMOD:4,9-UNIMOD:4	ms_run[1]:scan=1.1.2212.17	26.84252	2	1263.587047	1263.595143	K	N	370	381
PSM	ATAGAYIASQTVK	662	sp|O55234|PSB5_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2243.20	27.6931	2	1279.668647	1279.677216	R	K	79	92
PSM	IIYGGSVTGATCK	663	sp|P17751|TPIS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27	12-UNIMOD:4	ms_run[1]:scan=1.1.2285.11	28.85222	2	1325.656047	1325.664937	R	E	257	270
PSM	LVNADGEAVYCK	664	sp|P24270|CATA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27	11-UNIMOD:4	ms_run[1]:scan=1.1.2209.19	26.76128	2	1337.620447	1337.628552	K	F	222	234
PSM	AHSSMVGVNLPQK	665	sp|P09411|PGK1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2186.12	26.11805	3	1366.691171	1366.702719	R	A	172	185
PSM	AGAGSATLSMAYAGAR	666	sp|P08249|MDHM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27	10-UNIMOD:35	ms_run[1]:scan=1.1.2287.16	28.90435	2	1469.678647	1469.693277	K	F	242	258
PSM	AVDNQVYVATASPAR	667	sp|Q9JHW2|NIT2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2363.21	31.00228	2	1560.781647	1560.789620	R	D	196	211
PSM	GAEAANVTGPGGVPVQGSK	668	sp|P62960|YBOX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2281.15	28.74627	2	1694.847647	1694.858763	K	Y	117	136
PSM	ASQRPDVLTTGGGNPIGDK	669	sp|P24270|CATA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2312.17	29.5972	3	1881.944171	1881.954454	R	L	20	39
PSM	LGDVYVNDAFGTAHR	670	sp|P09041|PGK2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2658.5	39.17745	3	1633.778771	1633.784869	K	A	157	172
PSM	SADTLWDIQK	671	sp|P16125|LDHB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2790.15	42.87622	2	1175.576647	1175.582253	K	D	320	330
PSM	LVQAFQFTDK	672	sp|P35700|PRDX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2765.13	42.16777	2	1195.616647	1195.623724	R	H	159	169
PSM	VQQTVQDLFGR	673	sp|P38647|GRP75_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2777.15	42.50563	2	1289.663047	1289.672800	K	A	395	406
PSM	PAACTMLVSSLR	674	sp|Q05920|PYC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27	4-UNIMOD:4	ms_run[1]:scan=1.1.2770.12	42.30692	2	1304.648847	1304.658078	K	D	749	761
PSM	EAAQMDMVNDGVEDLRGK	675	sp|P19157|GSTP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2747.15	41.67193	3	1976.885171	1976.893176	R	Y	86	104
PSM	GAPTTSLVSVAVTK	676	sp|Q9DBF1|AL7A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2646.17	38.85045	2	1329.741847	1329.750381	K	I	219	233
PSM	TVIIEQSWGSPK	677	sp|P63038|CH60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2691.17	40.09343	2	1343.698847	1343.708516	R	V	61	73
PSM	AYSTDVCVPISR	678	sp|Q7TNG8|LDHD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27	7-UNIMOD:4	ms_run[1]:scan=1.1.2591.17	37.32141	2	1366.647647	1366.655101	K	L	363	375
PSM	TTPSVVAFTADGER	679	sp|P38647|GRP75_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2672.19	39.56912	2	1449.702847	1449.709973	R	L	86	100
PSM	SSLATMAHAQSLVEAQPNVDK	680	sp|Q60597|ODO1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2693.15	40.14747	3	2196.073271	2196.084482	R	L	102	123
PSM	HGGTIPVVPTAEFQDR	681	sp|P26443|DHE3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2664.21	39.3473	2	1722.861847	1722.868933	K	I	481	497
PSM	LIGPNCPGVINPGECK	682	sp|Q9WUM5|SUCA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27	6-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=1.1.2657.11	39.15312	2	1723.834047	1723.838562	R	I	167	183
PSM	EDKLECSEELGDLVK	683	sp|Q68FD5|CLH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27	6-UNIMOD:4	ms_run[1]:scan=1.1.2749.17	41.73102	2	1762.822847	1762.829496	K	S	454	469
PSM	HLEINPDHPIVETLR	684	sp|P11499|HS90B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2593.14	37.37442	3	1781.931971	1781.942433	K	Q	625	640
PSM	VGLIGSCTNSSYEDMGR	685	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27	7-UNIMOD:4	ms_run[1]:scan=1.1.2734.21	41.31305	2	1844.795847	1844.803298	R	S	379	396
PSM	EVYMGNVIQGGEGQAPTR	686	sp|Q8QZT1|THIL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2690.15	40.06408	3	1904.899271	1904.905061	K	Q	85	103
PSM	GAGAFGYFEVTHDITR	687	sp|P24270|CATA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2996.6	48.65202	3	1739.820671	1739.826734	K	Y	78	94
PSM	LIDDMVAQAMK	688	sp|O88844|IDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2992.5	48.54047	2	1233.602847	1233.609730	R	S	250	261
PSM	VGDAIPSVEVFEGEPGKK	689	sp|P99029|PRDX5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2833.15	44.09563	3	1856.954171	1856.951994	K	V	54	72
PSM	ENPTTFMGHYLHEVAR	690	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2830.16	44.01073	3	1900.886471	1900.889017	K	R	153	169
PSM	PLRLPLQDVYK	691	sp|P10126|EF1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2798.3	43.0909	3	1340.771471	1340.781622	K	I	245	256
PSM	TLTIVDTGIGMTK	692	sp|P07901|HS90A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2961.15	47.69387	2	1348.717447	1348.727203	R	A	88	101
PSM	IAEEFEVELER	693	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2944.13	47.22478	2	1362.657647	1362.666711	K	G	1044	1055
PSM	KGFIGPGIDVPAPDMSTGER	694	sp|P26443|DHE3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2964.16	47.7802	3	2042.999171	2043.009526	K	E	212	232
PSM	ATSLNSNDVFILK	695	sp|Q62468|VILI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2999.15	48.74485	2	1420.750447	1420.756195	R	T	537	550
PSM	RIQEITEQLDITTSEYEK	696	sp|P63038|CH60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2884.18	45.54035	3	2195.091671	2195.095758	K	E	370	388
PSM	TSNHAIVLAQLITR	697	sp|Q9R0H0|ACOX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2851.3	44.59167	3	1535.866571	1535.878376	K	G	183	197
PSM	AALDGTPGMIGYGMAK	698	sp|Q8BVI4|DHPR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2926.17	46.72152	2	1551.734047	1551.742535	K	G	136	152
PSM	VEVECSSLEEAFR	699	sp|Q91X91|NADC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27	5-UNIMOD:4	ms_run[1]:scan=1.1.2914.19	46.38275	2	1553.695447	1553.703173	K	A	198	211
PSM	ELGEYGLQAYTEVK	700	sp|P47738|ALDH2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2988.13	48.4442	2	1598.776647	1598.782804	R	T	495	509
PSM	AKPVVSFIAGITAPPGR	701	sp|Q9WUM5|SUCA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2988.4	48.43168	3	1679.968571	1679.972276	K	R	279	296
PSM	RIPGGPQMIQLSLDGK	702	sp|P17563|SBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2903.7	46.06372	3	1708.920971	1708.929425	K	R	382	398
PSM	GAGAFGYFEVTHDITR	703	sp|P24270|CATA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2989.13	48.47277	2	1739.823647	1739.826734	K	Y	78	94
PSM	WCQSMQDPSASLLER	704	sp|Q9DC50|OCTC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27	2-UNIMOD:4	ms_run[1]:scan=1.1.2947.10	47.31057	2	1806.796047	1806.802904	R	Q	465	480
PSM	NPDDITQEEYGEFYK	705	sp|P11499|HS90B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2902.21	46.04692	2	1846.787847	1846.789740	R	S	292	307
PSM	KVITAFNDGLNHLDSLK	706	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2806.11	43.32313	3	1884.002771	1884.010512	K	G	67	84
PSM	AATVMLAAGWTHSSPAGFR	707	sp|P11930|NUD19_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2944.10	47.22062	3	1929.948671	1929.951951	R	L	10	29
PSM	LASTLVHLGEYQAAVDGAR	708	sp|Q68FD5|CLH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2884.14	45.537	3	1970.014571	1970.022140	R	K	1227	1246
PSM	DKDDDLPQFTSAGESFNK	709	sp|Q9CPY7|AMPL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2812.17	43.49625	3	2012.890271	2012.896330	K	L	44	62
PSM	TGLSIHEVYGQSETGISSATLR	710	sp|Q91VA0|ACSM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2826.20	43.90007	3	2305.155371	2305.155004	R	E	355	377
PSM	RVIISAPSADAPMFVMGVNHEK	711	tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2918.8	46.48567	4	2368.204494	2368.203157	K	Y	116	138
PSM	AGGLATTGDKDILDIVPTEIHQK	712	sp|Q9QXD6|F16P1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3004.8	48.88072	4	2391.255694	2391.264555	K	A	292	315
PSM	LQYAVISEAWR	713	sp|Q99KP3|CRYL1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3068.12	50.67022	2	1334.693247	1334.698286	R	L	198	209
PSM	VCLLGCGISTGYGAAVNTAK	714	sp|P28474|ADHX_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27	2-UNIMOD:4,6-UNIMOD:4	ms_run[1]:scan=1.1.3033.12	49.67447	3	2010.981971	2010.986683	K	V	169	189
PSM	FESTSILQTLSK	715	sp|Q3UNX5|ACSM3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3046.15	50.04988	2	1352.711247	1352.718747	R	F	300	312
PSM	ALAGCDFLTISPK	716	sp|Q93092|TALDO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27	5-UNIMOD:4	ms_run[1]:scan=1.1.3077.10	50.92393	2	1391.704047	1391.711887	K	L	246	259
PSM	FASEITPITISVK	717	sp|Q8QZT1|THIL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3085.17	51.1606	2	1404.779447	1404.786432	K	G	228	241
PSM	AFVVLAPEFLSHDRDQLTK	718	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3114.16	51.96502	3	2185.150571	2185.153154	K	V	508	527
PSM	YSPIADMLCEAGR	719	sp|Q9DBM2|ECHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27	9-UNIMOD:4	ms_run[1]:scan=1.1.3194.17	54.21613	2	1481.658847	1481.664285	R	F	553	566
PSM	DQGTYEDYVEGLR	720	sp|Q60605|MYL6_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3018.5	49.26822	2	1543.664447	1543.679067	K	V	82	95
PSM	LQLGPETLLQDNPK	721	sp|O09174|AMACR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3093.11	51.38223	2	1564.840047	1564.846073	K	L	87	101
PSM	IIPGFMCQGGDFTR	722	sp|P17742|PPIA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27	7-UNIMOD:4	ms_run[1]:scan=1.1.3094.18	51.41568	2	1597.731647	1597.738119	R	H	56	70
PSM	ISPQSNVDFDLTLR	723	sp|Q9DCS2|MTL26_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3110.18	51.85705	2	1603.811847	1603.820586	K	C	148	162
PSM	VINEPTAAALAYGLDK	724	sp|P38647|GRP75_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3080.19	51.01792	2	1644.864047	1644.872287	R	S	219	235
PSM	VDAILCVAGGWAGGNAK	725	sp|Q8BVI4|DHPR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27	6-UNIMOD:4	ms_run[1]:scan=1.1.3186.12	53.98848	2	1657.818647	1657.824626	K	S	77	94
PSM	IHFPLATYAPVISAEK	726	sp|P05213|TBA1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3124.7	52.23997	3	1755.949271	1755.955957	R	A	265	281
PSM	QVGYENAGTVEFLVDK	727	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3093.17	51.38723	2	1767.858447	1767.867930	K	H	301	317
PSM	LISWYDNEYGYSNR	728	tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3014.13	49.16403	2	1778.780647	1778.790014	K	V	308	322
PSM	GLLSQGSPLSWEETQR	729	sp|P97494|GSH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	27		ms_run[1]:scan=1.1.3122.18	52.19223	2	1786.8784	1786.8845	M	H	2	18
PSM	GSRVEIEAIAVQGPFIK	730	sp|P52760|RIDA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3053.10	50.2422	3	1812.996371	1813.009784	R	A	118	135
PSM	VSHALAEGLGVIACIGEK	731	sp|P17751|TPIS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27	14-UNIMOD:4	ms_run[1]:scan=1.1.3132.7	52.46687	3	1822.960271	1822.961119	K	L	164	182
PSM	VGINYQPPTVVPGGDLAK	732	sp|P05213|TBA1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3040.21	49.88248	2	1823.974647	1823.978149	K	V	353	371
PSM	VGINYQPPTVVPGGDLAK	733	sp|P05213|TBA1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3046.21	50.05488	2	1823.974647	1823.978149	K	V	353	371
PSM	DMHGDSEYNIMFGPDICGPGTK	734	sp|P14211|CALR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27	17-UNIMOD:4	ms_run[1]:scan=1.1.3207.18	54.58983	3	2440.011671	2440.013367	K	K	121	143
PSM	AGAPPGLFNVVQGGAATGQFLCHHR	735	sp|Q9JLJ2|AL9A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27	22-UNIMOD:4	ms_run[1]:scan=1.1.3076.13	50.89791	4	2561.265694	2561.270995	K	E	199	224
PSM	FVFSLVDAMNGK	736	sp|P08249|MDHM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3454.7	61.47912	2	1326.656247	1326.664209	R	E	258	270
PSM	HPDEPVLLEEPVVLALAEK	737	sp|Q9JII6|AK1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3578.9	64.98835	3	2097.140471	2097.135772	R	H	222	241
PSM	NPAIIFEDANLEECIPATVR	738	sp|Q8BH00|AL8A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27	14-UNIMOD:4	ms_run[1]:scan=1.1.3537.15	63.82742	3	2271.115571	2271.120533	K	S	258	278
PSM	AVFVDLEPTVIDEIR	739	sp|P68368|TBA4A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3609.17	65.86197	2	1714.912447	1714.914152	R	N	65	80
PSM	IMEGPAFNFLDAPAVR	740	sp|Q9D051|ODPB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3533.15	63.71233	2	1746.879447	1746.876327	R	V	309	325
PSM	IMEGPAFNFLDAPAVR	741	sp|Q9D051|ODPB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3527.18	63.54245	2	1746.879447	1746.876327	R	V	309	325
PSM	LENYPIPELGPNDVLLK	742	sp|Q64442|DHSO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3538.20	63.86049	2	1923.036247	1923.035330	R	M	22	39
PSM	YFDSFGDLSSASAIMGNAK	743	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3522.21	63.4006	2	1979.888847	1979.893493	R	V	42	61
PSM	LFLYEPAGTETFSVESISK	744	sp|Q91XE4|ACY3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3513.6	63.12926	3	2117.053571	2117.056853	R	N	153	172
PSM	IANDNSLNHEYLPILGLAEFR	745	sp|P05201|AATC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3631.10	66.49686	3	2398.224971	2398.228110	K	S	61	82
PSM	DQSPASHEIATNLGDFAISLYR	746	sp|P07758|A1AT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3579.5	65.0125	3	2404.170971	2404.165903	K	E	36	58
PSM	FLPGAHVFPGGVLDAADSSPDWVR	747	sp|P11930|NUD19_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3456.15	61.54065	3	2509.237871	2509.239009	R	L	40	64
PSM	LNPNFLVDFGKEPLGPALAHELR	748	sp|P17563|SBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3484.8	62.3148	4	2546.366494	2546.364544	K	Y	438	461
PSM	SPWSMDENLMHISYEAGILENPK	749	sp|P16460|ASSY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3586.10	65.21085	3	2660.229671	2660.225075	K	N	177	200
PSM	IDATQVEVNPFGETPEGQVVCFDAK	750	sp|Q9Z2I8|SUCB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27	21-UNIMOD:4	ms_run[1]:scan=1.1.3519.20	63.3132	3	2749.292171	2749.290512	K	I	236	261
PSM	AHCLSEVEHDTMPADLPAIAADFVEDQEVCK	751	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27	3-UNIMOD:4,30-UNIMOD:4	ms_run[1]:scan=1.1.3590.17	65.32208	4	3496.576894	3496.558507	K	N	311	342
PSM	DLTAVSNNAGVDNFGLGLLLR	752	sp|Q9D0K2|SCOT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3839.5	72.33095	3	2158.140971	2158.138232	K	S	84	105
PSM	DYGVLLESAGIALR	753	sp|P20108|PRDX3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3668.4	67.5327	2	1475.790847	1475.798394	R	G	172	186
PSM	EVSVFGAVSELFTR	754	sp|P38060|HMGCL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3812.14	71.58577	2	1539.791047	1539.793309	K	K	123	137
PSM	SAGWVIPIGLLFCK	755	sp|Q921I1|TRFE_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27	13-UNIMOD:4	ms_run[1]:scan=1.1.3844.10	72.47505	2	1559.851047	1559.853407	R	L	144	158
PSM	LPCVEDYLSAILNR	756	sp|P07724|ALBU_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27	3-UNIMOD:4	ms_run[1]:scan=1.1.3807.10	71.4447	2	1661.842847	1661.844693	R	V	470	484
PSM	MGISVLEALGDGEFIK	757	sp|Q9Z2V4|PCKGC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3766.13	70.302	2	1677.864847	1677.864759	R	C	176	192
PSM	VLVCGAGPVGMVTLLVAK	758	sp|Q64442|DHSO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27	4-UNIMOD:4	ms_run[1]:scan=1.1.3703.14	68.53214	2	1783.006247	1783.009984	K	A	176	194
PSM	DIQQWEYVPLGPFLGK	759	sp|P35505|FAAA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3829.7	72.06059	2	1888.970647	1888.972336	R	S	238	254
PSM	AFMTADLPNELIELLEK	760	sp|Q68FD5|CLH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3886.4	73.63721	2	1946.006247	1946.007066	K	I	994	1011
PSM	FVTTEFEPCFDAADFIR	761	sp|Q9D964|GATM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27	9-UNIMOD:4	ms_run[1]:scan=1.1.3724.2	69.10812	3	2063.928071	2063.929879	K	A	244	261
PSM	DMDLIDVNEAFAPQFLSVQK	762	sp|Q8BWT1|THIM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3830.5	72.08075	3	2279.111471	2279.114385	K	A	313	333
PSM	YNLTPTIFFCATPPDDGNLCR	763	sp|Q64442|DHSO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27	10-UNIMOD:4,20-UNIMOD:4	ms_run[1]:scan=1.1.3666.11	67.48423	3	2471.121071	2471.124967	R	F	111	132
PSM	LCYVALDFEQEMATAASSSSLEK	764	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27	2-UNIMOD:4	ms_run[1]:scan=1.1.3734.13	69.38988	3	2549.165771	2549.166557	K	S	216	239
PSM	LRNPPVNSLSLECLTEFTISLEK	765	sp|P42125|ECI1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27	13-UNIMOD:4	ms_run[1]:scan=1.1.3737.13	69.47913	3	2659.396571	2659.389104	K	L	49	72
PSM	LTTPTYGDLNHLVSATMSGVTTCLR	766	sp|P68372|TBB4B_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27	23-UNIMOD:4	ms_run[1]:scan=1.1.3704.14	68.56075	3	2707.336571	2707.330937	K	F	217	242
PSM	SFGTTISPWVVPMDALMPFVVPNPK	767	sp|P35505|FAAA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3924.3	74.66306	3	2729.397371	2729.396103	K	Q	254	279
PSM	LDWSHNFTNMLGYTDPQFTELMR	768	tr|Q80X68|Q80X68_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3780.18	70.7087	3	2815.276271	2815.273422	K	L	234	257
PSM	CLELFSELAEDK	769	sp|P11499|HS90B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.3959.2	75.43265	2	1435.6482	1435.6536	K	E	412	424
PSM	APNSPDVLEIEFK	770	sp|P16460|ASSY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3114.16	51.96502	2	1457.733847	1457.740210	K	K	216	229
PSM	FEALAAHDALVELSGAMNTAACSLMK	771	sp|P97807|FUMH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27	22-UNIMOD:4	ms_run[1]:scan=1.1.3791.17	71.0061	3	2721.311771	2720.297194	K	I	309	335
PSM	QIDDVLSVASVRPAVLQVECHPYLAQNELIAHCHAR	772	sp|Q9JII6|AK1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:28,20-UNIMOD:4,33-UNIMOD:4	ms_run[1]:scan=1.1.3443.14	61.17425	5	4091.0572	4091.0462	R	G	168	204
PSM	VMVAEALDISR	773	sp|Q9Z2I8|SUCB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2860.13	44.85826	2	1202.624047	1202.632909	K	E	141	152
PSM	AAPAPSLISVFSSPQELGASLAQLVAQR	774	sp|Q9CQ60|6PGL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:1	ms_run[1]:scan=1.1.4149.2	77.9449	3	2849.5364	2849.5282	M	A	2	30
PSM	AFELYDQDGNGYIDENELDALLK	775	sp|P12658|CALB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3817.16	71.72622	3	2645.207471	2644.218058	K	D	194	217
PSM	ASGVQVADEVCR	776	sp|Q9R0P5|DEST_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:1,11-UNIMOD:4	ms_run[1]:scan=1.1.2732.16	41.25353	2	1331.6059	1331.6134	M	I	2	14
PSM	QIVLTGILEQVVNCR	777	sp|Q9EQH3|VPS35_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:28,14-UNIMOD:4	ms_run[1]:scan=1.1.3962.6	75.52115	2	1723.9226	1723.9286	K	D	240	255
PSM	GFGHIGIAVPDVYSACK	778	sp|Q9CPU0|LGUL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27	16-UNIMOD:4	ms_run[1]:scan=1.1.3004.7	48.87988	3	1789.876571	1789.882141	R	R	124	141
PSM	QPDGIAVVGIFLK	779	sp|P16015|CAH3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:28	ms_run[1]:scan=1.1.3906.2	74.18906	2	1338.7443	1338.7542	K	I	136	149
PSM	AVLGPLVGAVDQGTSSTR	780	sp|Q64516|GLPK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2992.3	48.5388	3	1727.911571	1726.921363	K	F	7	25
PSM	SNVNDGVAQSTR	781	sp|P17751|TPIS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.1761.21	14.28848	2	1246.581247	1246.590192	K	I	245	257
PSM	DGGGDVAFVK	782	sp|Q921I1|TRFE_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2311.12	29.56522	2	963.457447	963.466161	K	H	216	226
PSM	RHVFGESDELIGQK	783	sp|P17751|TPIS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2192.12	26.28793	3	1613.807471	1613.816169	R	V	150	164
PSM	KQTALAELVK	784	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2196.18	26.40555	2	1099.652447	1099.660110	K	H	549	559
PSM	IDVSVEAASGGK	785	sp|O08749|DLDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2277.17	28.63235	2	1131.566447	1131.577168	K	A	289	301
PSM	ILQEAGADISK	786	sp|Q60866|PTER_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2207.14	26.70332	2	1143.604247	1143.613553	R	T	215	226
PSM	EITALAPSTMK	787	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26	10-UNIMOD:35	ms_run[1]:scan=1.1.2249.15	27.85705	2	1176.597047	1176.606025	K	I	316	327
PSM	AAPAAAAAMAPPGPR	788	sp|Q8BMF4|ODP2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2342.14	30.42718	2	1318.670447	1318.681590	K	V	392	407
PSM	VCVQTVESGAMTK	789	sp|P54071|IDHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26	2-UNIMOD:4	ms_run[1]:scan=1.1.2297.20	29.18387	2	1408.660247	1408.669036	K	D	401	414
PSM	KGNIYSLNEGYAK	790	sp|Q9QXD6|F16P1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2202.5	26.56287	3	1455.728771	1455.735794	K	D	206	219
PSM	QTANVLSGACGLHR	791	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26	10-UNIMOD:4	ms_run[1]:scan=1.1.2234.9	27.4378	3	1482.725171	1482.736145	K	G	92	106
PSM	AAAEVNQEYGLDPK	792	sp|P97807|FUMH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2364.21	31.02972	2	1503.713047	1503.720538	R	I	99	113
PSM	TEQGPQVDETQFK	793	sp|P47738|ALDH2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2294.21	29.09967	2	1505.691247	1505.699802	R	K	358	371
PSM	GDGPVQGTIHFEQK	794	sp|P08228|SODC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2275.11	28.57115	3	1511.726771	1511.736856	K	A	11	25
PSM	IWHHTFYNELR	795	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2318.8	29.7579	3	1514.734571	1514.741882	K	V	85	96
PSM	SALEHSVQCAVDVK	796	sp|P24270|CATA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26	9-UNIMOD:4	ms_run[1]:scan=1.1.2331.9	30.12383	3	1541.744171	1541.750792	R	R	417	431
PSM	RHVFGESDELIGQK	797	sp|P17751|TPIS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2198.18	26.46222	3	1613.807471	1613.816169	R	V	150	164
PSM	KPVDQYEDCYLAR	798	sp|Q921I1|TRFE_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26	9-UNIMOD:4	ms_run[1]:scan=1.1.2338.9	30.31267	3	1655.746571	1655.761357	R	I	252	265
PSM	RALALGGTCTGEHGIGLGK	799	sp|Q7TNG8|LDHD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26	9-UNIMOD:4	ms_run[1]:scan=1.1.2298.17	29.20983	3	1866.965171	1866.973415	R	R	431	450
PSM	VTHLSTLQVGSLSVK	800	sp|Q99KB8|GLO2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2617.7	38.02923	3	1567.879571	1567.893357	K	C	138	153
PSM	LGDPLLEDTR	801	sp|Q9JLJ2|AL9A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2662.5	39.28278	2	1127.574247	1127.582253	K	M	317	327
PSM	QFSYTHICAGASAFGK	802	sp|Q99LC5|ETFA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26	8-UNIMOD:4	ms_run[1]:scan=1.1.2640.13	38.67625	3	1743.796571	1743.803890	K	N	102	118
PSM	VAFITGGGTGLGK	803	sp|Q9CQ62|DECR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2646.15	38.84878	2	1176.641047	1176.650273	K	A	61	74
PSM	TLADAEGDVFR	804	sp|Q9EQ20|MMSA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2689.12	40.03413	2	1192.569447	1192.572417	K	G	130	141
PSM	QVVDSAYEVIK	805	sp|P06151|LDHA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2613.12	37.92813	2	1249.645847	1249.655418	K	L	233	244
PSM	GGDQTTLLVLDK	806	sp|Q9JIL4|NHRF3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2790.17	42.87788	2	1258.669247	1258.676882	K	E	311	323
PSM	MLLQQDLSSYK	807	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2792.15	42.93245	2	1324.665047	1324.669688	R	F	318	329
PSM	TDTDAELDLVSR	808	sp|Q922D8|C1TC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2693.13	40.1458	2	1333.627447	1333.636139	K	L	761	773
PSM	YLILNATQAESK	809	sp|Q9CQV8|1433B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2616.11	38.0073	2	1349.710247	1349.719081	K	V	106	118
PSM	ILLTEPPMNPTK	810	sp|P61161|ARP2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2762.19	42.08905	2	1352.726847	1352.737374	K	N	107	119
PSM	TDFAPQLQSLNK	811	sp|Q8R164|BPHL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2771.19	42.34125	2	1360.690447	1360.698680	K	K	75	87
PSM	CGPGYSTPLEAMK	812	sp|P17563|SBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26	1-UNIMOD:4	ms_run[1]:scan=1.1.2633.18	38.48162	2	1409.622847	1409.631923	K	G	8	21
PSM	VQPIYGGTNEIMK	813	sp|P51174|ACADL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2617.13	38.03925	2	1448.725247	1448.733351	R	E	407	420
PSM	LQAGTVFVNTYNK	814	sp|Q8R0Y6|AL1L1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2644.19	38.79498	2	1453.750247	1453.756529	K	T	853	866
PSM	SQFTITPGSEQIR	815	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2626.20	38.2877	2	1462.734647	1462.741607	K	A	412	425
PSM	FKLEAPDADELPR	816	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2775.6	42.4424	3	1499.751671	1499.762009	K	S	522	535
PSM	GAQFSVNYSQGSLR	817	sp|Q3UNZ8|QORL2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2612.9	37.89952	2	1512.720647	1512.732105	R	D	209	223
PSM	VDGVSAEPTPESWR	818	sp|O35488|S27A2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2615.16	37.98123	2	1528.707447	1528.715787	K	S	198	212
PSM	GENLSLVVHGPGDIR	819	sp|Q64442|DHSO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2665.9	39.36477	3	1561.814471	1561.821255	K	L	7	22
PSM	AIANECQANFISIK	820	sp|Q01853|TERA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26	6-UNIMOD:4	ms_run[1]:scan=1.1.2771.20	42.34208	2	1577.777447	1577.787178	K	G	530	544
PSM	MLLEYTDSSYDEK	821	sp|P10649|GSTM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2773.19	42.39752	2	1592.683847	1592.691605	R	R	19	32
PSM	LGDVYVNDAFGTAHR	822	sp|P09041|PGK2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2659.8	39.201	3	1633.778771	1633.784869	K	A	157	172
PSM	FAAYFQQGDMESNGK	823	sp|P06745|G6PI_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2672.21	39.5708	2	1691.720847	1691.724971	R	Y	348	363
PSM	SSFANQGEICLCTSR	824	sp|Q8BH00|AL8A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26	10-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.2639.21	38.65468	2	1728.751847	1728.755954	R	I	278	293
PSM	VIVVGNPANTNCLTASK	825	sp|P14152|MDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26	12-UNIMOD:4	ms_run[1]:scan=1.1.2622.11	38.16823	3	1756.907771	1756.914169	K	S	126	143
PSM	VPNSGKEEIEAAVEAAR	826	sp|Q8BH00|AL8A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2600.14	37.56727	3	1768.885571	1768.895542	K	E	39	56
PSM	VDATEESDLAQQYGVR	827	sp|P09103|PDIA1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2780.21	42.59553	2	1779.821847	1779.827522	K	G	84	100
PSM	HLEINPDHSIIETLR	828	sp|P07901|HS90A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2739.13	41.44798	3	1785.930371	1785.937347	K	Q	634	649
PSM	SQVFSTAADGQTQVEIK	829	sp|P38647|GRP75_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2631.21	38.42803	2	1807.885847	1807.895208	K	V	469	486
PSM	EVYMGNVIQGGEGQAPTR	830	sp|Q8QZT1|THIL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2689.15	40.03663	3	1904.899271	1904.905061	K	Q	85	103
PSM	LGGSVELVDIGK	831	sp|Q9D1A2|CNDP2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2846.10	44.45592	2	1185.651647	1185.660504	R	Q	55	67
PSM	KVEFVLDLPK	832	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2870.14	45.14603	2	1186.689047	1186.696161	R	T	544	554
PSM	GGAEVQIFAPDVPQMHVIDHTK	833	sp|Q9D172|GAL3A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2991.6	48.51422	4	2388.182894	2388.189616	R	G	71	93
PSM	DSPSVWAAVPGK	834	sp|P62962|PROF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2820.10	43.71977	2	1212.606647	1212.613888	K	T	27	39
PSM	HCQEFLGSSEVINWK	835	sp|Q9DCY0|KEG1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26	2-UNIMOD:4	ms_run[1]:scan=1.1.2848.10	44.51235	3	1832.847071	1832.851569	K	Q	84	99
PSM	ALQASALAAWGGK	836	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2834.12	44.12183	2	1242.664847	1242.672071	R	A	305	318
PSM	FLASVSTVLTSK	837	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2934.11	46.94577	2	1251.699847	1251.707454	K	Y	129	141
PSM	IAATILTSPDLR	838	sp|P05202|AATM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2894.14	45.8165	2	1269.719447	1269.729252	R	K	326	338
PSM	EGMNIVEAMER	839	sp|P17742|PPIA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2918.9	46.4865	2	1277.570247	1277.574407	K	F	134	145
PSM	LKLPAVVTADLR	840	sp|Q9DCW4|ETFB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2877.2	45.33335	3	1294.786271	1294.797272	R	L	175	187
PSM	VLATAFDTTLGGR	841	sp|Q61316|HSP74_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2882.11	45.47918	2	1320.694247	1320.703765	K	K	222	235
PSM	LQSDVVVPVPQSHQVLIK	842	sp|P47199|QOR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2798.17	43.10258	3	1985.125271	1985.130962	K	V	24	42
PSM	LGDGLFLQCCR	843	sp|P70404|IDHG1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26	9-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.2908.14	46.21065	2	1337.612047	1337.622027	K	E	227	238
PSM	LGDGLFLQCCR	844	sp|P70404|IDHG1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26	9-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.2902.12	46.03942	2	1337.612047	1337.622027	K	E	227	238
PSM	GCDVVVIPAGVPR	845	sp|P08249|MDHM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26	2-UNIMOD:4	ms_run[1]:scan=1.1.2876.18	45.3189	2	1337.705647	1337.712556	K	K	92	105
PSM	IEDLELVPVESK	846	sp|Q62468|VILI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2986.6	48.38437	2	1369.729447	1369.734062	R	W	405	417
PSM	LATQLTGPVMPIR	847	sp|P47963|RL13_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2943.7	47.19615	2	1395.778247	1395.790806	K	N	146	159
PSM	CVIAEGDLGIVQK	848	sp|Q9Z0S1|BPNT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26	1-UNIMOD:4	ms_run[1]:scan=1.1.2803.15	43.24313	2	1400.725847	1400.733351	R	T	28	41
PSM	DMGGYSTTTDFIK	849	tr|Q91VA7|Q91VA7_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2906.18	46.15742	2	1434.635447	1434.633696	R	S	361	374
PSM	NISNQLSIGTDISAEHPELR	850	sp|Q8VCA8|SCRN2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2901.17	46.01503	3	2193.100571	2193.102575	R	S	190	210
PSM	PFVELETNLPASR	851	sp|O35215|DOPD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	26		ms_run[1]:scan=1.1.2972.14	48.00232	2	1471.7606	1471.7666	M	I	2	15
PSM	AEDVSAIEIVGGATR	852	sp|Q61699|HS105_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2897.18	45.90287	2	1486.752247	1486.762737	K	I	332	347
PSM	ISSLLEEQFQQGK	853	sp|P62242|RS8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2805.20	43.30302	2	1505.764047	1505.772573	K	L	158	171
PSM	RLENFASLSALYR	854	sp|P11930|NUD19_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2961.3	47.68385	3	1538.811971	1538.820526	R	F	245	258
PSM	MSLQPNEICVIQR	855	sp|O09173|HGD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26	9-UNIMOD:4	ms_run[1]:scan=1.1.2920.21	46.55353	2	1586.789447	1586.790883	K	G	172	185
PSM	ACQSIYPLHDVFVR	856	sp|P97351|RS3A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26	2-UNIMOD:4	ms_run[1]:scan=1.1.2895.8	45.83925	3	1703.837771	1703.845361	K	K	200	214
PSM	AFTTWTANAGIEECR	857	sp|Q9R0H0|ACOX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26	14-UNIMOD:4	ms_run[1]:scan=1.1.2869.20	45.1223	2	1725.772647	1725.778070	K	M	379	394
PSM	AFHGLAGGTGVAFSEVVK	858	sp|Q3TNA1|XYLB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2859.11	44.82788	3	1745.899871	1745.910070	R	S	492	510
PSM	NPDDITNEEYGEFYK	859	sp|P07901|HS90A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2871.21	45.18065	2	1832.770447	1832.774089	R	S	301	316
PSM	AATVMLAAGWTHSSPAGFR	860	sp|P11930|NUD19_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2937.15	47.03562	3	1929.948671	1929.951951	R	L	10	29
PSM	HLNEIDLFHCIDPNDSK	861	sp|Q9R0Q7|TEBP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26	10-UNIMOD:4	ms_run[1]:scan=1.1.2946.14	47.27863	3	2065.949771	2065.952740	K	H	49	66
PSM	GPVTDVAYSHDGAFLAVCDASK	862	sp|O88342|WDR1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26	18-UNIMOD:4	ms_run[1]:scan=1.1.2921.18	46.57975	3	2279.053871	2279.052848	K	V	490	512
PSM	QSKPVTTPEEIAQVATISANGDK	863	sp|P63038|CH60_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2824.20	43.84275	3	2383.216271	2383.223084	K	D	158	181
PSM	AFQFVETHGEVCPANWTPESPTIKPSPTASK	864	sp|P20108|PRDX3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26	12-UNIMOD:4	ms_run[1]:scan=1.1.2985.13	48.36162	4	3412.646094	3412.639792	K	E	219	250
PSM	LLGNMIVIVLGHHLGK	865	tr|A8DUK4|A8DUK4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26	5-UNIMOD:35	ms_run[1]:scan=1.1.3009.2	49.0137	4	1728.998094	1729.007282	R	D	106	122
PSM	VFEFGGPEVLK	866	sp|P47199|QOR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3071.5	50.74995	2	1220.633847	1220.644125	R	L	13	24
PSM	IFNTWLGDPSK	867	sp|P61922|GABT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3050.11	50.16045	2	1276.636847	1276.645188	R	N	378	389
PSM	FVEGLPINDFSR	868	sp|P14152|MDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3165.8	53.40283	2	1392.699247	1392.703765	K	E	299	311
PSM	TDMFQTVDLYEGK	869	sp|P37804|TAGL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3157.12	53.19388	2	1545.699647	1545.702110	K	D	109	122
PSM	YSSPTTIATVMSLSK	870	sp|Q9DBM2|ECHP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3110.16	51.85538	2	1584.797647	1584.806910	R	R	445	460
PSM	AVLVDLEPGTMDSVR	871	sp|P68372|TBB4B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3110.17	51.85622	2	1600.805847	1600.813058	R	S	63	78
PSM	AVLVDLEPGTMDSVR	872	sp|P68372|TBB4B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3103.15	51.66098	2	1600.805847	1600.813058	R	S	63	78
PSM	LEDTLWAGLTDQHVK	873	sp|Q8BWT1|THIM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3026.6	49.47505	3	1724.863571	1724.873350	K	L	144	159
PSM	ETTDTDTADQVIASFK	874	sp|P57780|ACTN4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3095.18	51.4431	2	1740.806647	1740.805390	R	V	839	855
PSM	DGTVTAGNASGVSDGAGAVIIASEDAVKK	875	sp|Q8BWT1|THIM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3062.20	50.50352	3	2659.322171	2659.330068	K	H	242	271
PSM	TIGTGLVTDVPAMTEEDK	876	sp|Q8BFR5|EFTU_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3069.21	50.70633	2	1875.905047	1875.913560	K	N	430	448
PSM	LCNPPVNAISPTVITEVR	877	sp|Q9DBM2|ECHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26	2-UNIMOD:4	ms_run[1]:scan=1.1.3158.21	53.22273	2	1979.046847	1979.050997	R	N	16	34
PSM	GIVDQSQQAYQEAFEISKK	878	sp|P63101|1433Z_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3021.14	49.3473	3	2168.067671	2168.074963	K	E	140	159
PSM	KLQEGTYVMLAGPNFETVAESR	879	sp|P23492|PNPH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3122.15	52.18972	3	2439.211571	2439.210411	R	L	186	208
PSM	QPPFPGLSHGDADPAALPDDVALR	880	sp|P11930|NUD19_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3191.21	54.13408	3	2455.210871	2455.213188	R	I	83	107
PSM	LNCQVIGASVDSHFCHLAWINTPK	881	sp|P35700|PRDX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26	3-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=1.1.3125.13	52.27338	4	2766.334094	2766.337026	K	K	69	93
PSM	LASDLLEWIR	882	sp|P57780|ACTN4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3591.4	65.3389	2	1214.661247	1214.665923	R	R	302	312
PSM	CLYSLINEAFR	883	sp|Q9DBM2|ECHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26	1-UNIMOD:4	ms_run[1]:scan=1.1.3433.3	60.90318	2	1384.669247	1384.680922	R	I	618	629
PSM	LDNLVAIFDINR	884	sp|P40142|TKT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3636.5	66.64017	2	1401.747847	1401.761615	K	L	175	187
PSM	VVGVPVALDLITSGR	885	sp|Q9DBM2|ECHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3561.9	64.51013	2	1494.874047	1494.876979	R	H	140	155
PSM	LMNESLMLVTALNPHIGYDK	886	sp|P97807|FUMH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3503.6	62.86418	3	2258.142371	2258.143911	K	A	445	465
PSM	DVPLGAPLCIIVEK	887	sp|Q8BMF4|ODP2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26	9-UNIMOD:4	ms_run[1]:scan=1.1.3587.5	65.22975	2	1522.838647	1522.842902	R	Q	282	296
PSM	DNVINLEVVLPDGR	888	sp|Q7TNG8|LDHD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3510.11	63.05018	2	1551.819847	1551.825671	R	L	185	199
PSM	FYAYNPLAGGLLTGK	889	sp|Q8CG76|ARK72_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3436.5	60.98185	2	1583.827447	1583.834780	R	Y	230	245
PSM	DFTATFGPLDSLNTR	890	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3525.17	63.48373	2	1653.798847	1653.799851	K	L	1022	1037
PSM	DMLYQVLAAEEPSVR	891	sp|Q64105|SPRE_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3572.17	64.82622	2	1719.849047	1719.850172	R	V	179	194
PSM	LLYECNPIAYVMEK	892	sp|Q9QXD6|F16P1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26	5-UNIMOD:4	ms_run[1]:scan=1.1.3477.20	62.1242	2	1741.839447	1741.841915	R	A	278	292
PSM	LLYECNPIAYVMEK	893	sp|Q9QXD6|F16P1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26	5-UNIMOD:4	ms_run[1]:scan=1.1.3489.21	62.4687	2	1741.839447	1741.841915	R	A	278	292
PSM	LGLDFPNLPYLIDGSHK	894	sp|P10649|GSTM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3637.2	66.66435	3	1897.996271	1897.993799	K	I	53	70
PSM	LENYPIPELGPNDVLLK	895	sp|Q64442|DHSO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3532.20	63.6878	2	1923.036247	1923.035330	R	M	22	39
PSM	VLSSYPINTLVGAPIIYR	896	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3597.5	65.50719	3	1975.121171	1975.114249	K	M	300	318
PSM	AIMTYVSSFYHAFSGAQK	897	sp|P57780|ACTN4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3445.6	61.22237	3	2006.945471	2006.956034	K	A	257	275
PSM	LAPITSDPTEAAAVGAVEASFK	898	sp|P52480|KPYM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3533.7	63.70565	3	2144.097371	2144.100115	R	C	401	423
PSM	VYEGSILEADCDILIPAASEK	899	sp|P26443|DHE3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26	11-UNIMOD:4	ms_run[1]:scan=1.1.3481.13	62.23323	3	2292.115571	2292.119530	K	Q	366	387
PSM	KPLVIIAEDVDGEALSTLVLNR	900	sp|P63038|CH60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3642.6	66.81005	3	2364.321071	2364.326427	R	L	269	291
PSM	FAELVYTGFWHSPECEFVR	901	sp|P16460|ASSY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26	15-UNIMOD:4	ms_run[1]:scan=1.1.3474.15	62.03437	3	2373.087371	2373.088839	K	H	317	336
PSM	FLPGAHVFPGGVLDAADSSPDWVR	902	sp|P11930|NUD19_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3463.12	61.72928	3	2509.237871	2509.239009	R	L	40	64
PSM	AGWTIVTPPTPVIPDDHPLWMSSK	903	sp|Q9D964|GATM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3620.9	66.1783	3	2644.337171	2644.335946	K	W	333	357
PSM	EIENLILNDPDFQHEDYNFLTR	904	sp|Q9R0H0|ACOX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3609.21	65.86532	3	2734.288571	2734.287475	R	S	35	57
PSM	AHCLSEVEHDTMPADLPAIAADFVEDQEVCK	905	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26	3-UNIMOD:4,30-UNIMOD:4	ms_run[1]:scan=1.1.3570.16	64.76852	4	3496.576894	3496.558507	K	N	311	342
PSM	SDDHVVSGTLVTPLPAVLGHEGAGIVESVGEGVTCVKPGDK	906	sp|P00329|ADH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26	35-UNIMOD:4	ms_run[1]:scan=1.1.3479.13	62.17585	5	4082.077118	4082.063025	R	V	49	90
PSM	DSTLIMQLLR	907	sp|O70456|1433S_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3665.5	67.45197	2	1188.647247	1188.653644	K	D	215	225
PSM	ITVVGVGQVGMACAISILGK	908	sp|P16125|LDHB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26	13-UNIMOD:4	ms_run[1]:scan=1.1.3769.5	70.38195	3	1972.081271	1972.084940	K	S	24	44
PSM	ALGVLAQLIWSR	909	sp|Q9CZU6|CISY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3723.2	69.0788	2	1325.774647	1325.781956	R	A	429	441
PSM	TSDLIVLGLPWK	910	sp|Q921F2|TADBP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3652.6	67.0896	2	1340.763847	1340.770388	K	T	103	115
PSM	DYGVLLESAGIALR	911	sp|P20108|PRDX3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3675.11	67.73448	2	1475.790847	1475.798394	R	G	172	186
PSM	AAGVSVEPFWPGLFAK	912	sp|P47955|RLA1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3716.12	68.89516	2	1674.872047	1674.876979	K	A	34	50
PSM	NNSNDIVNAIMELTM	913	sp|P70670|NACAM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3992.2	76.10928	2	1677.766047	1677.770207	K	-	2173	2188
PSM	ILQSSSEVGYDAMLGDFVNMVEK	914	sp|P63038|CH60_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3814.16	71.64332	3	2531.193671	2531.192377	K	G	494	517
PSM	EFGIADPEEIMWFK	915	sp|Q9R0H0|ACOX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3784.6	70.81396	2	1710.789647	1710.796345	R	K	76	90
PSM	VLVCGAGPVGMVTLLVAK	916	sp|Q64442|DHSO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26	4-UNIMOD:4	ms_run[1]:scan=1.1.3710.13	68.72575	2	1783.006247	1783.009984	K	A	176	194
PSM	DYTGEDVTPENFLAVLR	917	sp|O89017|LGMN_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3801.21	71.29082	2	1937.929647	1937.937072	K	G	104	121
PSM	VGDPAEDFGTFFSAVIDAK	918	sp|Q8CHT0|AL4A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3858.9	72.88412	2	1984.941647	1984.941824	K	A	376	395
PSM	DLDKPFLLPVESVYSIPGR	919	sp|Q8BFR5|EFTU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3660.7	67.31602	3	2144.148671	2144.151757	R	G	253	272
PSM	TDVNKIEEFLEEVLCPPK	920	sp|Q9QYB1|CLIC4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26	15-UNIMOD:4	ms_run[1]:scan=1.1.3853.7	72.73155	3	2159.079971	2159.082023	K	Y	86	104
PSM	EVAAFAQFGSDLDAATQQLLSR	921	sp|Q03265|ATPA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3824.8	71.91457	3	2337.153371	2337.160090	R	G	442	464
PSM	VTLTLPVLNAAQSIIFVATGEGK	922	sp|Q9CQ60|6PGL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3917.3	74.50563	3	2341.324571	2341.325698	R	A	186	209
PSM	LGAGYPMGPFELLDYVGLDTTK	923	sp|Q61425|HCDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3876.4	73.37347	3	2356.161671	2356.166086	K	F	250	272
PSM	TALLDAAGVASLLTTAEAVVTEIPK	924	sp|P63038|CH60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.4053.2	76.9154	3	2453.366171	2453.362872	R	E	527	552
PSM	GATLVCAWAEEGADALGPDGQLLHSDAFPPPR	925	sp|P97328|KHK_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26	6-UNIMOD:4	ms_run[1]:scan=1.1.3684.11	67.9954	4	3317.594094	3317.577526	K	V	218	250
PSM	EFVEEFIWPAVQSSALYEDR	926	sp|P16460|ASSY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:27	ms_run[1]:scan=1.1.3990.2	76.04708	3	2396.1359	2396.1320	K	Y	67	87
PSM	DDDIAALVVDNGSGMCK	927	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=1.1.3684.14	68.00042	2	1820.7933	1820.7915	M	A	2	19
PSM	RQLLQEEVGPVGVETMR	928	sp|Q7TNG8|LDHD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2742.13	41.53255	3	1941.023171	1940.014946	K	Q	450	467
PSM	ACSEFSFHMPSLEELAEVLQK	929	sp|Q91V76|CK054_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:1,2-UNIMOD:4	ms_run[1]:scan=1.1.3904.8	74.13605	3	2493.1580	2493.1551	M	G	2	23
PSM	CIGAIAMTEPGAGSDLQGVR	930	sp|P51174|ACADL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.3693.20	68.26006	2	1984.9343	1984.9341	K	T	166	186
PSM	CVIAEGDLGIVQK	931	sp|Q9Z0S1|BPNT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.3503.4	62.85918	2	1383.6991	1383.7063	R	T	28	41
PSM	TPILLGSLAHQIYR	932	sp|Q99L13|3HIDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3071.3	50.74828	3	1580.890571	1580.903862	K	M	297	311
PSM	VADALANAAGHLDDLPGALSALSDLHAHK	933	tr|Q91VB8|Q91VB8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3503.5	62.86168	4	2863.446094	2862.462420	K	L	63	92
PSM	GVTFNVTTVDTK	934	sp|Q9Z1Q5|CLIC1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2635.15	38.53585	2	1280.652247	1280.661232	K	R	38	50
PSM	MDPLSELQDDLTLDDTSQALNQLK	935	sp|Q5FWK3|RHG01_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:1	ms_run[1]:scan=1.1.3975.3	75.77399	3	2744.3069	2744.3057	-	L	1	25
PSM	QLDSGLLLVTGPLVINR	936	sp|P47911|RL6_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:28	ms_run[1]:scan=1.1.3940.5	75.07563	2	1790.0244	1790.0297	K	V	175	192
PSM	CANLFEALVGTLK	937	sp|Q4KML4|ABRAL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.4050.3	76.83525	2	1417.7229	1417.7270	R	A	39	52
PSM	CIESLIAVFQK	938	sp|P50543|S10AB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.3971.2	75.66241	2	1289.6621	1289.6684	R	Y	8	19
PSM	MQNDAGEFVDLYVPR	939	sp|Q9CQR2|RS21_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:1	ms_run[1]:scan=1.1.3795.17	71.119	2	1794.8192	1794.8242	-	K	1	16
PSM	MVDDGSGEVQVWR	940	sp|Q62468|VILI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2705.18	40.49253	2	1477.655447	1476.666728	K	I	392	405
PSM	SAEAAAEATK	941	sp|Q8VC30|TKFC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.1643.14	11.01122	2	947.446647	947.455990	K	N	526	536
PSM	AKPAETPAPAHK	942	sp|Q9D2G2|ODO2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.1576.21	9.16285	2	1216.648647	1216.656421	K	A	154	166
PSM	TGSQGQCTQVR	943	sp|P62858|RS28_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25	7-UNIMOD:4	ms_run[1]:scan=1.1.1633.21	10.74415	2	1220.545047	1220.556784	R	V	21	32
PSM	PNMVTAGHACTK	944	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25	10-UNIMOD:4	ms_run[1]:scan=1.1.1730.20	13.4232	2	1285.579847	1285.590726	K	K	231	243
PSM	TPVEPEVAIHR	945	sp|P60867|RS20_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2187.4	26.14	3	1246.655771	1246.666986	K	I	9	20
PSM	KQTALAELVK	946	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2191.16	26.26328	2	1099.652447	1099.660110	K	H	549	559
PSM	SDDIINSSGYR	947	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2316.19	29.71078	2	1225.550447	1225.557495	R	I	463	474
PSM	SDDIINSSGYR	948	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2322.17	29.87745	2	1225.550447	1225.557495	R	I	463	474
PSM	YSTDVSVDEVK	949	sp|P26443|DHE3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2344.18	30.48255	2	1240.572847	1240.582313	R	A	152	163
PSM	TCAELVQEAAR	950	sp|Q8VDK1|NIT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25	2-UNIMOD:4	ms_run[1]:scan=1.1.2237.18	27.52662	2	1246.586447	1246.597586	K	L	62	73
PSM	YVGSMVADIHR	951	sp|Q9QXD6|F16P1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2317.11	29.73232	3	1246.602971	1246.612842	R	T	245	256
PSM	VNADEVGGEALGR	952	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2234.16	27.44782	2	1285.614847	1285.626243	K	L	19	32
PSM	ICNQVLVCER	953	sp|Q9Z2I9|SUCB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25	2-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.2274.20	28.55048	2	1289.612447	1289.622027	R	K	151	161
PSM	EGASEEEINLSK	954	sp|Q8VCC2|EST1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2225.20	27.20282	2	1304.603047	1304.609590	K	M	481	493
PSM	DLGLAQDSATSTK	955	sp|Q99L13|3HIDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2298.19	29.2115	2	1305.631047	1305.641225	K	T	284	297
PSM	DLGLAQDSATSTK	956	sp|Q99L13|3HIDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2304.17	29.37822	2	1305.631047	1305.641225	K	T	284	297
PSM	AIVAGDQNVEYK	957	sp|P97447|FHL1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2230.14	27.34013	2	1305.644847	1305.656481	K	G	107	119
PSM	EDQTEYLEER	958	sp|P07901|HS90A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2272.18	28.49245	2	1310.554047	1310.562640	K	R	192	202
PSM	INVYYNEATGGK	959	sp|P68372|TBB4B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2341.16	30.40187	2	1327.632247	1327.640831	R	Y	47	59
PSM	VVAGVAAALAHKYH	960	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2334.7	30.20328	3	1405.773071	1405.783019	K	-	134	148
PSM	ADFAQACQDAGVR	961	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25	7-UNIMOD:4	ms_run[1]:scan=1.1.2298.21	29.21317	2	1407.615447	1407.620112	R	F	125	138
PSM	LAQAAQSSVATITR	962	sp|P26039|TLN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2289.21	28.96178	2	1415.767047	1415.773242	K	L	2044	2058
PSM	AAAEVNQEYGLDPK	963	sp|P97807|FUMH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2357.16	30.84015	2	1503.713047	1503.720538	R	I	99	113
PSM	TEQGPQVDETQFK	964	sp|P47738|ALDH2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2287.17	28.90602	2	1505.691247	1505.699802	R	K	358	371
PSM	GDGPVQGTIHFEQK	965	sp|P08228|SODC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2269.21	28.41122	2	1511.727447	1511.736856	K	A	11	25
PSM	SDFDPGQDTYQHPPK	966	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2220.18	27.06295	3	1730.745071	1730.753629	R	D	535	550
PSM	HSENILYVSSETIKK	967	sp|Q91XE0|GLYAT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2309.17	29.51425	3	1746.906371	1746.915215	K	L	128	143
PSM	AVDNQVYVATASPARDDK	968	sp|Q9JHW2|NIT2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2207.18	26.70917	3	1918.923971	1918.938469	R	A	196	214
PSM	LPAVVTADLR	969	sp|Q9DCW4|ETFB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2730.5	41.1898	2	1053.608447	1053.618245	K	L	177	187
PSM	LLADPTGAFGK	970	sp|P99029|PRDX5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2732.8	41.24685	2	1088.576847	1088.586610	R	A	145	156
PSM	LGDPLLEDTR	971	sp|Q9JLJ2|AL9A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2655.9	39.09575	2	1127.574247	1127.582253	K	M	317	327
PSM	HGYIGEFEIIDDHR	972	sp|P62245|RS15A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2707.14	40.54598	3	1699.785071	1699.795434	K	A	44	58
PSM	SEGGFIWACK	973	sp|O88844|IDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25	9-UNIMOD:4	ms_run[1]:scan=1.1.2759.10	41.9972	2	1153.514447	1153.522630	K	N	261	271
PSM	IALTDNSLIAR	974	sp|P14148|RL7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2788.13	42.81778	2	1185.660047	1185.671737	R	S	189	200
PSM	HLGLPVFNTVK	975	sp|Q9WUM5|SUCA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2745.12	41.61503	2	1223.694447	1223.702643	K	E	95	106
PSM	LTGSLSGWTSPK	976	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2621.10	38.1395	2	1232.631047	1232.640102	K	D	234	246
PSM	DGNGYISAAELR	977	sp|P0DP26|CALM1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2682.11	39.84362	2	1264.596847	1264.604780	K	H	96	108
PSM	LGGEVSCLVAGTK	978	sp|Q99LC5|ETFA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25	7-UNIMOD:4	ms_run[1]:scan=1.1.2603.15	37.65133	2	1289.656047	1289.664937	R	C	47	60
PSM	SFLVGSAAQSLSK	979	sp|Q9R0H0|ACOX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2716.15	40.80556	2	1293.684647	1293.692866	R	A	283	296
PSM	TVIIEQSWGSPK	980	sp|P63038|CH60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2684.10	39.90103	2	1343.698847	1343.708516	R	V	61	73
PSM	HFSVEGQLEFR	981	sp|P07901|HS90A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2647.18	38.87963	2	1347.649847	1347.657149	K	A	329	340
PSM	TGQQAEPLVVDLK	982	sp|P98078|DAB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2723.15	41.00655	2	1396.745247	1396.756195	K	D	151	164
PSM	ETSIIGVSLSSSTK	983	sp|P47199|QOR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2786.19	42.7655	2	1407.738047	1407.745690	K	E	265	279
PSM	IVLDNSVFSEHR	984	sp|Q68FD5|CLH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2628.6	38.33204	3	1414.710971	1414.720478	K	N	1011	1023
PSM	TINEVENQILTR	985	sp|P57780|ACTN4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2754.19	41.86508	2	1428.746447	1428.757257	R	D	747	759
PSM	TINEVENQILTR	986	sp|P57780|ACTN4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2757.17	41.9467	2	1428.746447	1428.757257	R	D	747	759
PSM	GDVTTQVALQPALK	987	sp|P09671|SODM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2697.17	40.26262	2	1439.790447	1439.798394	K	F	76	90
PSM	LVSSENFDDYMK	988	sp|P04117|FABP4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2794.20	42.99273	2	1446.629647	1446.633696	K	E	11	23
PSM	AQQVSQGLDVLTAK	989	sp|Q64727|VINC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2672.20	39.56995	2	1456.780647	1456.788558	K	V	353	367
PSM	SSLATMAHAQSLVEAQPNVDK	990	sp|Q60597|ODO1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2699.19	40.3217	3	2196.073271	2196.084482	R	L	102	123
PSM	THLPGFVEQAGALK	991	sp|P99029|PRDX5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2657.3	39.1431	3	1466.781671	1466.788164	K	A	99	113
PSM	ASAELALGENNEVLK	992	sp|P05202|AATM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2723.19	41.00988	2	1556.796247	1556.804602	K	S	108	123
PSM	GENLSLVVHGPGDIR	993	sp|Q64442|DHSO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2658.8	39.18497	2	1561.814447	1561.821255	K	L	7	22
PSM	LQCTYIEVEQVGK	994	sp|Q8VCA8|SCRN2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25	3-UNIMOD:4	ms_run[1]:scan=1.1.2693.19	40.15082	2	1565.767247	1565.775944	R	T	57	70
PSM	NAVTQEFGPVPDTAR	995	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2678.20	39.74118	2	1600.778047	1600.784535	R	Y	634	649
PSM	LGVEFDEITADDRK	996	sp|P04117|FABP4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2732.7	41.24602	3	1606.775771	1606.783866	K	V	67	81
PSM	QDLPNAMNAAEITDK	997	sp|P61205|ARF3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2764.21	42.14648	2	1629.753247	1629.766836	K	L	128	143
PSM	NQVAMNPTNTVFDAK	998	sp|P63017|HSP7C_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2676.21	39.6851	2	1648.781447	1648.787906	K	R	57	72
PSM	WIDIHNPATNEVVGR	999	sp|Q9EQ20|MMSA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2762.12	42.0832	3	1719.859871	1719.869268	K	V	56	71
PSM	DVRPITEQIAVTAGCK	1000	sp|Q91WU0|CES1F_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25	15-UNIMOD:4	ms_run[1]:scan=1.1.2678.14	39.73617	3	1756.916771	1756.914169	K	T	259	275
PSM	FAREEIIPVAPEYDK	1001	sp|P45952|ACADM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2752.12	41.80475	3	1775.899871	1775.909401	K	S	55	70
PSM	SQVFSTAADGQTQVEIK	1002	sp|P38647|GRP75_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2637.21	38.59795	2	1807.885847	1807.895208	K	V	469	486
PSM	EVYMGNVIQGGEGQAPTR	1003	sp|Q8QZT1|THIL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2688.14	40.00858	3	1904.899271	1904.905061	K	Q	85	103
PSM	ALQHIICQLGGTVCDGEK	1004	sp|Q9D826|SOX_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25	7-UNIMOD:4,14-UNIMOD:4	ms_run[1]:scan=1.1.2771.18	42.3404	3	1997.953871	1997.966281	R	V	157	175
PSM	TSRPENAIIYSNNEDFQVGQAK	1005	sp|P40142|TKT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2629.21	38.3724	3	2480.185271	2480.193181	R	V	472	494
PSM	VADIGLAAWGR	1006	sp|P50247|SAHH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2983.3	48.2961	2	1127.599847	1127.608743	K	K	9	20
PSM	IDTIEIITDR	1007	sp|O88569|ROA2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2955.8	47.51818	2	1187.631247	1187.639768	K	Q	138	148
PSM	HNVMVSTEWAAPNVFK	1008	sp|P17563|SBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2971.4	47.96678	3	1828.884971	1828.893040	R	D	196	212
PSM	NIEDVIAQGVGK	1009	tr|A0A5F8MPY2|A0A5F8MPY2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2954.8	47.49043	2	1241.652047	1241.661566	K	L	50	62
PSM	GAAFLGLGTDSVR	1010	sp|Q9DBE0|CSAD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2933.12	46.91782	2	1262.654447	1262.661900	K	V	197	210
PSM	AETFTFHSDICTLPEK	1011	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25	11-UNIMOD:4	ms_run[1]:scan=1.1.2811.14	43.46517	3	1894.885271	1894.877115	K	E	528	544
PSM	FNPETDFLTGK	1012	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2960.12	47.66285	2	1267.602447	1267.608468	K	D	507	518
PSM	LCLTGQWEAAQELQHR	1013	sp|Q9DCU9|HOGA1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25	2-UNIMOD:4	ms_run[1]:scan=1.1.2888.11	45.64648	3	1938.931271	1938.937030	R	L	250	266
PSM	NSLESYAFNMK	1014	sp|P63017|HSP7C_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2841.10	44.31715	2	1302.582647	1302.591438	K	A	540	551
PSM	NNLAGAEELFAR	1015	sp|Q68FD5|CLH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2919.14	46.51908	2	1303.644447	1303.652064	R	K	355	367
PSM	FAELAQIYAQR	1016	sp|Q9JHW2|NIT2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2901.15	46.01337	2	1308.674847	1308.682636	R	G	158	169
PSM	ASLQNLLSASQAR	1017	sp|P35505|FAAA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2861.15	44.8886	2	1357.723047	1357.731377	R	L	83	96
PSM	GFVDDIIQPSSTR	1018	sp|Q99MN9|PCCB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2995.17	48.63315	2	1433.703047	1433.715058	R	A	502	515
PSM	GLIDEANQDFTNR	1019	sp|E9PV24|FIBA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2800.20	43.16187	2	1491.690847	1491.695386	K	I	73	86
PSM	GLEVTAYSPLGSSDR	1020	sp|Q9JII6|AK1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2894.20	45.82152	2	1550.751247	1550.757651	R	A	204	219
PSM	DVMICPDTSLEDAK	1021	sp|Q99LX0|PARK7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25	5-UNIMOD:4	ms_run[1]:scan=1.1.2878.19	45.37532	2	1592.699447	1592.706210	R	T	49	63
PSM	VTNGAFTGEISPGMIK	1022	sp|P17751|TPIS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2893.21	45.79442	2	1620.807047	1620.818143	K	D	120	136
PSM	VGVPSDPSANMGALISK	1023	sp|Q8BH00|AL8A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2964.20	47.78355	2	1641.832047	1641.839607	K	A	316	333
PSM	NIAFFSTNCVEGTAR	1024	sp|Q8VDN2|AT1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25	9-UNIMOD:4	ms_run[1]:scan=1.1.2974.8	48.05737	2	1685.775647	1685.783155	R	G	241	256
PSM	KGVLFGVPGAFTPGCSK	1025	sp|P99029|PRDX5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25	15-UNIMOD:4	ms_run[1]:scan=1.1.2923.8	46.62853	3	1720.892171	1720.897063	K	T	82	99
PSM	LAEMPADSGYPAYLGAR	1026	sp|P50516|VATA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2974.9	48.05987	2	1780.838247	1780.845421	R	L	365	382
PSM	GENHCGIESEIVAGIPR	1027	sp|P10605|CATB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25	5-UNIMOD:4	ms_run[1]:scan=1.1.2812.12	43.49208	3	1836.870971	1836.878846	R	T	315	332
PSM	NPDDITQEEYGEFYK	1028	sp|P11499|HS90B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2908.21	46.21648	2	1846.787847	1846.789740	R	S	292	307
PSM	YADLTEDQLPSCESLK	1029	sp|Q9DBJ1|PGAM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25	12-UNIMOD:4	ms_run[1]:scan=1.1.2856.21	44.75025	2	1867.843247	1867.850960	R	D	142	158
PSM	QATLGAGLPISTPCTTVNK	1030	sp|Q8QZT1|THIL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25	14-UNIMOD:4	ms_run[1]:scan=1.1.2931.21	46.86782	2	1928.002047	1928.003713	R	V	103	122
PSM	HLLPLVQCPTLIVHGEK	1031	sp|Q8R164|BPHL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25	8-UNIMOD:4	ms_run[1]:scan=1.1.2866.16	45.03275	3	1953.080771	1953.086989	R	D	227	244
PSM	HLLPLVQCPTLIVHGEK	1032	sp|Q8R164|BPHL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25	8-UNIMOD:4	ms_run[1]:scan=1.1.2872.14	45.20352	3	1953.080771	1953.086989	R	D	227	244
PSM	CIGAIAMTEPGAGSDLQGVR	1033	sp|P51174|ACADL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25	1-UNIMOD:4	ms_run[1]:scan=1.1.2972.18	48.00815	2	2001.953447	2001.961196	K	T	166	186
PSM	DCGIPLSHLQVDGGMTSNK	1034	sp|Q64516|GLPK_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25	2-UNIMOD:4	ms_run[1]:scan=1.1.2864.17	44.97633	3	2027.927171	2027.940460	R	I	420	439
PSM	KLNCQVIGASVDSHFCHLAWINTPK	1035	sp|P35700|PRDX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25	4-UNIMOD:4,16-UNIMOD:4	ms_run[1]:scan=1.1.2950.14	47.38585	4	2894.440494	2894.431989	K	K	68	93
PSM	DIFAMDDKSENEPIENEAAR	1036	sp|Q9Z2I8|SUCB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2843.19	44.37971	3	2293.014071	2293.016856	K	Y	273	293
PSM	ENVHVFEVEGNSDELDEPIK	1037	sp|Q80W22|THNS2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2893.18	45.79192	3	2298.063371	2298.065186	K	A	184	204
PSM	IAIDAGFHHFDSASVYNTEDHVGEAIR	1038	sp|Q91WR5|AK1CL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2919.19	46.52325	4	2970.394894	2970.389649	K	S	40	67
PSM	LGEYGFQNAILVR	1039	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3155.3	53.12602	3	1478.778071	1478.788164	K	Y	422	435
PSM	LAVNMVPFPR	1040	sp|A2AQ07|TBB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3070.8	50.72403	2	1142.618447	1142.627035	K	L	253	263
PSM	SGEYPFPLIK	1041	sp|P45952|ACADM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3073.4	50.80547	2	1149.599047	1149.607011	K	R	70	80
PSM	VVDLMAYMASK	1042	tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3199.8	54.35255	2	1227.598047	1226.603917	R	E	322	333
PSM	LELQGIQGAVDHAAAFGR	1043	sp|Q9CPV4|GLOD4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3102.8	51.62747	3	1851.953471	1851.959145	K	I	184	202
PSM	TDIANLAEEFK	1044	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3130.8	52.41143	2	1249.611247	1249.619033	R	D	313	324
PSM	AITGASLADIMAK	1045	sp|Q8BP67|RL24_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3039.10	49.84462	2	1260.665447	1260.674773	R	R	81	94
PSM	NLGVSIQLQTLK	1046	sp|Q3UP75|UD3A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3012.6	49.10275	2	1312.763247	1312.771451	K	A	405	417
PSM	GPILMELQTYR	1047	sp|P35486|ODPA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3090.17	51.30298	2	1319.682447	1319.690758	K	Y	278	289
PSM	DPEGYFHFIGR	1048	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3011.2	49.0684	3	1336.611071	1336.620036	K	S	452	463
PSM	NWRDPDQTDGPGLGYLSSHIANVER	1049	sp|P13020|GELS_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3015.4	49.18095	4	2796.326494	2796.321569	K	V	393	418
PSM	SCWDEPLSIAVR	1050	sp|O55137|ACOT1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25	2-UNIMOD:4	ms_run[1]:scan=1.1.3160.8	53.2662	2	1431.675047	1431.681650	R	G	13	25
PSM	LVTGWVKPIIIGR	1051	sp|O88844|IDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3017.2	49.2313	3	1450.893671	1450.902406	R	H	120	133
PSM	GSQGGLSQDFVEALK	1052	sp|Q7TNG8|LDHD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3052.18	50.22142	2	1534.751647	1534.762737	R	A	22	37
PSM	DQGTYEDYVEGLR	1053	sp|Q60605|MYL6_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3011.8	49.07841	2	1543.664447	1543.679067	K	V	82	95
PSM	LLLINNAATLGDVSK	1054	sp|Q64105|SPRE_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3140.14	52.70173	2	1540.874047	1540.882458	R	G	96	111
PSM	GVVNILPGSGSLVGQR	1055	sp|Q8R0Y6|AL1L1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3074.17	50.84443	2	1551.863447	1551.873290	K	L	621	637
PSM	LYTLVLTDPDAPSR	1056	sp|P70296|PEBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3108.14	51.79877	2	1559.812047	1559.819523	K	K	63	77
PSM	VDGLLTCCSVFINK	1057	sp|Q9CWS0|DDAH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25	7-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.3139.17	52.67552	2	1624.787247	1624.795300	K	K	268	282
PSM	DMHGDSEYNIMFGPDICGPGTK	1058	sp|P14211|CALR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25	17-UNIMOD:4	ms_run[1]:scan=1.1.3205.16	54.53093	3	2440.011671	2440.013367	K	K	121	143
PSM	GGNASNSCTVLSLLGAR	1059	sp|P97328|KHK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25	8-UNIMOD:4	ms_run[1]:scan=1.1.3194.18	54.21697	2	1675.824047	1675.831168	R	C	40	57
PSM	ADMGGAATICSAIVSAAK	1060	sp|Q9CPY7|AMPL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25	10-UNIMOD:4	ms_run[1]:scan=1.1.3130.18	52.41978	2	1692.810047	1692.817492	R	L	304	322
PSM	VVEEAPSIFLDPETR	1061	sp|Q91ZA3|PCCA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3187.19	54.02173	2	1700.858647	1700.862117	K	Q	295	310
PSM	RTGAIVDVPVGEELLGR	1062	sp|Q03265|ATPA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3045.7	50.0145	3	1779.979871	1779.984297	K	V	133	150
PSM	SIEDFAHSSFQMALSK	1063	sp|O88844|IDHC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3193.5	54.17743	3	1796.835071	1796.840335	K	G	188	204
PSM	HQVLFIADEIQTGLAR	1064	sp|P29758|OAT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3163.5	53.34543	3	1809.964571	1809.973733	R	T	256	272
PSM	NALPTPSDDPTALMTDPK	1065	sp|P11352|GPX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3003.21	48.86352	2	1882.891447	1882.898244	R	Y	129	147
PSM	STCTINYSTSLPLAQGIK	1066	sp|Q9DBF1|AL7A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25	3-UNIMOD:4	ms_run[1]:scan=1.1.3076.20	50.90375	2	1952.976647	1952.987728	R	F	520	538
PSM	IFNSGADLSGITEENAPLK	1067	sp|Q00898|A1AT5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3093.20	51.38973	2	1974.979247	1974.989836	R	L	329	348
PSM	VDLFYLHAPDHSTPVEETLR	1068	sp|Q8CG76|ARK72_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3036.16	49.76348	3	2338.154771	2338.159361	R	A	143	163
PSM	SHSNQLVTDCISAMNPDTVLR	1069	sp|Q9Z0S1|BPNT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25	10-UNIMOD:4	ms_run[1]:scan=1.1.3028.15	49.53723	3	2357.109971	2357.110379	R	V	197	218
PSM	TPALIVYGDQDPMGSSSFQHLK	1070	sp|Q8VCR7|ABHEB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3079.16	50.98647	3	2390.153771	2390.157647	K	Q	152	174
PSM	VKPGYLGTAFAHYDVQVIDEQGNVLPPGK	1071	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3169.13	53.51747	4	3111.603294	3111.602936	K	E	379	408
PSM	TADGDLAGTVHPQLQDHDFEPLRPGEPIFK	1072	sp|Q91XE4|ACY3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3051.11	50.18805	5	3299.627118	3299.621105	R	L	233	263
PSM	TDLALILSAGDN	1073	sp|P12658|CALB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3594.3	65.42107	2	1201.613847	1201.619033	R	-	250	262
PSM	DFQLFSSPLGK	1074	sp|Q921I1|TRFE_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3443.3	61.16508	2	1237.626047	1237.634289	K	D	300	311
PSM	AAVASLLQSVQVPEFTPK	1075	sp|Q02053|UBA1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3570.6	64.76017	3	1884.026471	1884.035664	R	S	785	803
PSM	EHGGSIVNIIVLLNNGFPTAAHTGAAR	1076	sp|Q99MZ7|PECR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3550.7	64.1941	4	2728.432494	2728.440896	R	E	149	176
PSM	GYEEWLLNEIR	1077	sp|P57780|ACTN4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3535.6	63.76225	2	1420.695447	1420.698680	K	R	397	408
PSM	FGLEGCEVLIPALK	1078	sp|Q60597|ODO1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25	6-UNIMOD:4	ms_run[1]:scan=1.1.3522.14	63.39477	2	1544.820447	1544.827252	R	T	278	292
PSM	VINVNLIGTFNVIR	1079	sp|O08756|HCD2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3582.10	65.099	2	1570.918847	1570.919512	R	L	117	131
PSM	DAVLNAWAEDVDLR	1080	sp|P52480|KPYM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3493.14	62.57858	2	1585.770247	1585.773636	K	V	476	490
PSM	IEFLDDVMMDACNR	1081	sp|Q7TNG8|LDHD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25	12-UNIMOD:4	ms_run[1]:scan=1.1.3496.16	62.66751	2	1727.727447	1727.731713	R	H	276	290
PSM	YCNTWPMAISMLASK	1082	sp|Q64442|DHSO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25	2-UNIMOD:4	ms_run[1]:scan=1.1.3552.18	64.26051	2	1771.805247	1771.809569	R	T	300	315
PSM	LFIGGLSFETTEESLR	1083	sp|O88569|ROA2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3527.19	63.54328	2	1797.911047	1797.914880	K	N	23	39
PSM	LFIGGLSFETTEESLR	1084	sp|O88569|ROA2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3533.16	63.71317	2	1797.911047	1797.914880	K	N	23	39
PSM	AYLPVNESFGFTADLR	1085	sp|P58252|EF2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3472.19	61.9819	2	1798.879247	1798.889000	K	S	786	802
PSM	HGYPLILYDVFPDVCK	1086	sp|Q99L13|3HIDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25	15-UNIMOD:4	ms_run[1]:scan=1.1.3549.5	64.16392	3	1934.954471	1934.960057	K	E	60	76
PSM	HGYPLILYDVFPDVCK	1087	sp|Q99L13|3HIDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25	15-UNIMOD:4	ms_run[1]:scan=1.1.3550.4	64.1916	3	1934.954471	1934.960057	K	E	60	76
PSM	IPNIYAIGDVVAGPMLAHK	1088	sp|O08749|DLDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3529.6	63.58992	3	1978.070171	1978.071004	K	A	347	366
PSM	VKPIWPIGMFSGYVDNPK	1089	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3495.7	62.63103	3	2047.056971	2047.060105	R	K	415	433
PSM	AREYLISLDPENLTLLEK	1090	sp|Q9DC50|OCTC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3472.8	61.97272	3	2116.139171	2116.141586	K	I	251	269
PSM	ASAFALQEQPVVNAVIDDATK	1091	sp|Q9D2G2|ODO2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3534.9	63.73602	3	2186.120471	2186.121913	K	E	288	309
PSM	KFDLGQDVIDFTGHSLALYR	1092	sp|Q61598|GDIB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3531.4	63.64583	4	2294.161694	2294.169532	K	T	174	194
PSM	TIYISGQVGLDPSSGQLVPGGVVEEAK	1093	sp|P52760|RIDA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3445.18	61.23237	3	2699.402771	2699.401777	R	Q	30	57
PSM	SGPFGQIFRPDNFVFGQSGAGNNWAK	1094	sp|P68372|TBB4B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3533.17	63.714	3	2797.339871	2797.336097	R	G	78	104
PSM	FDTTFFLCCLR	1095	sp|P11930|NUD19_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25	8-UNIMOD:4,9-UNIMOD:4	ms_run[1]:scan=1.1.3651.11	67.06477	2	1478.661847	1478.668643	R	D	191	202
PSM	IPAFLNVVDIAGLVK	1096	sp|Q9CZ30|OLA1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3822.12	71.86221	2	1567.933047	1567.933765	K	G	84	99
PSM	DLADELALVDVMEDK	1097	sp|P06151|LDHA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3822.16	71.86555	2	1674.802647	1674.802218	K	L	43	58
PSM	FEALAAHDALVELSGAMNTAACSLMK	1098	sp|P97807|FUMH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25	22-UNIMOD:4	ms_run[1]:scan=1.1.3790.17	70.97835	3	2720.290871	2720.297194	K	I	309	335
PSM	LGLDFPNLPYLIDGSHK	1099	sp|P10649|GSTM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3673.4	67.67522	3	1897.982171	1897.993799	K	I	53	70
PSM	NIVFSPLSISAALALVSLGAK	1100	sp|Q03734|SPA3M_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3941.2	75.10403	3	2070.204071	2070.208878	K	G	70	91
PSM	TLLTGLLDLQAQYPQFISR	1101	sp|P61922|GABT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3818.9	71.7482	3	2176.187171	2176.189205	K	V	414	433
PSM	LDAITDEENDMLDLAFGLTDR	1102	sp|P46656|ADX_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3892.3	73.80698	3	2366.089271	2366.094772	K	S	131	152
PSM	EVLLVPGNGFFIDGSAPTSFFR	1103	sp|Q9WVM8|AADAT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3834.6	72.19476	3	2369.201171	2369.205583	R	A	378	400
PSM	YGGWVDQNSPVLLDEPVLGSMAK	1104	sp|Q91WR5|AK1CL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3682.8	67.93906	3	2474.215571	2474.215162	R	K	224	247
PSM	ELGAFGLQVPSELGGLGLSNTQYAR	1105	sp|P50544|ACADV_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3765.14	70.27375	3	2576.320571	2576.323467	K	L	139	164
PSM	VEAPQALSENVLFGMGNPLLDISAVVDK	1106	sp|P55264|ADK_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3907.4	74.22535	3	2925.517571	2925.515761	K	D	14	42
PSM	CCAEANPPACYGTVLAEFQPLVEEPK	1107	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.3860.10	72.93643	3	2932.3129	2932.3076	K	N	384	410
PSM	CEFQDAYVLLSEK	1108	sp|P63038|CH60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.3802.11	71.31049	2	1583.7093	1583.7172	K	K	237	250
PSM	CQLEINFNTLQTK	1109	sp|P57780|ACTN4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.3633.11	66.56067	2	1590.7562	1590.7702	K	L	352	365
PSM	ASGADSKGDDLSTAILK	1110	sp|Q01853|TERA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:1	ms_run[1]:scan=1.1.2798.21	43.10592	2	1689.8341	1689.8416	M	Q	2	19
PSM	CLELFTELAEDK	1111	sp|P07901|HS90A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.3977.4	75.8297	2	1449.6671	1449.6692	K	E	421	433
PSM	AAVVLENGVLSR	1112	sp|P16331|PH4H_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:1	ms_run[1]:scan=1.1.3543.6	63.99446	2	1268.7005	1268.7083	M	K	2	14
PSM	IAAFADAAVDPIDFPLAPAYAVPK	1113	sp|Q8QZT1|THIL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3801.13	71.28415	3	2442.274871	2442.283499	R	V	309	333
PSM	VTNGAFTGEISPGMIK	1114	sp|P17751|TPIS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3014.11	49.1607	2	1620.806047	1620.818143	K	D	120	136
PSM	QVVDSAYEVIK	1115	sp|P06151|LDHA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:28	ms_run[1]:scan=1.1.3185.6	53.9561	2	1232.6195	1232.6283	K	L	233	244
PSM	KTQEQLASEMAELTAR	1116	sp|P26041|MOES_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2761.15	42.05777	3	1804.891871	1804.898913	K	I	412	428
PSM	ASGVQVADEVCR	1117	sp|Q9R0P5|DEST_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:1,11-UNIMOD:4	ms_run[1]:scan=1.1.2738.17	41.42295	2	1331.6059	1331.6134	M	I	2	14
PSM	GSELESAMETLINVFHAHSGK	1118	tr|Q91V77|Q91V77_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:1	ms_run[1]:scan=1.1.3879.4	73.45478	3	2298.0886	2298.0945	M	E	2	23
PSM	AEYLASIFGTEK	1119	sp|Q8BGJ9|U2AF4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:1	ms_run[1]:scan=1.1.3900.3	74.01981	2	1369.6731	1369.6760	M	D	2	14
PSM	LNQDQLDAVSK	1120	sp|Q60865|CAPR1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2228.15	27.28455	2	1228.610047	1229.625181	R	Y	86	97
PSM	KVEFIEELPK	1121	sp|Q3UNX5|ACSM3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2612.7	37.89617	2	1231.677847	1230.685990	R	T	552	562
PSM	FRPSFPASSPYVTTVGGTSFK	1122	sp|O89023|TPP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2975.16	48.0855	3	2234.116571	2232.121519	K	N	373	394
PSM	AAQAHEDIIHGSGK	1123	sp|P47199|QOR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.1713.5	12.95067	4	1432.692894	1432.705891	K	T	310	324
PSM	KVNVVEQEK	1124	sp|P17182|ENOA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.1669.20	11.73762	2	1071.581847	1071.592424	K	I	81	90
PSM	RYDDPEVQK	1125	sp|P38647|GRP75_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.1749.20	13.94945	2	1148.537047	1148.546202	R	D	127	136
PSM	ACHQLHQEGK	1126	sp|Q8CG76|ARK72_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	2-UNIMOD:4	ms_run[1]:scan=1.1.1565.21	8.86055	2	1206.546447	1206.556390	R	F	163	173
PSM	HQTVLDNTEGK	1127	sp|Q921I1|TRFE_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.1737.21	13.61993	2	1240.592647	1240.604780	K	N	555	566
PSM	LSDGVAVLK	1128	sp|P63038|CH60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2328.12	30.04205	2	900.521847	900.528033	K	V	397	406
PSM	IVVVTAGVR	1129	sp|P16125|LDHB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2305.3	29.39368	2	912.567047	912.575652	K	Q	92	101
PSM	TRPTVAAGAVGLAQR	1130	sp|P45952|ACADM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2191.11	26.25912	3	1466.822471	1466.831760	R	A	280	295
PSM	VGAFTVVCK	1131	sp|P05202|AATM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	8-UNIMOD:4	ms_run[1]:scan=1.1.2373.7	31.26555	2	979.507047	979.516088	R	D	288	297
PSM	VHQILEGSNEVMR	1132	sp|Q9D7B6|ACAD8_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2240.13	27.60462	3	1510.745471	1510.756212	R	M	391	404
PSM	IGGHGAEYGAEALER	1133	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2196.15	26.40305	3	1528.718771	1528.727020	K	M	18	33
PSM	DGLTDVYNK	1134	sp|Q8QZT1|THIL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2380.13	31.4662	2	1023.478447	1023.487290	K	I	179	188
PSM	HLFTGPALSK	1135	sp|P35505|FAAA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2225.17	27.20032	2	1069.582447	1069.592030	K	H	48	58
PSM	PAAVAAENEEIGAHIK	1136	sp|P26039|TLN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2258.13	28.10078	3	1618.819571	1618.831485	K	H	1902	1918
PSM	VTVAGLAGKDPVQCSR	1137	sp|Q99LX0|PARK7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	14-UNIMOD:4	ms_run[1]:scan=1.1.2355.13	30.78143	3	1656.853571	1656.861740	K	D	33	49
PSM	VVAGVAAALAHK	1138	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2239.14	27.57798	2	1105.651647	1105.660778	K	Y	134	146
PSM	IDVSVEAASGGK	1139	sp|O08749|DLDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2284.10	28.81785	2	1131.566447	1131.577168	K	A	289	301
PSM	GYSFTTTAER	1140	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2252.14	27.93878	2	1131.514047	1131.519653	R	E	197	207
PSM	LVASAYSIAQK	1141	sp|Q9Z0S1|BPNT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2352.17	30.70245	2	1149.632247	1149.639374	R	A	11	22
PSM	DGVANVSIEDR	1142	sp|P08228|SODC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2377.18	31.38553	2	1173.556047	1173.562580	K	V	93	104
PSM	GEFITTVQQR	1143	sp|P14152|MDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2350.17	30.64793	2	1177.600447	1177.609137	K	G	221	231
PSM	EAAENSLVAYK	1144	sp|P62259|1433E_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2286.10	28.87748	2	1193.586447	1193.592818	K	A	143	154
PSM	DQVANSAFVER	1145	sp|P07901|HS90A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2321.21	29.85272	2	1234.583647	1234.594215	K	L	501	512
PSM	YSTDVSVDEVK	1146	sp|P26443|DHE3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2337.15	30.29072	2	1240.572847	1240.582313	R	A	152	163
PSM	MDDVINISGHR	1147	sp|Q99NB1|ACS2L_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2340.4	30.36233	3	1255.585871	1255.597920	R	L	542	553
PSM	RTIAQDYGVLK	1148	sp|P35700|PRDX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2302.17	29.32357	2	1262.690247	1262.698286	K	A	110	121
PSM	VLETAEDIQER	1149	sp|P16546|SPTN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2267.19	28.35438	2	1301.639247	1301.646310	K	R	8	19
PSM	VASVAHSAPSEAPSCSPFGK	1150	sp|P70290|EM55_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	15-UNIMOD:4	ms_run[1]:scan=1.1.2290.21	28.98903	3	1984.926971	1984.931276	R	K	228	248
PSM	ADFAQACQDAGVR	1151	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	7-UNIMOD:4	ms_run[1]:scan=1.1.2304.20	29.38072	2	1407.615447	1407.620112	R	F	125	138
PSM	RFDDAVVQSDMK	1152	sp|P63017|HSP7C_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2266.21	28.32848	2	1409.653847	1409.660914	R	H	77	89
PSM	QYAGFSTVEESNK	1153	sp|P16332|MUTA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2342.16	30.43052	2	1458.657047	1458.662688	R	F	107	120
PSM	VIQCFAETGQVQK	1154	sp|Q68FD5|CLH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	4-UNIMOD:4	ms_run[1]:scan=1.1.2346.20	30.5398	2	1506.741447	1506.750064	K	I	488	501
PSM	SVTNEDVTQEQLGGAK	1155	sp|Q99MN9|PCCB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2265.21	28.30082	2	1674.800447	1674.806058	K	T	235	251
PSM	SVTNEDVTQEQLGGAK	1156	sp|Q99MN9|PCCB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2258.21	28.10745	2	1674.800447	1674.806058	K	T	235	251
PSM	GQHMSEQFSQVNCLNK	1157	sp|Q61133|GSTT2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	13-UNIMOD:4	ms_run[1]:scan=1.1.2291.17	29.01312	3	1905.839171	1905.846166	K	V	38	54
PSM	NQQEGVCPEGSIDNSPVK	1158	sp|Q921I1|TRFE_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	7-UNIMOD:4	ms_run[1]:scan=1.1.2366.19	31.0836	3	1956.882371	1956.884720	R	W	344	362
PSM	KVNLAELFK	1159	sp|P99029|PRDX5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2739.5	41.44132	2	1060.620447	1060.628081	K	G	71	80
PSM	SADTLWGIQK	1160	sp|P06151|LDHA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2684.5	39.89268	2	1117.569247	1117.576774	K	E	319	329
PSM	NDIAWNFEK	1161	sp|P11352|GPX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2780.12	42.58802	2	1135.520647	1135.529824	R	F	156	165
PSM	GDLGIEIPAEK	1162	sp|P52480|KPYM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2784.7	42.69822	2	1140.593647	1140.602654	R	V	295	306
PSM	FYTDPVEAVK	1163	sp|Q9D0K2|SCOT1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2612.4	37.89117	2	1167.571847	1167.581191	K	D	42	52
PSM	ISGDLEVLAEK	1164	sp|O35381|AN32A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2720.9	40.91522	2	1172.621047	1172.628869	R	C	76	87
PSM	LVQAFQFTDK	1165	sp|P35700|PRDX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2771.13	42.33624	2	1195.616647	1195.623724	R	H	159	169
PSM	LVQAFQFTDK	1166	sp|P35700|PRDX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2759.12	41.99887	2	1195.616647	1195.623724	R	H	159	169
PSM	AIEMLGGELGSK	1167	sp|P97807|FUMH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2761.15	42.05777	2	1203.606447	1203.616924	R	K	158	170
PSM	ASSTANLIFEDCRIPK	1168	sp|Q07417|ACADS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	12-UNIMOD:4	ms_run[1]:scan=1.1.2762.13	42.08403	3	1820.898371	1820.909084	R	E	235	251
PSM	QGIQFYTQLK	1169	sp|Q9EQ20|MMSA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2792.12	42.92995	2	1224.644247	1224.650273	K	T	501	511
PSM	GVLFASGQNLAR	1170	sp|Q9CPY7|AMPL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2642.14	38.73397	2	1231.658847	1231.667320	K	H	189	201
PSM	IYVVDVGSEPR	1171	sp|P17563|SBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2614.12	37.95097	2	1232.631047	1232.640102	R	A	104	115
PSM	IYVVDVGSEPR	1172	sp|P17563|SBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2607.15	37.76447	2	1232.631047	1232.640102	R	A	104	115
PSM	EKLEASITEYA	1173	sp|P10639|THIO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2696.15	40.23247	2	1252.611847	1252.618698	K	-	95	106
PSM	GGDQTTLLVLDK	1174	sp|Q9JIL4|NHRF3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2784.14	42.70405	2	1258.669247	1258.676882	K	E	311	323
PSM	HALIIYDDLSK	1175	sp|Q03265|ATPA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2624.15	38.22747	2	1286.678247	1286.687053	K	Q	306	317
PSM	ICCDLEVLASK	1176	sp|Q99MN9|PCCB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	2-UNIMOD:4,3-UNIMOD:4	ms_run[1]:scan=1.1.2760.17	42.03137	2	1306.616847	1306.626109	R	K	517	528
PSM	HLGFQSAVEALR	1177	tr|A0A0J9YTU1|A0A0J9YTU1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2690.18	40.0666	2	1326.697847	1326.704434	K	G	198	210
PSM	IGAFGYMECSAK	1178	sp|Q9QUI0|RHOA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	9-UNIMOD:4	ms_run[1]:scan=1.1.2678.17	39.73868	2	1332.576447	1332.584244	R	T	151	163
PSM	YALYDATYETK	1179	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2596.18	37.46015	2	1336.611647	1336.618698	R	E	82	93
PSM	TVIIEQSWGSPK	1180	sp|P63038|CH60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2697.14	40.2601	2	1343.698847	1343.708516	R	V	61	73
PSM	ASDTSITWNNLK	1181	sp|Q921I1|TRFE_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2662.8	39.28778	2	1348.656647	1348.662294	K	G	456	468
PSM	AALEALGSCLNNK	1182	sp|Q9CZN7|GLYM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	9-UNIMOD:4	ms_run[1]:scan=1.1.2632.16	38.45167	2	1359.671047	1359.681650	R	Y	83	96
PSM	TVYFAEEVQCEGNSFHK	1183	sp|P97315|CSRP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	10-UNIMOD:4	ms_run[1]:scan=1.1.2715.16	40.77753	3	2043.891371	2043.899641	K	S	16	33
PSM	VVDLMAYMASKE	1184	tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	8-UNIMOD:35	ms_run[1]:scan=1.1.2737.17	41.3943	2	1371.632647	1371.641425	R	-	322	334
PSM	RFSMVIDNGIVK	1185	sp|P99029|PRDX5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2687.10	39.98388	2	1377.735847	1377.743856	K	A	176	188
PSM	AVLEALGSCLNNK	1186	sp|P50431|GLYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	9-UNIMOD:4	ms_run[1]:scan=1.1.2787.14	42.79005	2	1387.719847	1387.712950	R	Y	54	67
PSM	RSEPEPQILDFQTQQYK	1187	sp|Q9R0H0|ACOX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2766.17	42.199	3	2106.030971	2106.038184	K	L	314	331
PSM	YYVTIIDAPGHR	1188	sp|P10126|EF1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2588.6	37.22721	3	1403.710871	1403.719750	K	D	85	97
PSM	GNPTVEVDLYTAK	1189	sp|P17182|ENOA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2690.19	40.06743	2	1405.703047	1405.708910	R	G	16	29
PSM	ETTIQGLDGLSER	1190	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2751.14	41.77922	2	1417.698047	1417.704888	K	C	122	135
PSM	AYTEEDLDLVEK	1191	sp|Q922D8|C1TC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2747.18	41.67445	2	1423.667647	1423.671856	K	G	722	734
PSM	LVSSENFDDYMK	1192	sp|P04117|FABP4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2788.19	42.82278	2	1446.629647	1446.633696	K	E	11	23
PSM	VILSSSSSCLLPSK	1193	sp|Q99KP3|CRYL1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	9-UNIMOD:4	ms_run[1]:scan=1.1.2745.18	41.62003	2	1476.777847	1476.785781	R	L	117	131
PSM	IFVGGLSPDTPEEK	1194	sp|Q60668|HNRPD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2767.18	42.22772	2	1487.741647	1487.750775	K	I	184	198
PSM	TTPSYVAFTDTER	1195	sp|P16627|HS71L_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2660.14	39.23542	2	1486.687047	1486.693989	R	L	39	52
PSM	AVFQYIDENQDR	1196	sp|Q9D1A2|CNDP2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2698.19	40.29296	2	1496.679447	1496.689572	K	Y	6	18
PSM	VDGVSAEPTPESWR	1197	sp|O35488|S27A2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2622.17	38.17323	2	1528.707447	1528.715787	K	S	198	212
PSM	AEAEAQAEELSFPR	1198	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2699.21	40.32337	2	1546.715447	1546.726351	R	S	929	943
PSM	VAMSHFEPSEYIR	1199	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2671.13	39.53553	3	1564.728971	1564.734414	K	Y	32	45
PSM	AIANECQANFISIK	1200	sp|Q01853|TERA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	6-UNIMOD:4	ms_run[1]:scan=1.1.2777.20	42.50982	2	1577.777447	1577.787178	K	G	530	544
PSM	ESAAIYFTSGTSGPPK	1201	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2686.17	39.95844	2	1611.772847	1611.778053	R	M	214	230
PSM	HWPFMVVNDAGRPK	1202	sp|P63017|HSP7C_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2621.9	38.13867	3	1652.816171	1652.824566	K	V	89	103
PSM	AIESQCYVIAAAQCGR	1203	sp|Q8VDK1|NIT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	6-UNIMOD:4,14-UNIMOD:4	ms_run[1]:scan=1.1.2700.21	40.35209	2	1795.827447	1795.834539	R	H	242	258
PSM	EVYMGNVIQGGEGQAPTR	1204	sp|Q8QZT1|THIL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2691.14	40.09093	3	1904.899271	1904.905061	K	Q	85	103
PSM	ASGAVGLSYGAHSNLCVNQIVR	1205	sp|Q9JHI5|IVD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	16-UNIMOD:4	ms_run[1]:scan=1.1.2787.17	42.79255	3	2272.130771	2272.138249	R	N	119	141
PSM	DNADGTYQVEYTPFEK	1206	sp|Q80X90|FLNB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2990.15	48.49637	2	1875.804247	1875.816289	K	G	1284	1300
PSM	LLCGLLSDR	1207	sp|P34884|MIF_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	3-UNIMOD:4	ms_run[1]:scan=1.1.2873.6	45.22528	2	1045.553047	1045.559016	K	L	79	88
PSM	TPFGAYGGLLK	1208	sp|Q8BWT1|THIM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2988.5	48.43252	2	1122.596247	1122.607346	R	D	15	26
PSM	FEDENFILK	1209	sp|P17742|PPIA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2888.5	45.64148	2	1153.558847	1153.565540	K	H	83	92
PSM	QGLLGINIAEK	1210	sp|P51174|ACADL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2951.8	47.40807	2	1154.657247	1154.665923	K	H	96	107
PSM	FLQASEDLLK	1211	sp|P15532|NDKA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2830.11	44.00657	2	1162.614447	1162.623390	K	E	40	50
PSM	LIGIDDVPDAR	1212	sp|P98078|DAB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2827.11	43.92105	2	1182.616647	1182.624452	K	G	54	65
PSM	VMVAEALDISR	1213	sp|Q9Z2I8|SUCB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2864.14	44.97382	2	1202.624047	1202.632909	K	E	141	152
PSM	ALQASALAAWGGK	1214	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2853.9	44.65408	2	1242.664847	1242.672071	R	A	305	318
PSM	EVGADFTIQVGK	1215	sp|Q64442|DHSO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2835.11	44.14957	2	1262.641247	1262.650667	K	E	215	227
PSM	EVGADFTIQVGK	1216	sp|Q64442|DHSO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2829.14	43.98058	2	1262.641247	1262.650667	K	E	215	227
PSM	KYTPEQVAMATVTALHR	1217	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2883.13	45.50845	3	1914.999671	1914.998567	K	T	243	260
PSM	TCFSMVPALQK	1218	sp|P85094|ISC2A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	2-UNIMOD:4	ms_run[1]:scan=1.1.2868.11	45.08603	2	1280.620847	1280.625715	K	E	83	94
PSM	GIVNEQFLLQR	1219	sp|P50544|ACADV_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2994.13	48.60198	2	1315.719847	1315.724835	K	L	558	569
PSM	SHSEPAEFSAQLDPSFIK	1220	sp|Q99J99|THTM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2933.14	46.9195	3	1988.943371	1988.947972	K	T	147	165
PSM	GIICGLTQFTNK	1221	sp|Q64516|GLPK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	4-UNIMOD:4	ms_run[1]:scan=1.1.2975.13	48.083	2	1350.691047	1350.696572	R	C	384	396
PSM	IEDLELVPVESK	1222	sp|Q62468|VILI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2979.12	48.19327	2	1369.729447	1369.734062	R	W	405	417
PSM	GYISPYFINTSK	1223	sp|P63038|CH60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2931.19	46.86615	2	1388.691647	1388.697617	R	G	222	234
PSM	ATSLNSNDVFILK	1224	sp|Q62468|VILI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2993.12	48.57357	2	1420.750447	1420.756195	R	T	537	550
PSM	LVEDHLAVQSLIR	1225	tr|E9Q7L0|E9Q7L0_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2819.7	43.68865	3	1491.831371	1491.840928	K	A	110	123
PSM	ISSLLEEQFQQGK	1226	sp|P62242|RS8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2811.20	43.47018	2	1505.764047	1505.772573	K	L	158	171
PSM	LVSIGAEEIVDGNAK	1227	sp|P57780|ACTN4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2841.18	44.32383	2	1513.791247	1513.798788	K	M	127	142
PSM	VLEQLTGQTPVFSK	1228	sp|Q9CXW4|RL11_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2930.20	46.83837	2	1545.832647	1545.840259	K	A	39	53
PSM	VCYEGQPVGEFIR	1229	sp|P13707|GPDA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	2-UNIMOD:4	ms_run[1]:scan=1.1.2861.19	44.89193	2	1552.726847	1552.734414	K	C	328	341
PSM	AENACVPPFTVEVK	1230	sp|Q9D964|GATM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	5-UNIMOD:4	ms_run[1]:scan=1.1.2879.21	45.40483	2	1559.760847	1559.765380	R	A	83	97
PSM	AENACVPPFTVEVK	1231	sp|Q9D964|GATM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	5-UNIMOD:4	ms_run[1]:scan=1.1.2873.20	45.23697	2	1559.760847	1559.765380	R	A	83	97
PSM	YLGAEYMQSVGNMR	1232	sp|Q921I1|TRFE_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2948.15	47.33425	2	1617.720647	1617.727948	K	K	668	682
PSM	QVIDCQLADVNNLGK	1233	sp|Q9CPY7|AMPL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	5-UNIMOD:4	ms_run[1]:scan=1.1.2864.21	44.97967	2	1685.833647	1685.840670	R	Y	441	456
PSM	YSNSDVIIYVGCGER	1234	sp|P50516|VATA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	12-UNIMOD:4	ms_run[1]:scan=1.1.2885.21	45.57067	2	1730.788047	1730.793385	K	G	266	281
PSM	TFVVQGFGNVGLHSMR	1235	sp|P26443|DHE3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2963.9	47.74574	3	1747.872671	1747.882809	K	Y	303	319
PSM	LAEMPADSGYPAYLGAR	1236	sp|P50516|VATA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2981.19	48.25566	2	1780.838247	1780.845421	R	L	365	382
PSM	ICDQWDNLGSLTHSR	1237	sp|P57780|ACTN4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	2-UNIMOD:4	ms_run[1]:scan=1.1.2819.13	43.69367	3	1800.814571	1800.821331	K	R	499	514
PSM	GANAVGYTNYPDNVVFK	1238	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2913.21	46.35665	2	1827.873447	1827.879164	R	F	645	662
PSM	HFIEQGINVCLCQSYAK	1239	sp|P05202|AATM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	10-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.2821.17	43.75433	3	2065.964771	2065.971367	R	N	263	280
PSM	VLITTDLLAR	1240	sp|P10630|IF4A2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3056.8	50.32292	2	1113.667447	1113.675760	R	G	326	336
PSM	ISVAGVTSGNVGYLAHAIHQVTK	1241	sp|P05202|AATM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3074.7	50.8361	4	2321.244094	2321.249179	R	-	408	431
PSM	VTSLVVDIVPR	1242	sp|Q8R146|APEH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3070.11	50.72653	2	1196.701847	1196.712873	K	Q	340	351
PSM	FSVDVFEETR	1243	sp|O09173|HGD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3042.6	49.9274	2	1227.571447	1227.577168	R	G	188	198
PSM	TFESLVDFCK	1244	sp|Q61425|HCDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	9-UNIMOD:4	ms_run[1]:scan=1.1.3092.9	51.35287	2	1244.566447	1244.574725	K	T	193	203
PSM	FRSETITEEELVGLMNK	1245	tr|A0A1B0GRG8|A0A1B0GRG8_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3167.10	53.45963	3	1994.990771	1994.998293	K	Y	158	175
PSM	LVAIVDVIDQNR	1246	sp|Q9CR57|RL14_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3191.10	54.1249	2	1353.753047	1353.761615	K	A	24	36
PSM	ELEEIVQPIISK	1247	sp|P20029|BIP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3071.11	50.75497	2	1396.769247	1396.781347	K	L	623	635
PSM	LDNNTELSFFAK	1248	sp|O88844|IDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3059.14	50.41212	2	1397.674847	1397.682696	K	A	346	358
PSM	AVQMGMSSVFFNK	1249	sp|Q8R0Y6|AL1L1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3085.19	51.16227	2	1444.673047	1444.684292	K	G	691	704
PSM	VDLCATWEAMEK	1250	sp|Q91WR5|AK1CL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	4-UNIMOD:4	ms_run[1]:scan=1.1.3174.14	53.65848	2	1451.638247	1451.642487	R	C	142	154
PSM	TGLVFMPGTIQMR	1251	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	6-UNIMOD:35	ms_run[1]:scan=1.1.3074.15	50.84277	2	1465.731847	1465.742142	R	S	129	142
PSM	LAYINPDLALEEK	1252	sp|Q60864|STIP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3069.16	50.70215	2	1487.777247	1487.787161	R	N	352	365
PSM	EDIYAVEIVGGATR	1253	sp|Q61316|HSP74_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3061.12	50.468	2	1491.747847	1491.756923	K	I	333	347
PSM	VFDYSEYWEGAR	1254	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3154.16	53.10815	2	1520.652447	1520.657209	R	G	831	843
PSM	GCALQCAILSPAFK	1255	sp|P48722|HS74L_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	2-UNIMOD:4,6-UNIMOD:4	ms_run[1]:scan=1.1.3101.17	51.60727	2	1534.759847	1534.763606	R	V	375	389
PSM	ANATEFGLASGVFTR	1256	sp|Q8R0Y6|AL1L1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3126.17	52.30537	2	1539.758847	1539.768157	R	D	827	842
PSM	SIITLDGGALVQVQK	1257	sp|P04117|FABP4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3158.14	53.2169	2	1540.874047	1540.882458	K	W	83	98
PSM	TCEDWVDGISQFK	1258	sp|Q8R164|BPHL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	2-UNIMOD:4	ms_run[1]:scan=1.1.3196.15	54.2721	2	1583.687647	1583.692609	K	Q	205	218
PSM	SQHVQVEEGSEPDAFWEALGGK	1259	sp|P13020|GELS_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3168.16	53.49228	3	2399.106671	2399.102969	R	T	625	647
PSM	DVAPQAPVHFLVIPR	1260	sp|Q9D0S9|HINT2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3164.7	53.37457	3	1657.918271	1657.930411	R	K	80	95
PSM	IINEPTAAAIAYGLDK	1261	sp|P16627|HS71L_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3122.16	52.19055	2	1658.881047	1658.887937	R	G	174	190
PSM	TQEFILNSPTVTSIK	1262	sp|Q9R0H0|ACOX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3027.19	49.51322	2	1676.889847	1676.898502	K	W	160	175
PSM	NAVITVPAYFNDSQR	1263	sp|P38647|GRP75_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3052.20	50.22308	2	1693.833047	1693.842384	K	Q	188	203
PSM	TLNEWSSQISPDLVR	1264	sp|O09172|GSH0_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3143.19	52.79197	2	1743.875247	1743.879164	K	E	50	65
PSM	IHFPLATYAPVISAEK	1265	sp|P05213|TBA1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3142.5	52.75173	3	1755.949271	1755.955957	R	A	265	281
PSM	IHFPLATYAPVISAEK	1266	sp|P05213|TBA1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3136.7	52.58118	3	1755.949271	1755.955957	R	A	265	281
PSM	AEEYEFLTPMEEAPK	1267	sp|Q99PT1|GDIR1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3168.18	53.49395	2	1782.798447	1782.802218	R	G	153	168
PSM	TITLEVEPSDTIENVK	1268	tr|A0A0A6YW67|A0A0A6YW67_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3003.20	48.86268	2	1786.912647	1786.920025	K	A	12	28
PSM	LGPNYLQIPVNCPYR	1269	sp|P24270|CATA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	12-UNIMOD:4	ms_run[1]:scan=1.1.3180.21	53.83115	2	1802.907647	1802.913775	R	A	366	381
PSM	LLSHCLLVTLASHHPADFTPAVHASLDK	1270	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	5-UNIMOD:4	ms_run[1]:scan=1.1.3033.8	49.67112	5	3049.586118	3049.580761	K	F	101	129
PSM	MVIWGANAYVTEEDSR	1271	sp|Q8R164|BPHL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3133.20	52.50603	2	1839.843447	1839.846149	K	I	159	175
PSM	TGIGSGLSLSGIVHPELSR	1272	sp|P50544|ACADV_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3119.11	52.10143	3	1879.002671	1879.016326	R	S	514	533
PSM	SLEDHTPLPGITVGDIGPK	1273	sp|Q9QXD1|ACOX2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3079.9	50.98062	3	1945.011371	1945.015657	R	M	226	245
PSM	YFDSFGDLSSASAIMGNAK	1274	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	15-UNIMOD:35	ms_run[1]:scan=1.1.3193.21	54.19078	2	1995.885047	1995.888408	R	V	42	61
PSM	HVLSTFGPVPEFSGATVER	1275	sp|Q99KP3|CRYL1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3014.8	49.1557	3	2029.022171	2029.026891	K	V	261	280
PSM	DDNPSLPPFERPEAEAMCTSFK	1276	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	18-UNIMOD:4	ms_run[1]:scan=1.1.3141.18	52.73385	3	2537.118371	2537.120275	K	E	131	153
PSM	GSNTCELVFEDCKVPAANVLSQESK	1277	sp|Q9JHI5|IVD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	5-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.3021.17	49.35232	3	2781.297371	2781.294946	R	G	248	273
PSM	IGPSEVENALMEHPAVSETAVISSPDPSRGEVVK	1278	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3160.13	53.2737	4	3530.756894	3530.756278	R	A	474	508
PSM	DLEDLQILIK	1279	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3544.3	64.0209	2	1198.674447	1198.680905	K	V	578	588
PSM	NLQNLLILTAIK	1280	sp|Q68FD5|CLH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3596.5	65.4787	2	1352.835247	1352.839137	R	A	1023	1035
PSM	AVVLPISLATTFK	1281	sp|Q8VCN5|CGL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3516.7	63.2159	2	1358.810247	1358.817339	R	Q	35	48
PSM	LLIQSEFPSLLK	1282	sp|P97816|S100G_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3463.7	61.72512	2	1386.807247	1386.812253	K	A	34	46
PSM	LLIQSEFPSLLK	1283	sp|P97816|S100G_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3453.9	61.4521	2	1386.807247	1386.812253	K	A	34	46
PSM	VALTGLTVAEYFR	1284	sp|P56480|ATPB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3455.11	61.50988	2	1438.770047	1438.782016	R	D	282	295
PSM	MGLPICLVVAVNR	1285	sp|Q80W22|THNS2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	6-UNIMOD:4	ms_run[1]:scan=1.1.3543.10	63.9978	2	1440.790247	1440.794512	K	N	275	288
PSM	DIVLVAYGVLGTQR	1286	sp|Q91WR5|AK1CL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3596.11	65.4837	2	1502.841647	1502.845679	K	Y	210	224
PSM	DIVLVAYGVLGTQR	1287	sp|Q91WR5|AK1CL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3602.12	65.6569	2	1502.841647	1502.845679	K	Y	210	224
PSM	TLNDELEIIEGMK	1288	sp|P63038|CH60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3435.6	60.95668	2	1503.742447	1503.749061	K	F	206	219
PSM	MFVLDEADEMLSR	1289	sp|P10630|IF4A2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3534.12	63.73852	2	1554.701247	1554.705816	K	G	179	192
PSM	TFGENYVQELLEK	1290	sp|Q9Z2Y8|PLPHP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3457.15	61.56797	2	1568.765047	1568.772239	R	A	64	77
PSM	SVNESLNNLFITEEDYQALR	1291	sp|Q68FD5|CLH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3548.10	64.13982	3	2354.139971	2354.139020	K	T	1462	1482
PSM	TFVSITPAEVGVLVGK	1292	sp|P62962|PROF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3522.19	63.39893	2	1615.913247	1615.918509	K	D	39	55
PSM	LLEAGDFICQALNR	1293	sp|P38060|HMGCL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	9-UNIMOD:4	ms_run[1]:scan=1.1.3456.13	61.53898	2	1618.810047	1618.813727	K	K	299	313
PSM	VEGAFPVTMLPGDGVGPELMHAVK	1294	tr|Q91VA7|Q91VA7_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3504.7	62.89365	3	2450.232371	2450.233789	R	E	44	68
PSM	AVFVDLEPTVIDEIR	1295	sp|P68368|TBA4A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3603.20	65.69231	2	1714.912447	1714.914152	R	N	65	80
PSM	GLAPVQAYLHIPDIIK	1296	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3470.3	61.91345	3	1746.997271	1747.003242	R	V	89	105
PSM	SGGGGNFVLSTSLVGYLR	1297	sp|Q9DC50|OCTC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3529.20	63.6016	2	1782.915047	1782.926448	R	V	533	551
PSM	SWIEEQEMGSFLSVAK	1298	sp|Q9CPY7|AMPL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3543.20	64.00615	2	1839.869047	1839.871301	K	G	238	254
PSM	ILPNVPEVEDSTDFFK	1299	sp|Q8R0Y6|AL1L1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3472.20	61.98273	2	1848.908847	1848.914546	R	S	334	350
PSM	HGYPLILYDVFPDVCK	1300	sp|Q99L13|3HIDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	15-UNIMOD:4	ms_run[1]:scan=1.1.3548.5	64.13565	3	1934.954471	1934.960057	K	E	60	76
PSM	EGDSPQLMAIMNHVLGPR	1301	sp|Q62468|VILI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3472.5	61.97021	3	1963.953371	1963.960802	K	K	216	234
PSM	YFDSFGDLSSASAIMGNAK	1302	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3496.20	62.67085	2	1979.896247	1979.893493	R	V	42	61
PSM	DLYANTVLSGGTTMYPGIADR	1303	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3477.14	62.1192	3	2214.063071	2214.062684	K	M	292	313
PSM	AAATFNPELITHILDGSPENTR	1304	sp|Q9R0H0|ACOX1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3504.6	62.89115	3	2366.184671	2366.186639	R	R	10	32
PSM	LLEVSDDPQVLAVAAHDVGEYVR	1305	sp|Q8BVE3|VATH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3615.15	66.03373	3	2494.267871	2494.270368	K	H	397	420
PSM	ETVVEVPQVTWEDIGGLEDVKR	1306	sp|Q01853|TERA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3483.15	62.29208	3	2497.269671	2497.270034	R	E	466	488
PSM	GLQVVEHACSVTSLMLGETMPSITK	1307	sp|Q9EQ20|MMSA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	9-UNIMOD:4	ms_run[1]:scan=1.1.3503.8	62.8692	3	2687.334071	2687.333245	R	D	141	166
PSM	SGPFGQIFRPDNFVFGQSGAGNNWAK	1308	sp|P68372|TBB4B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3527.20	63.54412	3	2797.339871	2797.336097	R	G	78	104
PSM	DLLEVADILEK	1309	sp|Q99LP6|GRPE1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3739.9	69.53198	2	1256.680847	1256.686384	K	A	110	121
PSM	KLDQDTVFALANYILFK	1310	sp|P07758|A1AT1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3827.8	71.9983	3	1998.079871	1998.082615	K	G	193	210
PSM	GLVLIAFSQYLQK	1311	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3706.12	68.61377	2	1478.846447	1478.849701	K	C	45	58
PSM	AILPFDLQIIDEK	1312	sp|Q91VA0|ACSM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3717.9	68.92135	2	1513.833647	1513.839196	K	G	388	401
PSM	DDGLFSGDPNWFPK	1313	sp|Q9WVA4|TAGL2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3651.16	67.06893	2	1593.706447	1593.709973	R	K	140	154
PSM	DMTLEGDDLILEIE	1314	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3929.4	74.78027	2	1604.744847	1604.749120	K	-	1165	1179
PSM	DFNVGDYIEAVLDR	1315	sp|Q8CI94|PYGB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3890.4	73.74823	2	1624.767247	1624.773302	K	N	257	271
PSM	AALLAELASLEADALR	1316	sp|Q3TW96|UAP1L_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3833.6	72.16572	2	1625.888247	1625.898836	R	E	32	48
PSM	TVPFCSTFAAFFTR	1317	sp|P40142|TKT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	5-UNIMOD:4	ms_run[1]:scan=1.1.3755.9	69.9805	2	1650.784247	1650.786449	R	A	382	396
PSM	IGVAIGDQILDLSVIK	1318	sp|P35505|FAAA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3752.13	69.89753	2	1652.968647	1652.971273	R	H	32	48
PSM	AVQQPDGLAVLGIFLK	1319	sp|P00920|CAH2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3811.9	71.55373	2	1667.958847	1667.961043	K	I	133	149
PSM	EFADSLGIPFLETSAK	1320	sp|P62821|RAB1A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3720.12	69.00842	2	1723.862447	1723.866868	K	N	141	157
PSM	IDIPSFDWPIAPFPR	1321	sp|P61922|GABT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3832.10	72.14352	2	1769.908447	1769.914093	K	L	236	251
PSM	TEFLSFMNTELAAFTK	1322	sp|P50543|S10AB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3815.20	71.67423	2	1848.895047	1848.896788	K	N	32	48
PSM	NGDGEVSYEEFEAFFK	1323	sp|P97816|S100G_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3675.18	67.74281	2	1866.794047	1866.794825	K	K	60	76
PSM	LADVLEQSLEELAQAESK	1324	sp|Q8BH00|AL8A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3794.4	71.07983	3	1971.996071	1972.000067	R	D	76	94
PSM	EEGLPVPELFEDPLFSR	1325	sp|Q9DC50|OCTC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3824.20	71.92458	2	1972.977847	1972.978209	K	S	516	533
PSM	TVLGVPEVLLGILPGAGGTQR	1326	sp|Q8BMS1|ECHA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3834.3	72.18975	3	2046.180971	2046.183726	K	L	167	188
PSM	FDGALNVDLTEFQTNLVPYPR	1327	sp|P05213|TBA1B_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3783.10	70.78277	3	2408.197271	2408.201226	R	I	244	265
PSM	AQNVPLPVSTLVEFVIAATDCTAK	1328	sp|P29699|FETUA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	21-UNIMOD:4	ms_run[1]:scan=1.1.4000.2	76.24302	3	2543.330171	2543.330526	R	E	188	212
PSM	DVQTPFLVELEVLDGHEPDGGQR	1329	sp|Q9QYR9|ACOT2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3761.15	70.15773	3	2549.228771	2549.239797	R	L	138	161
PSM	YVEPIEDVPCGNIVGLVGVDQFLVK	1330	sp|P58252|EF2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	10-UNIMOD:4	ms_run[1]:scan=1.1.3816.16	71.69849	3	2758.427171	2758.425155	R	T	457	482
PSM	LGAPISSGLSDLFDLTSGVGTLSGSYVAPK	1331	sp|O35643|AP1B1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3858.7	72.87912	3	2908.514171	2908.506970	R	A	688	718
PSM	ENGTITAANASTLNDGAAALVLMTAEAAQR	1332	sp|Q8QZT1|THIL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3797.21	71.17827	3	2944.455371	2944.456014	K	L	271	301
PSM	GHHVAQLDPLGILDADLDSSVPADIISSTDK	1333	sp|Q60597|ODO1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3741.12	69.58929	4	3198.611694	3198.604452	R	L	141	172
PSM	AIAIAAGVPVVPGTDSPISSLHEAHEFSNTYGFPIIFK	1334	tr|E9QPD7|E9QPD7_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3737.16	69.48413	4	3952.063694	3952.041091	R	A	158	196
PSM	QEPERNECFLQHK	1335	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:28,8-UNIMOD:4	ms_run[1]:scan=1.1.2197.18	26.43385	3	1696.7563	1696.7622	K	D	118	131
PSM	CEFQDAYVLLSEK	1336	sp|P63038|CH60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.3802.10	71.30965	2	1583.7093	1583.7172	K	K	237	250
PSM	TMLESAGGLIQTAR	1337	sp|P26039|TLN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2884.17	45.5395	2	1446.740647	1446.750064	K	A	1605	1619
PSM	QIDDVLSVASVRPAVLQVECHPYLAQNELIAHCHAR	1338	sp|Q9JII6|AK1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:28,20-UNIMOD:4,33-UNIMOD:4	ms_run[1]:scan=1.1.3436.6	60.98352	5	4091.0572	4091.0462	R	G	168	204
PSM	NPAETLLLSEPLNGDLLGQYSQLAR	1339	sp|Q8VDK1|NIT1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3810.17	71.5325	3	2712.400871	2711.413010	R	E	90	115
PSM	AGTTTIEAVKR	1340	sp|P21107-2|TPM3-2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:1	ms_run[1]:scan=1.1.2254.12	27.99547	2	1187.6402	1187.6502	M	K	2	13
PSM	YPIEHGIITNWDDMEK	1341	sp|P62737|ACTA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2905.15	46.12677	3	1959.913871	1959.903664	K	I	71	87
PSM	ELQNLIQELLQAR	1342	sp|P12658|CALB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:27	ms_run[1]:scan=1.1.4100.2	77.4607	2	1548.8538	1548.8619	K	K	35	48
PSM	ASGVAVSDGVIK	1343	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:1	ms_run[1]:scan=1.1.2822.9	43.7763	2	1143.6071	1143.6130	M	V	2	14
PSM	VIVLTAAAQGIGR	1344	sp|Q8JZV9|BDH2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2836.18	44.1839	2	1267.751247	1267.761221	K	A	8	21
PSM	QSILELAQQWGEFK	1345	sp|P24288|BCAT1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:28	ms_run[1]:scan=1.1.3928.4	74.7559	2	1658.8321	1658.8299	R	V	292	306
PSM	SDKPDMAEIEK	1346	sp|P20065-2|TYB4-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:1	ms_run[1]:scan=1.1.2322.20	29.87995	2	1303.5870	1303.5961	M	F	2	13
PSM	HGGPADEER	1347	sp|P08228|SODC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.1570.16	8.9924	2	967.410247	966.415522	K	H	72	81
PSM	MEIATEEPLNPIK	1348	sp|Q91VM9|IPYR2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2869.16	45.11895	2	1482.756647	1483.759231	K	Q	101	114
PSM	VIAATGSDEK	1349	sp|Q3UNZ8|QORL2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.1711.11	12.90708	2	989.495047	989.502940	K	C	192	202
PSM	TPVSEHVTK	1350	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.1670.20	11.76498	2	996.515847	996.524010	K	C	491	500
PSM	SEATAAAEHK	1351	sp|Q9Z2V4|PCKGC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.1574.16	9.1022	2	1013.469847	1013.477788	R	G	462	472
PSM	NSSQAVQAVR	1352	sp|Q99K67|AASS_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.1754.19	14.08945	2	1058.538247	1058.546871	R	D	190	200
PSM	NAGQTCVCSNR	1353	sp|Q8BWF0|SSDH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	6-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.1668.19	11.7095	2	1265.516847	1265.524104	R	F	323	334
PSM	VGGTSDVEVNEKK	1354	sp|P63038|CH60_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.1748.21	13.9224	2	1360.671647	1360.683424	K	D	406	419
PSM	TATPQQAQEVHEK	1355	sp|P17751|TPIS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.1714.14	12.98163	3	1465.706171	1465.716121	K	L	226	239
PSM	VAIEPGVPR	1356	sp|Q64442|DHSO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2286.5	28.86913	2	936.530447	936.539266	R	E	92	101
PSM	RIFSSEHDIFR	1357	sp|P51174|ACADL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2313.6	29.61587	3	1405.700171	1405.710248	R	E	51	62
PSM	TRPTVAAGAVGLAQR	1358	sp|P45952|ACADM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2190.13	26.23263	3	1466.822471	1466.831760	R	A	280	295
PSM	MREIVHIQAGQCGNQIGAK	1359	sp|P99024|TBB5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	12-UNIMOD:4	ms_run[1]:scan=1.1.2246.14	27.77213	4	2109.050894	2109.057162	-	F	1	20
PSM	HFVGMLPEK	1360	sp|Q9R0P5|DEST_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2251.15	27.91223	2	1056.532447	1056.542637	K	D	70	79
PSM	HLFTGPALSK	1361	sp|P35505|FAAA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2232.13	27.38722	2	1069.582447	1069.592030	K	H	48	58
PSM	INAVDYASVK	1362	sp|Q8VCR7|ABHEB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2351.11	30.67023	2	1078.558247	1078.565875	K	T	142	152
PSM	LRVDPVNFK	1363	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2354.2	30.74452	3	1086.610871	1086.618579	K	L	92	101
PSM	WLNENAVEK	1364	sp|P50247|SAHH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	23		ms_run[1]:scan=1.1.2281.10	28.73792	2	1101.5342	1101.5452	K	V	310	319
PSM	VVAGVAAALAHK	1365	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2224.4	27.16163	3	1105.649771	1105.660778	K	Y	134	146
PSM	VNVPVIGGHAGK	1366	sp|P08249|MDHM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2205.3	26.64187	3	1146.640571	1146.650942	R	T	192	204
PSM	VYIGGEDYEK	1367	sp|P40936|INMT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2297.16	29.18053	2	1171.531047	1171.539720	K	E	5	15
PSM	INFDSNSAYR	1368	sp|Q9Z2I9|SUCB1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2333.6	30.18305	2	1185.535247	1185.541451	K	Q	275	285
PSM	KVYDLNEIAK	1369	sp|Q91V76|CK054_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2288.11	28.93138	2	1191.641647	1191.649939	K	V	76	86
PSM	FAAATGATPIAGR	1370	sp|P14206|RSSA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2303.20	29.35345	2	1202.629647	1202.640771	K	F	90	103
PSM	VVSPWNSEDAK	1371	sp|Q9D051|ODPB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2316.20	29.71162	2	1230.578647	1230.588067	K	G	174	185
PSM	DRVTDALNATR	1372	sp|P63038|CH60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2297.18	29.1822	2	1230.623447	1230.631663	K	A	419	430
PSM	TCAELVQEAAR	1373	sp|Q8VDK1|NIT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	2-UNIMOD:4	ms_run[1]:scan=1.1.2230.12	27.3368	2	1246.586447	1246.597586	K	L	62	73
PSM	AAISDSVVEPAAK	1374	sp|Q62468|VILI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2285.10	28.85055	2	1256.653247	1256.661232	K	A	238	251
PSM	ASDETGFIAVHK	1375	sp|P34914|HYES_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2195.8	26.36902	3	1273.620371	1273.630266	R	A	409	421
PSM	VNADEVGGEALGR	1376	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2363.17	30.99893	2	1285.622047	1285.626243	K	L	19	32
PSM	IIYGGSVTGATCK	1377	sp|P17751|TPIS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	12-UNIMOD:4	ms_run[1]:scan=1.1.2272.19	28.49328	2	1325.656047	1325.664937	R	E	257	270
PSM	ALGQNPTNAEVLK	1378	sp|Q60605|MYL6_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2323.21	29.90885	2	1353.717247	1353.725229	R	V	38	51
PSM	RFDDAVVQSDMK	1379	sp|P63017|HSP7C_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2273.21	28.52315	2	1409.653847	1409.660914	R	H	77	89
PSM	RYTMGDAPDFDR	1380	sp|P10649|GSTM1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2368.12	31.13298	3	1442.614571	1442.624863	K	S	32	44
PSM	IWHHTFYNELR	1381	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2312.21	29.60053	2	1514.732847	1514.741882	K	V	85	96
PSM	HSSLAGCQIINYR	1382	sp|Q68FD5|CLH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	7-UNIMOD:4	ms_run[1]:scan=1.1.2354.7	30.75285	3	1517.727971	1517.740896	R	T	145	158
PSM	IECESAETTEDCIEK	1383	sp|Q921I1|TRFE_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	3-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.2226.21	27.2316	2	1812.731647	1812.739361	K	I	384	399
PSM	EIVHIQAGQCGNQIGAK	1384	sp|P99024|TBB5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	10-UNIMOD:4	ms_run[1]:scan=1.1.2275.18	28.57698	3	1821.904871	1821.915566	R	F	3	20
PSM	KYDTDHSGFIETEELK	1385	sp|P12658|CALB1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2377.19	31.38637	3	1910.886971	1910.889788	R	N	109	125
PSM	GAGTGGLGLTVEGPCEAK	1386	sp|Q80X90|FLNB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	15-UNIMOD:4	ms_run[1]:scan=1.1.2661.9	39.26325	2	1672.797247	1672.809035	K	I	1067	1085
PSM	HLEINPDHPIVETLR	1387	sp|P11499|HS90B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2602.4	37.61433	4	1781.936894	1781.942433	K	Q	625	640
PSM	LAPPLVIKEDEIR	1388	sp|P29758|OAT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2749.4	41.71684	3	1491.856571	1491.866080	R	E	414	427
PSM	VPGATMLLAK	1389	sp|Q9EQ20|MMSA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2628.8	38.33372	2	999.571247	999.578688	R	L	214	224
PSM	MFASFPTTK	1390	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2607.5	37.75611	2	1028.492447	1028.500103	R	T	33	42
PSM	ILHCLELASDIQR	1391	sp|Q9CY64|BIEA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	4-UNIMOD:4	ms_run[1]:scan=1.1.2703.8	40.42728	3	1566.805571	1566.818812	R	L	277	290
PSM	SADTLWGIQK	1392	sp|P06151|LDHA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2691.9	40.08677	2	1117.569247	1117.576774	K	E	319	329
PSM	ILEATAHAQAQLGCPVIIHPGR	1393	sp|Q60866|PTER_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	14-UNIMOD:4	ms_run[1]:scan=1.1.2661.4	39.25407	4	2351.249694	2351.253219	K	N	183	205
PSM	GNPAAVCLLER	1394	sp|Q9CXN7|PBLD2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	7-UNIMOD:4	ms_run[1]:scan=1.1.2625.13	38.25375	2	1198.602847	1198.612842	R	T	18	29
PSM	QLFHPEQLITGKEDAANNYAR	1395	sp|P05213|TBA1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2734.15	41.30805	4	2414.192894	2414.197872	R	G	85	106
PSM	INFDDNAEFR	1396	sp|Q9Z2I8|SUCB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2676.12	39.67758	2	1239.545647	1239.552016	K	Q	261	271
PSM	YVDIAIPCNNK	1397	sp|P14206|RSSA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	8-UNIMOD:4	ms_run[1]:scan=1.1.2611.2	37.87755	2	1305.631447	1305.638722	R	G	156	167
PSM	GTPLDTEVPLER	1398	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2738.16	41.42212	2	1325.674847	1325.682696	K	V	819	831
PSM	WALSQSNPSALR	1399	sp|Q01853|TERA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2654.18	39.07463	2	1328.681447	1328.683699	R	E	454	466
PSM	FLIPNASQPESK	1400	sp|P63101|1433Z_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2598.17	37.5144	2	1329.683647	1329.692866	K	V	104	116
PSM	IHVSDQELQSANASVDDSRLEELK	1401	sp|Q02053|UBA1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2720.15	40.92022	4	2682.296494	2682.309667	K	A	807	831
PSM	PLRLPLQDVYK	1402	sp|P10126|EF1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2792.4	42.92327	3	1340.771471	1340.781622	K	I	245	256
PSM	VLDASWYSPGTR	1403	sp|P52196|THTR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2790.20	42.8804	2	1350.648447	1350.656815	R	Q	31	43
PSM	LTLAQEDLISNR	1404	sp|Q8BL66|EEA1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2770.15	42.30942	2	1371.728447	1371.735794	K	N	1056	1068
PSM	SGNTPLDMNQFR	1405	sp|Q9DC50|OCTC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2696.18	40.23497	2	1378.620247	1378.629948	K	M	149	161
PSM	CGPGYSTPLEAMK	1406	sp|P17563|SBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	1-UNIMOD:4	ms_run[1]:scan=1.1.2627.19	38.315	2	1409.622847	1409.631923	K	G	8	21
PSM	DNPGVVTCLDEAR	1407	sp|Q02053|UBA1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	8-UNIMOD:4	ms_run[1]:scan=1.1.2629.16	38.36823	2	1444.656647	1444.661643	K	H	227	240
PSM	NVETMNYADIER	1408	sp|Q9D2G2|ODO2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2590.19	37.29498	2	1453.647047	1453.650744	R	T	335	347
PSM	LGFYGLHESDLDK	1409	sp|Q60597|ODO1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2732.4	41.24352	3	1492.707371	1492.719809	K	V	172	185
PSM	IFVGGLNPEATEEK	1410	sp|Q99020|ROAA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2759.18	42.00388	2	1502.752247	1502.761674	K	I	161	175
PSM	NFQYPSESSLAYK	1411	sp|Q64669|NQO1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2727.13	41.1166	2	1532.709447	1532.714724	K	E	65	78
PSM	EIYGQTETGLICR	1412	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	12-UNIMOD:4	ms_run[1]:scan=1.1.2670.20	39.51308	2	1538.733447	1538.739893	R	V	360	373
PSM	VAEGIFETEAPGGYK	1413	sp|Q9CPV4|GLOD4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2789.20	42.85209	2	1566.749047	1566.756589	K	F	110	125
PSM	AHQVVEDGYEFFAK	1414	sp|P62137|PP1A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2729.9	41.17344	2	1638.761447	1638.767822	R	R	247	261
PSM	VIVVGNPANTNCLTASK	1415	sp|P14152|MDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	12-UNIMOD:4	ms_run[1]:scan=1.1.2638.21	38.62642	2	1756.910247	1756.914169	K	S	126	143
PSM	MAPYQGPDAAPGALDYK	1416	sp|P57780|ACTN4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2756.21	41.92197	2	1763.817247	1763.818872	R	S	884	901
PSM	VPNSGKEEIEAAVEAAR	1417	sp|Q8BH00|AL8A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2606.17	37.73768	3	1768.885571	1768.895542	K	E	39	56
PSM	FFQEEVIPHHTEWEK	1418	sp|P51174|ACADL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2609.7	37.81207	4	1954.912094	1954.921363	K	A	67	82
PSM	LRGEDGESECVINYVEK	1419	sp|Q8R0Y6|AL1L1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	10-UNIMOD:4	ms_run[1]:scan=1.1.2591.15	37.31975	3	1995.924971	1995.920771	K	A	395	412
PSM	TSNHAIVLAQLITR	1420	sp|Q9R0H0|ACOX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2845.4	44.4228	3	1535.866571	1535.878376	K	G	183	197
PSM	YGLAAAVFTK	1421	sp|P47738|ALDH2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2795.5	43.00828	2	1039.563647	1039.570232	K	D	444	454
PSM	NFHFVHSSADVDSVVSGTLR	1422	sp|Q8CHT0|AL4A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2838.8	44.2322	4	2173.058894	2173.055231	K	S	318	338
PSM	ASSTLDNLFK	1423	sp|P97816|S100G_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2819.10	43.69117	2	1094.552847	1094.560789	K	E	46	56
PSM	TDVAAPFGGFK	1424	sp|Q8R0Y6|AL1L1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2811.10	43.46183	2	1108.547647	1108.555310	K	Q	866	877
PSM	VEGGTPLFTLR	1425	sp|Q9D2G2|ODO2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2929.9	46.80045	2	1188.642247	1188.650273	K	K	135	146
PSM	SVDEVFGEVVK	1426	sp|Q9DBP5|KCY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2907.13	46.18137	2	1206.605847	1206.613219	K	I	180	191
PSM	FPSLGPYNVSK	1427	sp|Q99LB2|DHRS4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2832.12	44.06447	2	1207.615847	1207.623724	R	T	177	188
PSM	IAEFAFEYAR	1428	sp|Q9D6R2|IDH3A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2994.8	48.59782	2	1215.586047	1215.592424	R	N	179	189
PSM	LIDDMVAQAMK	1429	sp|O88844|IDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2985.3	48.34993	2	1233.602847	1233.609730	R	S	250	261
PSM	LTLSCEEFIK	1430	sp|Q9DCM0|ETHE1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	5-UNIMOD:4	ms_run[1]:scan=1.1.2873.12	45.2303	2	1238.613647	1238.621675	R	V	215	225
PSM	FANTMGLVIER	1431	sp|Q78JT3|3HAO_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2890.7	45.6989	2	1249.641047	1249.648893	R	R	96	107
PSM	FLASVSTVLTSK	1432	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2969.8	47.91583	2	1251.699847	1251.707454	K	Y	129	141
PSM	FLASVSTVLTSK	1433	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2982.3	48.27167	2	1251.699847	1251.707454	K	Y	129	141
PSM	LILPHVDVQLK	1434	sp|P54071|IDHP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2937.3	47.0256	3	1273.765871	1273.775808	K	Y	70	81
PSM	VNPLGGAIALGHPLGCTGAR	1435	sp|Q8VCH0|THIKB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	16-UNIMOD:4	ms_run[1]:scan=1.1.2902.10	46.03773	3	1930.019771	1930.020700	K	Q	366	386
PSM	FAELAQIYAQR	1436	sp|Q9JHW2|NIT2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2895.14	45.84426	2	1308.674847	1308.682636	R	G	158	169
PSM	TGELNFVSCMR	1437	sp|Q91V76|CK054_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	9-UNIMOD:4	ms_run[1]:scan=1.1.2840.12	44.29122	2	1312.580447	1312.590392	R	Q	179	190
PSM	AVAVVVDPIQSVK	1438	sp|O35593|PSDE_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2838.15	44.23805	2	1323.767847	1323.776202	R	G	140	153
PSM	EGIECEVINLR	1439	sp|Q9D051|ODPB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	5-UNIMOD:4	ms_run[1]:scan=1.1.2912.10	46.31968	2	1330.649447	1330.655101	K	T	259	270
PSM	TLTIVDTGIGMTK	1440	sp|P07901|HS90A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3000.15	48.77338	2	1348.718647	1348.727203	R	A	88	101
PSM	QEGQNYGFFLR	1441	sp|Q9JIL4|NHRF3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2964.15	47.77937	2	1357.633647	1357.641499	K	I	15	26
PSM	VWSQACLDVCAPHLEEK	1442	sp|Q3TNA1|XYLB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	6-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.2837.13	44.2081	3	2040.930071	2040.939732	K	L	243	260
PSM	AEAETLPSLPITK	1443	sp|O88428|PAPS2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2902.13	46.04025	2	1368.739647	1368.750047	R	L	240	253
PSM	TIIPLISQCTPK	1444	sp|P08249|MDHM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	9-UNIMOD:4	ms_run[1]:scan=1.1.2960.16	47.6662	2	1369.757847	1369.763923	K	V	204	216
PSM	QAQNIVTLATSIK	1445	sp|Q8R4N0|CLYBL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2959.13	47.63522	2	1385.778447	1385.787829	K	E	324	337
PSM	QASPNIVIALAGNK	1446	sp|P35278|RAB5C_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2930.17	46.83587	2	1394.780647	1394.788164	R	A	122	136
PSM	FFGNNWAETYR	1447	sp|Q8CG76|ARK72_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2962.18	47.72482	2	1403.618047	1403.625849	R	N	259	270
PSM	FAVYLPPQAESGK	1448	sp|Q9R0P3|ESTD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2869.14	45.11728	2	1405.716247	1405.724166	R	C	32	45
PSM	VIGVSSFHAMAEQCITDQK	1449	sp|Q3UNZ8|QORL2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	14-UNIMOD:4	ms_run[1]:scan=1.1.2852.21	44.63547	3	2119.993871	2120.003061	R	T	109	128
PSM	VNDTIQIDLETGK	1450	sp|P62702|RS4X_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2799.16	43.13007	2	1444.738447	1444.740939	K	I	156	169
PSM	QNMLQGTEIGVLAK	1451	sp|Q9WTP7|KAD3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2970.13	47.94717	2	1500.784447	1500.797014	R	T	44	58
PSM	GWEEGVAQMSVGQR	1452	sp|P26883|FKB1A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2805.21	43.30385	2	1532.701847	1532.704176	R	A	59	73
PSM	YRCELLYEGPPDDEAAMGIK	1453	sp|P58252|EF2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	3-UNIMOD:4	ms_run[1]:scan=1.1.2963.17	47.7524	3	2326.059671	2326.060970	K	S	367	387
PSM	YAEIVHLTLPDGTK	1454	sp|P62814|VATB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2873.5	45.22445	3	1555.816271	1555.824609	R	R	68	82
PSM	VIPLFSPQCGECR	1455	sp|P00329|ADH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	9-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.2912.18	46.32635	2	1561.735447	1561.738119	K	I	90	103
PSM	HNAWYAALALSPGSK	1456	sp|Q7TNG8|LDHD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2901.7	46.0067	3	1584.795971	1584.804876	R	A	348	363
PSM	LLLEYTDTSYEDK	1457	sp|P15626|GSTM2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2891.20	45.73762	2	1588.742647	1588.750835	R	K	19	32
PSM	LRDYIWNTLNSGR	1458	sp|Q9CZU6|CISY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2828.8	43.94703	3	1606.810271	1606.821589	K	V	328	341
PSM	QLLDLELQSQGESR	1459	sp|Q9DBE0|CSAD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2967.20	47.86915	2	1614.816447	1614.821314	K	E	54	68
PSM	STEPCAHLLVSSIGVVGTAEQNR	1460	sp|O35215|DOPD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	5-UNIMOD:4	ms_run[1]:scan=1.1.2993.18	48.57857	3	2424.204071	2424.206723	K	T	53	76
PSM	GSLLIDSSTIDPSVSK	1461	sp|Q99L13|3HIDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2992.18	48.55132	2	1617.839047	1617.846132	K	E	125	141
PSM	KPLEALYGYDYLAK	1462	sp|Q8R164|BPHL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2923.5	46.62603	3	1642.851971	1642.860660	R	T	191	205
PSM	AANVLEGVCGLQPGDR	1463	sp|Q8BGA8|ACSM5_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	9-UNIMOD:4	ms_run[1]:scan=1.1.2869.19	45.12147	2	1654.805847	1654.809704	K	M	101	117
PSM	WVVIGDENYGEGSSR	1464	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2851.21	44.60668	2	1666.752247	1666.758714	R	E	657	672
PSM	LIAAYCNVGDIEGASK	1465	sp|Q6PB66|LPPRC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	6-UNIMOD:4	ms_run[1]:scan=1.1.2795.20	43.0208	2	1679.810847	1679.818872	R	I	202	218
PSM	EVFTEQADLSGITEAK	1466	tr|A0A0R4J0I1|A0A0R4J0I1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2952.20	47.4455	2	1736.835247	1736.846860	K	K	335	351
PSM	VTNEPILAFSQGSPER	1467	sp|Q8CHT0|AL4A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2904.21	46.10372	2	1743.872847	1743.879164	K	D	31	47
PSM	TFVVQGFGNVGLHSMR	1468	sp|P26443|DHE3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2970.5	47.94048	3	1747.872671	1747.882809	K	Y	303	319
PSM	VVYRPEHISFEELLK	1469	sp|Q9D6Y7|MSRA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2936.4	46.99768	4	1857.989294	1857.998885	R	V	119	134
PSM	LSGSNPYTTVTPQIINSK	1470	sp|P57780|ACTN4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2849.21	44.54978	2	1918.990247	1919.000007	K	W	606	624
PSM	LHIIEVGTPPTGNQPFPK	1471	sp|Q68FD5|CLH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2853.12	44.65658	3	1944.038771	1944.046898	K	K	228	246
PSM	LFDSNNDGKLELTEMAR	1472	sp|P12658|CALB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2880.16	45.42833	3	1951.926371	1951.930941	K	L	153	170
PSM	QSLIYHVASQQIQTLEK	1473	sp|Q9DCY0|KEG1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2907.21	46.18805	2	1985.048247	1985.058191	R	L	239	256
PSM	ADRDESSPYAAMLAAQDVAQR	1474	sp|P62264|RS14_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2956.18	47.5545	3	2264.046371	2264.049159	K	C	64	85
PSM	SCTLTFLGSTATPDDPYEVKR	1475	sp|Q91XE4|ACY3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	2-UNIMOD:4	ms_run[1]:scan=1.1.2991.12	48.5234	3	2357.112971	2357.120927	R	A	72	93
PSM	GHIASVLNAWPEDVVK	1476	sp|P06801|MAOX_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3014.12	49.16236	2	1733.912047	1733.910070	K	A	131	147
PSM	LILPGLISSR	1477	sp|P17563|SBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3164.6	53.37373	2	1067.660447	1067.670280	K	I	94	104
PSM	AVAIDLPGLGR	1478	sp|Q8VCR7|ABHEB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3068.4	50.66353	2	1080.619647	1080.629144	R	S	64	75
PSM	SPGASLLPVLTK	1479	sp|Q8VC30|TKFC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3001.8	48.79603	2	1181.692647	1181.701974	K	A	511	523
PSM	YIIWSPVCR	1480	sp|P11352|GPX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	8-UNIMOD:4	ms_run[1]:scan=1.1.3038.11	49.81664	2	1192.599647	1192.606300	K	N	147	156
PSM	IHQYFGDLCSQLLSR	1481	sp|Q8JZZ0|UD3A2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	9-UNIMOD:4	ms_run[1]:scan=1.1.3054.7	50.26702	3	1835.895071	1835.898853	K	K	112	127
PSM	GVVQDLQQAISK	1482	sp|P57776|EF1D_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3035.11	49.73063	2	1284.693647	1284.703765	R	L	96	108
PSM	IVGAPMHDLLLWNNATVTTCHSK	1483	sp|Q922D8|C1TC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	20-UNIMOD:4	ms_run[1]:scan=1.1.3055.7	50.29438	4	2577.278894	2577.283199	K	T	176	199
PSM	KNDIENILNWNVMQHK	1484	sp|P28271|ACOC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3068.11	50.66938	3	1994.988671	1994.999630	K	N	57	73
PSM	YFDSFGDLSSASAIMGNAK	1485	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	15-UNIMOD:35	ms_run[1]:scan=1.1.3194.13	54.2128	3	1995.882071	1995.888408	R	V	42	61
PSM	DTLYFMDDAEK	1486	sp|O35488|S27A2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3012.8	49.10775	2	1346.557647	1346.570034	K	T	590	601
PSM	DLGTDSQIFISR	1487	sp|Q61598|GDIB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3043.15	49.96365	2	1350.669447	1350.677945	K	A	391	403
PSM	IGTEGQGFLIAMK	1488	sp|Q9D7B6|ACAD8_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3041.12	49.90367	2	1363.707047	1363.716973	R	G	257	270
PSM	ALGMTPAAFSALPR	1489	sp|Q62468|VILI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3168.10	53.48728	2	1401.736047	1401.743856	R	W	801	815
PSM	LVTGWVKPIIIGR	1490	sp|O88844|IDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3010.7	49.05405	2	1450.894047	1450.902406	R	H	120	133
PSM	CMALSTAILVGEAK	1491	sp|Q9EQ20|MMSA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	1-UNIMOD:4	ms_run[1]:scan=1.1.3118.15	52.07642	2	1462.743847	1462.752372	R	K	317	331
PSM	FLTEELSLDQDR	1492	sp|O35215|DOPD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3013.7	49.13212	2	1464.699047	1464.709639	K	I	84	96
PSM	YSPIADMLCEAGR	1493	sp|Q9DBM2|ECHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	9-UNIMOD:4	ms_run[1]:scan=1.1.3200.16	54.38788	2	1481.658847	1481.664285	R	F	553	566
PSM	LYATTSLYSAWDK	1494	sp|P17563|SBP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3054.14	50.27287	2	1517.730447	1517.740210	R	Q	399	412
PSM	NSTLTFVTMSGELK	1495	sp|Q9DCG6|PBLD1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3113.16	51.93738	2	1526.758047	1526.765045	R	A	98	112
PSM	VKPGYLGTAFAHYDVQVIDEQGNVLPPGK	1496	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3162.13	53.32483	4	3111.603294	3111.602936	K	E	379	408
PSM	TFLLDGDEVIITGHCQGDGYR	1497	sp|P35505|FAAA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	15-UNIMOD:4	ms_run[1]:scan=1.1.3165.14	53.40783	3	2365.095071	2365.100860	R	V	382	403
PSM	RAFPAWADTSILSR	1498	sp|Q9EQ20|MMSA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3014.3	49.14902	3	1589.823371	1589.831425	K	Q	88	102
PSM	IINEPTAAAIAYGLDK	1499	sp|P16627|HS71L_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3109.19	51.83037	2	1658.881047	1658.887937	R	G	174	190
PSM	TLVYGGIFLYPANKK	1500	sp|Q9QXD6|F16P1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3035.8	49.72813	3	1682.933471	1682.939579	R	S	256	271
PSM	NAVITVPAYFNDSQR	1501	sp|P38647|GRP75_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3046.19	50.05322	2	1693.833047	1693.842384	K	Q	188	203
PSM	RFGLEGCEVLIPALK	1502	sp|Q60597|ODO1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	7-UNIMOD:4	ms_run[1]:scan=1.1.3195.5	54.23502	3	1700.920571	1700.928363	K	T	277	292
PSM	VGDAIPSVEVFEGEPGK	1503	sp|P99029|PRDX5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3134.19	52.53378	2	1728.852047	1728.857031	K	K	54	71
PSM	VAGHDINYLALSGVLSK	1504	sp|O09174|AMACR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3118.4	52.06725	3	1755.941171	1755.951935	K	I	118	135
PSM	IHFPLATYAPVISAEK	1505	sp|P05213|TBA1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3130.6	52.40977	3	1755.949271	1755.955957	R	A	265	281
PSM	LCNPPVNAISPTVITEVR	1506	sp|Q9DBM2|ECHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	2-UNIMOD:4	ms_run[1]:scan=1.1.3152.21	53.05404	2	1979.046847	1979.050997	R	N	16	34
PSM	TVTNAVVTVPAYFNDSQR	1507	sp|P63017|HSP7C_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3070.21	50.73488	2	1980.983447	1980.990505	K	Q	138	156
PSM	ALYQTEAFTADFQQPTEAK	1508	sp|P07759|SPA3K_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3091.16	51.3306	3	2158.011671	2158.021865	R	N	158	177
PSM	ISVAGVTSGNVGYLAHAIHQVTK	1509	sp|P05202|AATM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3068.6	50.6652	4	2321.244094	2321.249179	R	-	408	431
PSM	TFLLDGDEVIITGHCQGDGYR	1510	sp|P35505|FAAA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	15-UNIMOD:4	ms_run[1]:scan=1.1.3163.14	53.35295	3	2365.095071	2365.100860	R	V	382	403
PSM	ITSLAQLNAANHDAAIFPGGFGAAK	1511	sp|Q9D172|GAL3A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3203.19	54.4762	3	2454.262271	2454.265558	K	N	115	140
PSM	LAELEEFINGPNNAHIQQVGDR	1512	sp|Q68FD5|CLH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3083.18	51.10375	3	2463.207371	2463.214250	R	C	1183	1205
PSM	VLTPTQVMNRPSSISWDGLDPGK	1513	sp|P70296|PEBP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3186.13	53.98932	3	2497.259771	2497.263509	K	L	40	63
PSM	AVPLAGFGYGLPISR	1514	sp|Q8BFP9|PDK1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3433.4	60.90737	2	1516.831447	1516.840199	R	L	347	362
PSM	TDLALILSAGDN	1515	sp|P12658|CALB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3600.3	65.59184	2	1201.613847	1201.619033	R	-	250	262
PSM	DLFQVIYNVK	1516	sp|P98078|DAB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3561.4	64.50597	2	1237.662247	1237.670674	K	K	164	174
PSM	FVSISDLFVPK	1517	sp|Q61598|GDIB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3572.3	64.81454	2	1250.684647	1250.691075	K	D	380	391
PSM	IDVLFNVAGFVHHGTILDCEEK	1518	sp|Q8JZV9|BDH2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	19-UNIMOD:4	ms_run[1]:scan=1.1.3435.3	60.95167	4	2512.243694	2512.242045	R	D	75	97
PSM	ELNDFISYLQR	1519	sp|P27773|PDIA3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3438.6	61.03545	2	1396.688247	1396.698680	R	E	472	483
PSM	LDNLVAIFDINR	1520	sp|P40142|TKT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3642.5	66.80922	2	1401.747847	1401.761615	K	L	175	187
PSM	SVDPTLALSVYLR	1521	sp|Q68FD5|CLH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3529.9	63.59243	2	1432.785447	1432.792580	K	A	469	482
PSM	DIVLVAYGVLGTQR	1522	sp|Q91WR5|AK1CL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3608.9	65.82658	2	1502.841647	1502.845679	K	Y	210	224
PSM	NPAIIFEDANLEECIPATVR	1523	sp|Q8BH00|AL8A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	14-UNIMOD:4	ms_run[1]:scan=1.1.3531.16	63.65585	3	2271.115571	2271.120533	K	S	258	278
PSM	GLGGVNVEELFGISK	1524	sp|Q9Z2V4|PCKGC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3622.8	66.23027	2	1517.806447	1517.808959	K	E	568	583
PSM	LGILGLCNTLAIEGR	1525	sp|P51660|DHB4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	7-UNIMOD:4	ms_run[1]:scan=1.1.3464.15	61.75928	2	1598.874047	1598.881412	K	K	169	184
PSM	TIFSTLENDPLFAR	1526	sp|Q9EPL9|ACOX3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3582.11	65.10067	2	1622.830247	1622.830422	K	S	50	64
PSM	AGVPPGVINIVFGTGPR	1527	sp|Q8BH00|AL8A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3573.13	64.85153	2	1649.923247	1649.925326	K	V	197	214
PSM	TLTQCSWLLDGFPR	1528	sp|Q9WTP7|KAD3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	5-UNIMOD:4	ms_run[1]:scan=1.1.3507.11	62.97047	2	1692.828847	1692.829377	K	T	81	95
PSM	TLASLSPETSLFIIASK	1529	sp|P06745|G6PI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3624.19	66.29747	2	1776.984647	1776.987317	K	T	195	212
PSM	DMGMVTILVHNTASALR	1530	sp|P34914|HYES_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3532.4	63.67445	3	1827.924971	1827.933524	R	E	195	212
PSM	FFNQLFSGLDPHALAGR	1531	sp|Q9DBE0|CSAD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3503.3	62.85668	3	1888.949171	1888.958417	R	I	89	106
PSM	TLISLAPGSPNPSMFPFK	1532	sp|Q9WVM8|AADAT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3622.17	66.24112	2	1902.987847	1902.991357	K	S	32	50
PSM	GHYTEGAELVDSVLDVVR	1533	sp|P68372|TBB4B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3477.10	62.11585	3	1957.971971	1957.974521	K	K	104	122
PSM	VLSSYPINTLVGAPIIYR	1534	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3583.9	65.13443	2	1975.116447	1975.114249	K	M	300	318
PSM	LLVEHQGVSFLLAEMAMK	1535	sp|P45952|ACADM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3540.6	63.90697	3	2015.053571	2015.058390	K	V	312	330
PSM	NIANPTATLLASCMMLDHLK	1536	sp|P70404|IDHG1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	13-UNIMOD:4	ms_run[1]:scan=1.1.3508.10	62.99747	3	2213.098271	2213.100666	K	L	321	341
PSM	ISQAEEDDQQLLGHLLLVAK	1537	sp|Q9D0S9|HINT2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3461.8	61.67183	3	2219.175671	2219.179762	R	K	100	120
PSM	GLTDNFADVQVSVVDCPDLTK	1538	sp|Q91V76|CK054_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	16-UNIMOD:4	ms_run[1]:scan=1.1.3467.7	61.83473	3	2292.087371	2292.094378	K	E	23	44
PSM	KFDLGQDVIDFTGHSLALYR	1539	sp|Q61598|GDIB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3530.15	63.62635	3	2294.165471	2294.169532	K	T	174	194
PSM	AIVAGDEVAQEVDAVAPDCSFLK	1540	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	19-UNIMOD:4	ms_run[1]:scan=1.1.3514.14	63.16428	3	2403.165971	2403.162792	R	I	156	179
PSM	EFFAEQNLSYTEEPLAEIAGAK	1541	sp|O55060|TPMT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3636.9	66.64685	3	2456.173271	2456.174737	R	V	93	115
PSM	INESIGQGDLSELPELHALTAGLK	1542	sp|Q9R0H0|ACOX1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3519.15	63.30903	3	2504.313071	2504.312233	R	A	355	379
PSM	YNLGAPVAGTCYQAEWDDYVPK	1543	sp|P70296|PEBP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	11-UNIMOD:4	ms_run[1]:scan=1.1.3436.7	60.98518	3	2516.125871	2516.131826	K	L	158	180
PSM	DQEGQDVLLFIDNIFR	1544	sp|P56480|ATPB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3988.4	76.02309	2	1920.968647	1920.958142	R	F	295	311
PSM	ELLMLENFIGGK	1545	sp|Q8BH00|AL8A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3654.4	67.14858	2	1362.714247	1362.721724	R	F	6	18
PSM	DITYFIQQLLR	1546	sp|Q641P0|ARP3B_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3932.3	74.86972	2	1408.765647	1408.771451	R	E	199	210
PSM	ENFIPTIVNFSAEEISDAIR	1547	sp|Q9JHU4|DYHC1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3851.4	72.67484	3	2264.130671	2264.132478	R	E	3343	3363
PSM	GMYGIENEVFLSLPCILNAR	1548	sp|P16125|LDHB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	15-UNIMOD:4	ms_run[1]:scan=1.1.3848.9	72.58998	3	2295.143771	2295.139160	K	G	280	300
PSM	SALASVIMGLSPILGK	1549	sp|Q76MZ3|2AAA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3799.12	71.22698	2	1555.894247	1555.900751	K	D	343	359
PSM	GYGDSSSPPEIEEYAMELLCK	1550	sp|P34914|HYES_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	20-UNIMOD:4	ms_run[1]:scan=1.1.3806.7	71.4151	3	2374.037471	2374.034480	K	E	293	314
PSM	DVFLGTFLYEYSR	1551	sp|P07724|ALBU_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3801.12	71.28332	2	1608.779447	1608.782410	K	R	348	361
PSM	IPEWWLANVACLR	1552	sp|Q3UNX5|ACSM3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	11-UNIMOD:4	ms_run[1]:scan=1.1.3714.9	68.83888	2	1626.824047	1626.834068	K	T	124	137
PSM	ILSISADIETIGEILK	1553	sp|P61979|HNRPK_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3832.8	72.14018	2	1713.967247	1713.976418	R	K	87	103
PSM	DIVYEMGELGVLGPTIK	1554	sp|Q60759|GCDH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3773.18	70.50647	2	1832.949447	1832.959388	R	G	95	112
PSM	DGLLDVVEALQSPLVDKK	1555	sp|Q9QYR9|ACOT2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3796.3	71.13531	3	1938.064271	1938.067358	K	S	328	346
PSM	MGGSSGALYGLFLTAAAQPLK	1556	sp|Q8VC30|TKFC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3767.5	70.32415	3	2052.065771	2052.071398	R	A	443	464
PSM	IVAPELYIAVGISGAIQHLAGMK	1557	sp|Q99LC5|ETFA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3871.3	73.22967	3	2350.301171	2350.308274	K	D	269	292
PSM	LGAGYPMGPFELLDYVGLDTTK	1558	sp|Q61425|HCDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3882.4	73.54321	3	2356.161671	2356.166086	K	F	250	272
PSM	FLQNSLGAVPSPFDCYLCCR	1559	sp|Q8VCN5|CGL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	15-UNIMOD:4,18-UNIMOD:4,19-UNIMOD:4	ms_run[1]:scan=1.1.3654.10	67.16026	3	2403.083771	2403.080994	R	G	237	257
PSM	YSPDCTIIVVSNPVDILTYVTWK	1560	sp|P16125|LDHB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	5-UNIMOD:4	ms_run[1]:scan=1.1.3888.6	73.69935	3	2682.360371	2682.361492	K	L	128	151
PSM	ISTSLPVLDLIDAIQPGSINYDLLK	1561	sp|Q61233|PLSL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3930.4	74.81288	3	2697.483671	2697.484050	K	T	546	571
PSM	DGIEPGHIPGSVNIPFTEFLTNEGLEK	1562	sp|Q99J99|THTM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3769.21	70.3953	3	2909.450171	2909.444704	R	S	198	225
PSM	EAVGDDESVPENVLNFDDLTADALAALK	1563	sp|P26638|SYSC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3902.7	74.08362	3	2930.412971	2930.403293	K	V	72	100
PSM	CLYSLINEAFR	1564	sp|Q9DBM2|ECHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.3937.3	75.00325	2	1367.6483	1367.6538	R	I	618	629
PSM	QVEELYQSLLELGEK	1565	sp|P16546|SPTN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:28	ms_run[1]:scan=1.1.3959.3	75.441	2	1759.8772	1759.8872	K	R	1068	1083
PSM	QAAPCVLFFDELDSIAK	1566	sp|Q01853|TERA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:28,5-UNIMOD:4	ms_run[1]:scan=1.1.3990.3	76.05542	2	1905.9145	1905.9177	R	A	568	585
PSM	HNVMVSTEWAAPNVFK	1567	sp|P17563|SBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2965.8	47.802	3	1828.884971	1828.893040	R	D	196	212
PSM	CLELFSELAEDK	1568	sp|P11499|HS90B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.3953.3	75.26953	2	1435.6482	1435.6536	K	E	412	424
PSM	KTDGVYDPVEYEK	1569	sp|Q99K67|AASS_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2286.12	28.88082	2	1542.728647	1541.724954	R	Y	274	287
PSM	EEIIPVAPEYDK	1570	sp|P45952|ACADM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2835.18	44.15542	2	1402.695247	1401.702762	R	S	58	70
PSM	CMTEEIFGPVTCVVPFDSEEEVITR	1571	sp|Q8BH00|AL8A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:385,1-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.3937.5	75.0116	3	2926.3133	2926.3070	R	A	387	412
PSM	SFQHLLQTLNRPDSELQLSTGNGLFVNNDLK	1572	sp|P07758|A1AT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3484.20	62.32482	4	3497.788894	3497.790296	K	L	113	144
PSM	GIRPAINVGLSVSR	1573	sp|Q03265|ATPA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2597.10	37.48095	3	1437.832271	1437.841596	K	V	403	417
PSM	QLLQANPILEAFGNAK	1574	sp|Q8VDD5|MYH9_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:28	ms_run[1]:scan=1.1.3897.8	73.93602	2	1708.9103	1708.9143	R	T	210	226
PSM	QFLSGELEVELTPQGTLAER	1575	sp|Q9D0K2|SCOT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:28	ms_run[1]:scan=1.1.3848.6	72.58582	3	2199.1030	2199.1054	R	I	125	145
PSM	GGHVNLTMLGAMQVSK	1576	sp|Q9D0K2|SCOT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2765.9	42.16443	3	1642.833971	1641.833082	R	Y	391	407
PSM	QEQDTYALSSYTR	1577	sp|Q8QZT1|THIL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:28	ms_run[1]:scan=1.1.2946.16	47.28197	2	1543.6731	1543.6785	R	S	206	219
PSM	VDVHFCGVNFADILACR	1578	sp|Q3UNZ8|QORL2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	6-UNIMOD:4,16-UNIMOD:4	ms_run[1]:scan=1.1.3533.5	63.70398	3	1991.930471	1991.934587	R	G	56	73
PSM	MFCLQSSQALQVLENSLR	1579	sp|Q9DCY0|KEG1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:1,1-UNIMOD:35,3-UNIMOD:4	ms_run[1]:scan=1.1.3898.5	73.96425	3	2181.0517	2181.0553	-	K	1	19
PSM	CAFMGSLAPGHVADFLVADFR	1580	tr|A0A0J9YU79|A0A0J9YU79_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.3873.6	73.2838	3	2263.0456	2263.0549	R	Q	57	78
PSM	CVSTLLDLIQTK	1581	sp|O35643|AP1B1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.3951.2	75.21867	2	1372.7225	1372.7267	R	V	391	403
PSM	LPCIFICENNR	1582	sp|P35486|ODPA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	3-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=1.1.2981.12	48.24983	2	1434.668647	1434.674791	K	Y	216	227
PSM	AASGAPLRPATVLGTMEMGR	1583	sp|Q8CG76|ARK72_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	23		ms_run[1]:scan=1.1.2902.11	46.03858	3	1986.0452	1985.0182	R	R	38	58
PSM	QPVGVAAIITPWNFPSAMITR	1584	sp|Q8BWF0|SSDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:28	ms_run[1]:scan=1.1.3988.3	76.01723	3	2251.1875	2251.1818	K	K	181	202
PSM	QFLLAAEAIDDIPFGITSNSGVFSK	1585	sp|P09103|PDIA1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:28	ms_run[1]:scan=1.1.4142.2	77.83511	3	2622.3271	2622.3212	K	Y	173	198
PSM	CLEDMFDALEGK	1586	sp|P52825|CPT2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.3976.3	75.8019	2	1409.5817	1409.5838	K	A	643	655
PSM	PFVELETNLPASR	1587	sp|O35215|DOPD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:1	ms_run[1]:scan=1.1.3800.13	71.2559	2	1513.7771	1513.7771	M	I	2	15
PSM	AEAGEGQKPSPAQLELR	1588	sp|Q8K183|PDXK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2254.12	27.99547	3	1779.909071	1779.911526	K	M	276	293
PSM	GSLLIDSSTIDPSVSK	1589	sp|Q99L13|3HIDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2999.20	48.74902	2	1616.829447	1617.846132	K	E	125	141
PSM	LICCDILDVLDK	1590	sp|P62259|1433E_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	3-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=1.1.3571.11	64.79272	2	1476.731247	1475.736388	K	H	95	107
PSM	HNLCGETEEER	1591	sp|O35660|GSTM6_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	4-UNIMOD:4	ms_run[1]:scan=1.1.1714.18	12.98748	2	1372.576047	1372.567742	K	I	84	95
PSM	KPVHPNDHVNK	1592	sp|P97807|FUMH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.1567.10	8.90665	3	1283.664071	1283.673468	K	S	170	181
PSM	VNVPVIGGHAGK	1593	sp|P08249|MDHM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2198.5	26.45137	3	1146.640571	1146.650942	R	T	192	204
PSM	KNPDSLELIR	1594	sp|Q91YI0|ARLY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2299.4	29.22743	3	1183.646771	1183.656087	K	S	288	298
PSM	MAEHNLLLHLR	1595	sp|Q99KR3|LACB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2370.5	31.18173	3	1345.719971	1345.728875	K	K	256	267
PSM	APEEILAEK	1596	tr|D3Z5G7|D3Z5G7_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2208.10	26.73267	2	998.521247	998.528427	K	S	332	341
PSM	IWHHTFYNELR	1597	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2318.9	29.75873	3	1514.734571	1514.741882	K	V	85	96
PSM	TAVCDIPPR	1598	sp|P68372|TBB4B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	4-UNIMOD:4	ms_run[1]:scan=1.1.2190.15	26.2343	2	1027.503447	1027.512065	K	G	351	360
PSM	AYDATCLVK	1599	sp|Q9R0P3|ESTD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	6-UNIMOD:4	ms_run[1]:scan=1.1.2356.7	30.80162	2	1039.491247	1039.500832	K	A	201	210
PSM	GFEEAVAAGAK	1600	sp|P38060|HMGCL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2283.8	28.79762	2	1048.509447	1048.518925	K	E	112	123
PSM	IGFTGSTEVGK	1601	sp|Q8R0Y6|AL1L1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2309.12	29.51008	2	1094.551447	1094.560789	K	H	646	657
PSM	KQTALAELVK	1602	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2184.16	26.0643	2	1099.652447	1099.660110	K	H	549	559
PSM	LQNLQLQPGK	1603	sp|P32020|NLTP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2318.13	29.76207	2	1137.640647	1137.650607	K	A	535	545
PSM	ATAVMPDGQFK	1604	sp|P35700|PRDX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2360.16	30.91663	2	1163.556647	1163.564495	K	D	17	28
PSM	KFDQLLAEEK	1605	sp|O08638|MYH11_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2308.16	29.4861	2	1219.633447	1219.644853	K	N	1452	1462
PSM	NQFTVAQYEK	1606	sp|Q3UZZ6|ST1D1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2356.12	30.80663	2	1226.585447	1226.593152	K	F	266	276
PSM	EQVANSAFVER	1607	sp|P11499|HS90B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2222.20	27.11992	2	1248.600647	1248.609865	K	V	492	503
PSM	KPAPSQALLFGK	1608	sp|O35855|BCAT2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2330.20	30.1055	2	1255.718047	1255.728858	K	T	48	60
PSM	AAISDSVVEPAAK	1609	sp|Q62468|VILI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2292.17	29.04065	2	1256.653247	1256.661232	K	A	238	251
PSM	IDEPLEGSEDR	1610	sp|P61979|HNRPK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2207.17	26.70748	2	1258.561447	1258.567725	K	I	423	434
PSM	SLNPELGTDADK	1611	sp|P06151|LDHA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2246.20	27.77715	2	1258.596447	1258.604111	K	E	213	225
PSM	LAQEDPDYGLR	1612	sp|P24270|CATA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2360.19	30.91915	2	1275.601047	1275.609531	R	D	253	264
PSM	LAQEDPDYGLR	1613	sp|P24270|CATA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2353.7	30.72603	2	1275.601047	1275.609531	R	D	253	264
PSM	ICNQVLVCER	1614	sp|Q9Z2I9|SUCB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	2-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.2268.19	28.38193	2	1289.612447	1289.622027	R	K	151	161
PSM	INVYYNEATGGK	1615	sp|P68372|TBB4B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2348.19	30.59462	2	1327.632247	1327.640831	R	Y	47	59
PSM	ADIVENQVMDTR	1616	sp|P10649|GSTM1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	9-UNIMOD:35	ms_run[1]:scan=1.1.2208.12	26.73602	2	1405.638247	1405.650744	R	M	97	109
PSM	VCVQTVESGAMTK	1617	sp|P54071|IDHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	2-UNIMOD:4	ms_run[1]:scan=1.1.2291.20	29.01562	2	1408.660247	1408.669036	K	D	401	414
PSM	GGGALVENTTTGLSR	1618	sp|Q60866|PTER_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2359.10	30.89383	2	1431.721447	1431.731771	K	D	91	106
PSM	STGSVVGQQPFGGAR	1619	sp|Q8CHT0|AL4A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2339.21	30.34955	2	1446.712047	1446.721541	K	A	509	524
PSM	GDATVSYEDPPTAK	1620	sp|Q61545|EWS_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2209.20	26.76295	2	1449.652247	1449.662354	K	A	410	424
PSM	ENYGELADCCTK	1621	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	9-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.2254.14	27.9988	2	1458.568047	1458.575530	R	Q	106	118
PSM	SEGTYCCGPVSVR	1622	sp|P21981|TGM2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	6-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=1.1.2263.21	28.24527	2	1470.611847	1470.623149	K	A	365	378
PSM	FSSQEAASSFGDDR	1623	sp|Q91ZA3|PCCA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2380.21	31.47287	2	1502.619247	1502.627366	R	L	240	254
PSM	IWHHTFYNELR	1624	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2324.12	29.92943	3	1514.734571	1514.741882	K	V	85	96
PSM	MHSVGICGSDVHYWEHGR	1625	sp|Q64442|DHSO_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	7-UNIMOD:4	ms_run[1]:scan=1.1.2337.8	30.28488	4	2125.907694	2125.921062	K	I	39	57
PSM	NQQEGVCPEGSIDNSPVK	1626	sp|Q921I1|TRFE_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	7-UNIMOD:4	ms_run[1]:scan=1.1.2373.19	31.27555	3	1956.882371	1956.884720	R	W	344	362
PSM	HLEINPDHPIVETLR	1627	sp|P11499|HS90B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2595.2	37.41938	4	1781.936894	1781.942433	K	Q	625	640
PSM	NLGSVDFPR	1628	sp|Q91XE4|ACY3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2599.9	37.53543	2	1003.500247	1003.508694	R	T	224	233
PSM	MFASFPTTK	1629	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2614.3	37.94345	2	1028.492447	1028.500103	R	T	33	42
PSM	EGGLLTLAGAK	1630	sp|Q8BVI4|DHPR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2730.3	41.18813	2	1028.579847	1028.586610	K	A	125	136
PSM	YIATPIFSK	1631	sp|P10649|GSTM1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2717.7	40.82765	2	1038.567047	1038.574983	R	M	203	212
PSM	HDVVFLITK	1632	sp|Q68FD5|CLH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2593.9	37.37023	2	1070.603447	1070.612431	K	Y	270	279
PSM	LGDVYVNDAFGTAHR	1633	sp|P09041|PGK2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2672.9	39.56078	3	1633.778771	1633.784869	K	A	157	172
PSM	HWPFMVVNDAGRPK	1634	sp|P63017|HSP7C_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2614.7	37.94678	3	1652.816171	1652.824566	K	V	89	103
PSM	VVEIAPATHLDPQLR	1635	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2704.12	40.45912	3	1657.906871	1657.915155	K	S	274	289
PSM	LYTLVLTDPDAPSRK	1636	sp|P70296|PEBP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2760.10	42.02553	3	1687.904171	1687.914486	K	D	63	78
PSM	ALTGGIAHLFK	1637	sp|O08749|DLDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2689.10	40.03247	2	1126.638847	1126.649879	K	Q	133	144
PSM	MEIQEIQLK	1638	sp|P58771|TPM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2785.10	42.72932	2	1130.593047	1130.600546	K	E	141	150
PSM	TVVTEAGNLLK	1639	sp|Q61207|SAP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2696.12	40.22997	2	1143.640447	1143.649939	K	D	68	79
PSM	IGQFQLMQGK	1640	sp|Q9JHI5|IVD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2643.10	38.75893	2	1148.595247	1148.601214	K	M	317	327
PSM	SEGGFIWACK	1641	sp|O88844|IDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	9-UNIMOD:4	ms_run[1]:scan=1.1.2765.11	42.1661	2	1153.514447	1153.522630	K	N	261	271
PSM	SADTLWDIQK	1642	sp|P16125|LDHB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2784.10	42.70072	2	1175.576647	1175.582253	K	D	320	330
PSM	CAVVDVPFGGAK	1643	sp|P26443|DHE3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	1-UNIMOD:4	ms_run[1]:scan=1.1.2725.9	41.0571	2	1218.601047	1218.606694	K	A	172	184
PSM	RPDPIDWSLK	1644	sp|Q9D964|GATM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2619.16	38.08937	2	1225.637847	1225.645522	R	Y	143	153
PSM	HFRDEELSCSVLELK	1645	sp|P07759|SPA3K_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	9-UNIMOD:4	ms_run[1]:scan=1.1.2679.12	39.76288	3	1860.899471	1860.903998	R	Y	252	267
PSM	FYDVALDTGDK	1646	sp|Q9DBE0|CSAD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2705.13	40.48835	2	1242.568047	1242.576833	K	V	342	353
PSM	IQLVEEELDR	1647	tr|D3Z2H9|D3Z2H9_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2730.13	41.19648	2	1242.635447	1242.645582	R	A	56	66
PSM	MVVDSAYEVIK	1648	sp|P16125|LDHB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	1-UNIMOD:35	ms_run[1]:scan=1.1.2603.13	37.64967	2	1268.623447	1268.632240	K	L	234	245
PSM	LGFPMYAHVDK	1649	sp|Q9DCY0|KEG1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2627.2	38.30082	3	1276.618271	1276.627429	K	A	256	267
PSM	RPSANCDPYAVTEAIVR	1650	sp|P15105|GLNA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	6-UNIMOD:4	ms_run[1]:scan=1.1.2677.13	39.70693	3	1917.927971	1917.936696	R	T	341	358
PSM	GTPLDTEVPLER	1651	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2732.15	41.2527	2	1325.674847	1325.682696	K	V	819	831
PSM	VLQETILVEER	1652	sp|Q9WV92|E41L3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2716.17	40.80723	2	1327.724447	1327.734731	K	H	690	701
PSM	LAGCTVFITGASR	1653	sp|Q2TPA8|HSDL2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	4-UNIMOD:4	ms_run[1]:scan=1.1.2676.16	39.68093	2	1351.686847	1351.691821	K	G	8	21
PSM	DIEPGSPAEAAGLK	1654	sp|Q9JIL4|NHRF3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2592.16	37.34843	2	1353.668847	1353.677610	K	N	270	284
PSM	VIDPATATSVDLR	1655	sp|P80315|TCPD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2728.10	41.14542	2	1356.712447	1356.724895	K	D	194	207
PSM	AALEALGSCLNNK	1656	sp|Q9CZN7|GLYM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	9-UNIMOD:4	ms_run[1]:scan=1.1.2626.17	38.2852	2	1359.671047	1359.681650	R	Y	83	96
PSM	LVQMSICSSLAR	1657	sp|Q9Z0S1|BPNT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	7-UNIMOD:4	ms_run[1]:scan=1.1.2785.15	42.73348	2	1363.687647	1363.695192	R	K	53	65
PSM	LSQALGNITVVQK	1658	sp|Q9CZ42|NNRD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2646.19	38.85212	2	1369.786247	1369.792915	K	G	230	243
PSM	CLYASVLTAQPR	1659	sp|P58252|EF2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	1-UNIMOD:4	ms_run[1]:scan=1.1.2784.19	42.70823	2	1377.696847	1377.707471	R	L	728	740
PSM	VGVPTETGALTLNR	1660	sp|Q8BWT1|THIM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2728.12	41.14875	2	1426.770047	1426.777993	R	L	77	91
PSM	ARPFPDGLAEDIDKGEVSAR	1661	sp|P58252|EF2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	22		ms_run[1]:scan=1.1.2747.19	41.67528	3	2142.0542	2142.0702	K	Q	606	626
PSM	TPSCCYLWCGK	1662	sp|Q62468|VILI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	4-UNIMOD:4,5-UNIMOD:4,9-UNIMOD:4	ms_run[1]:scan=1.1.2637.17	38.5946	2	1430.570047	1430.578113	K	G	550	561
PSM	LTGFHETSNINDFSAGVANR	1663	sp|P15105|GLNA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2709.17	40.60525	3	2149.014671	2149.018845	R	G	300	320
PSM	LVPGWTKPITIGR	1664	sp|P54071|IDHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2768.3	42.24315	3	1436.842871	1436.850370	R	H	160	173
PSM	YHTSQSGDEMTSLSEYVSR	1665	sp|P11499|HS90B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2711.18	40.66363	3	2175.930371	2175.937877	R	M	457	476
PSM	SQFTITPGSEQIR	1666	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2620.20	38.12012	2	1462.734647	1462.741607	K	A	412	425
PSM	DIVHSGLAYTMER	1667	sp|P26443|DHE3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2790.4	42.86703	3	1490.709371	1490.718763	K	S	504	517
PSM	SLTNDWEDHLAVK	1668	sp|P11499|HS90B_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2742.6	41.5267	3	1526.727671	1526.736522	K	H	307	320
PSM	FEPQINAEESEIR	1669	sp|Q64516|GLPK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2655.13	39.10243	2	1560.730847	1560.742001	R	Y	493	506
PSM	IEGRPGASLPPLNLK	1670	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2648.8	38.89945	3	1560.889571	1560.898777	R	E	974	989
PSM	EQWSNCPTIGQIR	1671	sp|P10605|CATB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	6-UNIMOD:4	ms_run[1]:scan=1.1.2691.21	40.09678	2	1587.737847	1587.746375	R	D	88	101
PSM	VIAINVDDPDAANYK	1672	sp|Q9D819|IPYR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2787.19	42.79422	2	1616.797847	1616.804602	K	D	156	171
PSM	QDLPNAMNAAEITDK	1673	sp|P61205|ARF3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2758.19	41.9765	2	1629.753247	1629.766836	K	L	128	143
PSM	VASSVPVENFTIHGGLSR	1674	sp|Q60597|ODO1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2765.15	42.16943	3	1868.964971	1868.974461	K	I	620	638
PSM	VAPEEHPVLLTEAPLNPK	1675	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2738.15	41.42128	3	1953.063971	1953.057128	R	A	96	114
PSM	GVEVTVGHEQEEGGKWPYAGTAEAIK	1676	sp|Q9D172|GAL3A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2661.10	39.26575	3	2741.332571	2741.329674	K	A	187	213
PSM	ENPTTFMGHYLHEVAR	1677	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2830.4	44.00072	4	1900.880494	1900.889017	K	R	153	169
PSM	LACGVIGIAQ	1678	sp|P08228|SODC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	3-UNIMOD:4	ms_run[1]:scan=1.1.2954.3	47.48627	2	1000.527647	1000.537552	R	-	145	155
PSM	MIAEAIPELK	1679	sp|P08249|MDHM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2845.9	44.42697	2	1113.600647	1113.610382	K	A	315	325
PSM	AAFQLGSPWR	1680	sp|P47738|ALDH2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2967.8	47.85913	2	1131.574847	1131.582528	R	R	87	97
PSM	DAVSVFYVSR	1681	sp|O35488|S27A2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2941.5	47.13565	2	1141.569647	1141.576774	K	T	175	185
PSM	AFIVLNPDYK	1682	sp|Q3UNX5|ACSM3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2945.6	47.24508	2	1178.625847	1178.633560	K	S	516	526
PSM	VLVGANFEEVAFDEKK	1683	sp|P09103|PDIA1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2946.7	47.27195	3	1793.913071	1793.919966	K	N	373	389
PSM	AITGIQAFTVGK	1684	sp|Q60759|GCDH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2868.8	45.08352	2	1204.671847	1204.681573	R	-	427	439
PSM	IAEFAFEYAR	1685	sp|Q9D6R2|IDH3A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2987.5	48.40892	2	1215.586047	1215.592424	R	N	179	189
PSM	TGQSYLAAGLLK	1686	sp|Q99MZ7|PECR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2823.13	43.80835	2	1220.668247	1220.676488	K	N	6	18
PSM	LSGFGQSGIFSK	1687	sp|O09174|AMACR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2816.15	43.60954	2	1226.623447	1226.629538	R	V	106	118
PSM	SMALAWASSGVR	1688	sp|Q99MZ7|PECR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2830.12	44.0074	2	1234.605047	1234.612842	K	I	184	196
PSM	NIEDVIAQGVGK	1689	tr|A0A5F8MPY2|A0A5F8MPY2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2960.10	47.66118	2	1241.652047	1241.661566	K	L	50	62
PSM	FLASVSTVLTSK	1690	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2965.10	47.80367	2	1251.699847	1251.707454	K	Y	129	141
PSM	KWDTCAPEVILHAVGGK	1691	sp|Q9Z0S1|BPNT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	5-UNIMOD:4	ms_run[1]:scan=1.1.2977.9	48.13474	3	1879.955771	1879.961454	K	L	245	262
PSM	MAEDLILYGTK	1692	sp|Q91YI0|ARLY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2922.8	46.59998	2	1252.632647	1252.637325	R	E	256	267
PSM	TLAFASVDLTNK	1693	sp|Q9CQR4|ACO13_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2946.11	47.2753	2	1278.670647	1278.681967	K	T	112	124
PSM	PMFIVNTNVPR	1694	sp|P34884|MIF_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	22		ms_run[1]:scan=1.1.2877.14	45.34337	2	1286.6717	1286.6800	M	A	2	13
PSM	ENLLGEPGMGFK	1695	sp|Q07417|ACADS_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2944.11	47.22145	2	1290.625247	1290.627823	K	I	251	263
PSM	IMNTFSVVPSPK	1696	sp|P68372|TBB4B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2835.13	44.15125	2	1318.687447	1318.695509	R	V	163	175
PSM	FASENDLPEWK	1697	sp|P34022|RANG_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2798.18	43.10342	2	1334.605447	1334.614282	R	E	58	69
PSM	TLEDFDLGTTEK	1698	sp|Q8R4N0|CLYBL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2811.17	43.46768	2	1367.638247	1367.645641	K	C	91	103
PSM	TIIPLISQCTPK	1699	sp|P08249|MDHM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	9-UNIMOD:4	ms_run[1]:scan=1.1.2954.14	47.49543	2	1369.757847	1369.763923	K	V	204	216
PSM	LIIQWNGPESNR	1700	sp|Q62468|VILI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2902.14	46.04108	2	1425.730247	1425.736462	K	M	173	185
PSM	LTFSCLGGSDNFK	1701	sp|Q9R0Q7|TEBP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	5-UNIMOD:4	ms_run[1]:scan=1.1.2909.13	46.23815	2	1444.660647	1444.665666	K	H	36	49
PSM	PQQIDIAVPANMR	1702	sp|Q9DCM0|ETHE1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2827.17	43.92605	2	1451.746447	1451.755483	K	C	234	247
PSM	GYLGPEQLPDCLK	1703	sp|P08249|MDHM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	11-UNIMOD:4	ms_run[1]:scan=1.1.2981.15	48.25233	2	1488.723447	1488.728266	K	G	79	92
PSM	VNMVTASYITPAMK	1704	sp|Q99K67|AASS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2889.20	45.6819	2	1524.760447	1524.768022	R	E	571	585
PSM	EGHEVVGVFTIPDK	1705	sp|Q8R0Y6|AL1L1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2801.5	43.17792	3	1525.766771	1525.777659	K	D	22	36
PSM	FAIQDISVEETSAK	1706	sp|O88990|ACTN3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2921.20	46.58142	2	1536.761047	1536.767154	R	E	147	161
PSM	LGDVISIQPCPDVK	1707	sp|Q01853|TERA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	10-UNIMOD:4	ms_run[1]:scan=1.1.2899.19	45.96018	2	1539.789847	1539.796680	R	Y	96	110
PSM	EVGEVLCTDPLVSK	1708	sp|Q8BWF0|SSDH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	7-UNIMOD:4	ms_run[1]:scan=1.1.2928.17	46.77851	2	1544.767847	1544.775610	K	I	254	268
PSM	HNAWYAALALSPGSK	1709	sp|Q7TNG8|LDHD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2903.21	46.0754	2	1584.800047	1584.804876	R	A	348	363
PSM	GIKDPEGYFHFIGR	1710	sp|Q8K0L3|ACSM2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2839.2	44.25515	4	1634.807294	1634.820526	R	S	449	463
PSM	CSPDPGLTALLSDHR	1711	sp|Q91X72|HEMO_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	1-UNIMOD:4	ms_run[1]:scan=1.1.2902.6	46.0344	3	1637.778371	1637.783155	R	G	255	270
PSM	STGGAPTFNVTVTMTAK	1712	sp|P62962|PROF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2884.21	45.54285	2	1681.829247	1681.834522	K	T	92	109
PSM	YAEIYGISSAHTLLR	1713	sp|Q99K67|AASS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2876.5	45.30807	3	1692.876371	1692.883521	K	G	708	723
PSM	NILGGTVFREPIICK	1714	sp|P54071|IDHP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	14-UNIMOD:4	ms_run[1]:scan=1.1.2975.5	48.07632	3	1715.931371	1715.939262	R	N	141	156
PSM	AETFTFHSDICTLPEK	1715	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	11-UNIMOD:4	ms_run[1]:scan=1.1.2799.21	43.13425	2	1894.873847	1894.877115	K	E	528	544
PSM	NTGTEAPDYLATVDVDPK	1716	sp|P17563|SBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2964.21	47.78438	2	1904.896247	1904.900353	R	S	35	53
PSM	LHIIEVGTPPTGNQPFPK	1717	sp|Q68FD5|CLH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2847.15	44.48823	3	1944.038771	1944.046898	K	K	228	246
PSM	QSLIYHVASQQIQTLEK	1718	sp|Q9DCY0|KEG1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2914.13	46.37775	3	1985.046971	1985.058191	R	L	239	256
PSM	AIVICGANDNFCAGADIHGFK	1719	sp|Q9DBM2|ECHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	5-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.2955.17	47.5257	3	2249.030471	2249.035758	R	S	47	68
PSM	RLVGQGATAVLLDVPDSEGEAQAK	1720	tr|A2AFQ2|A2AFQ2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2916.17	46.43675	3	2423.268671	2423.265617	K	K	29	53
PSM	GNDISSGTVLSDYVGSGPPSGTGLHR	1721	sp|P70296|PEBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2955.19	47.52737	3	2529.204071	2529.209559	K	Y	94	120
PSM	AFQFVETHGEVCPANWTPESPTIKPSPTASK	1722	sp|P20108|PRDX3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	12-UNIMOD:4	ms_run[1]:scan=1.1.2992.20	48.55298	4	3412.646094	3412.639792	K	E	219	250
PSM	LPFPIIDDK	1723	sp|O08709|PRDX6_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3118.2	52.06558	2	1056.577047	1056.585548	K	G	98	107
PSM	IHPEPGTWEEFLEK	1724	sp|Q3UZZ6|ST1D1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3046.8	50.04405	3	1710.818171	1710.825337	K	F	148	162
PSM	SGEYPFPLIK	1725	sp|P45952|ACADM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3079.6	50.97812	2	1149.599047	1149.607011	K	R	70	80
PSM	VANVSLLALYK	1726	sp|P62267|RS23_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3106.5	51.73598	2	1189.697047	1189.707060	K	G	125	136
PSM	TFESLVDFCK	1727	sp|Q61425|HCDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	9-UNIMOD:4	ms_run[1]:scan=1.1.3106.8	51.73848	2	1244.566447	1244.574725	K	T	193	203
PSM	TFESLVDFCK	1728	sp|Q61425|HCDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	9-UNIMOD:4	ms_run[1]:scan=1.1.3099.6	51.54305	2	1244.566447	1244.574725	K	T	193	203
PSM	FEELNADLFR	1729	sp|P17156|HSP72_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3132.8	52.4677	2	1252.599247	1252.608802	R	G	305	315
PSM	FEELNADLFR	1730	sp|P17156|HSP72_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3138.6	52.6377	2	1252.599247	1252.608802	R	G	305	315
PSM	HSMNPFCEIAVEEAVR	1731	sp|Q9DCW4|ETFB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	7-UNIMOD:4	ms_run[1]:scan=1.1.3016.5	49.20778	3	1887.852071	1887.860753	K	L	36	52
PSM	SGAMSQALNFIK	1732	sp|Q62468|VILI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3005.13	48.91283	2	1265.636247	1265.643808	R	A	309	321
PSM	KEPGAYDWSSIVQHACELEGDR	1733	sp|P40936|INMT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	16-UNIMOD:4	ms_run[1]:scan=1.1.3194.9	54.20947	4	2546.148894	2546.149602	K	S	101	123
PSM	WSPSPLIEDLK	1734	tr|D3Z7X0|D3Z7X0_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3189.7	54.06673	2	1283.666847	1283.676154	R	E	186	197
PSM	LLSPGSVMLVSAR	1735	sp|Q64105|SPRE_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3058.17	50.38625	2	1328.737247	1328.748607	R	S	31	44
PSM	YQIPALAQAGFR	1736	sp|P34914|HYES_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3113.13	51.93488	2	1333.702847	1333.714270	R	V	274	286
PSM	DLGTDSQIFISR	1737	sp|Q61598|GDIB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3037.14	49.7905	2	1350.669447	1350.677945	K	A	391	403
PSM	DQSPASHEIATNLGDFALR	1738	sp|Q00897|A1AT4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3110.12	51.85203	3	2040.992771	2040.986482	K	L	36	55
PSM	ALGMTPAAFSALPR	1739	sp|Q62468|VILI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3174.13	53.65765	2	1401.736047	1401.743856	R	W	801	815
PSM	FASEITPITISVK	1740	sp|Q8QZT1|THIL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3091.15	51.32977	2	1404.779447	1404.786432	K	G	228	241
PSM	DDGSWEVIEGYR	1741	sp|P26443|DHE3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3164.12	53.37875	2	1424.615247	1424.620824	R	A	125	137
PSM	SSFFVNGLTLGGQK	1742	sp|P62962|PROF1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3174.15	53.65932	2	1453.748847	1453.756529	R	C	57	71
PSM	GVVDSEDIPLNLSR	1743	sp|Q9CQN1|TRAP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3039.18	49.85128	2	1512.773447	1512.778387	R	E	391	405
PSM	DILDIVPTEIHQK	1744	sp|Q9QXD6|F16P1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3109.2	51.81618	3	1519.815971	1519.824609	K	A	302	315
PSM	FANILTEACSLQR	1745	sp|Q3UNX5|ACSM3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	9-UNIMOD:4	ms_run[1]:scan=1.1.3096.14	51.46717	2	1521.757447	1521.760963	K	G	101	114
PSM	DVGGIVLANACGPCIGQWDRK	1746	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	11-UNIMOD:4,14-UNIMOD:4	ms_run[1]:scan=1.1.3191.18	54.13158	3	2285.105171	2285.104506	R	D	438	459
PSM	VQIAVANAQELLQR	1747	sp|P62075|TIM13_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3050.16	50.16462	2	1551.864447	1551.873290	K	M	28	42
PSM	SVIGMGTGAGAYILTR	1748	sp|Q62433|NDRG1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3130.16	52.41812	2	1565.811247	1565.823563	K	F	133	149
PSM	TPILLGSLAHQIYR	1749	sp|Q99L13|3HIDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3073.15	50.81465	2	1580.892847	1580.903862	K	M	297	311
PSM	SAPDFTATAVVDGAFK	1750	sp|Q61171|PRDX2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3196.17	54.27377	2	1595.778647	1595.783138	K	E	11	27
PSM	VDGLLTCCSVFINK	1751	sp|Q9CWS0|DDAH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	7-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.3133.17	52.50353	2	1624.787247	1624.795300	K	K	268	282
PSM	GFGFVCFSSPEEATK	1752	tr|A2A5N3|A2A5N3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	6-UNIMOD:4	ms_run[1]:scan=1.1.3180.18	53.82865	2	1661.733647	1661.739559	K	A	334	349
PSM	IINEPTAAAIAYGLDR	1753	sp|P17879|HS71B_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3158.19	53.22107	2	1686.894447	1686.894085	R	T	172	188
PSM	VDIDVPDVNIEGPDAK	1754	tr|E9Q616|E9Q616_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3127.16	52.33313	2	1694.824447	1694.836296	K	L	1287	1303
PSM	RSIQFVDWCPTGFK	1755	sp|P05213|TBA1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	9-UNIMOD:4	ms_run[1]:scan=1.1.3044.9	49.98743	3	1739.836571	1739.845361	K	V	339	353
PSM	TFPTVNPSTGEVICQVAEGNKEDVDK	1756	sp|P47738|ALDH2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	14-UNIMOD:4	ms_run[1]:scan=1.1.3020.16	49.32537	3	2833.335971	2833.344004	K	A	55	81
PSM	CQPPDAVVWPQNVDQVSR	1757	sp|Q7TNG8|LDHD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	1-UNIMOD:4	ms_run[1]:scan=1.1.3008.8	48.99177	3	2093.988671	2093.995273	R	V	63	81
PSM	EGAAHAFAQYNLDQFTPVK	1758	sp|P47754|CAZA2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3024.13	49.42658	3	2106.009371	2106.017054	R	I	48	67
PSM	AFVVLAPEFLSHDRDQLTK	1759	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3109.16	51.82787	3	2185.150571	2185.153154	K	V	508	527
PSM	FFPLEAWQIGK	1760	sp|O35215|DOPD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3553.5	64.27842	2	1334.698047	1334.702309	R	K	100	111
PSM	GIDYEIVPINLIK	1761	sp|Q9WVL0|MAAI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3602.11	65.65605	2	1485.840247	1485.844282	K	D	28	41
PSM	VVGVPVALDLITSGR	1762	sp|Q9DBM2|ECHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3567.5	64.67482	2	1494.874047	1494.876979	R	H	140	155
PSM	TLNDELEIIEGMK	1763	sp|P63038|CH60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3449.16	61.34262	2	1503.742447	1503.749061	K	F	206	219
PSM	DAVLNAWAEDVDLR	1764	sp|P52480|KPYM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3494.16	62.60942	2	1585.770247	1585.773636	K	V	476	490
PSM	SLNSEMDNILANLR	1765	sp|Q8BMS1|ECHA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3609.12	65.8578	2	1588.783247	1588.787906	K	L	647	661
PSM	SVLDAAQIVGLNCLR	1766	sp|Q61699|HS105_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	13-UNIMOD:4	ms_run[1]:scan=1.1.3476.17	62.09293	2	1627.860247	1627.871576	R	L	155	170
PSM	GGLPSQAFEYILYNK	1767	sp|P49935|CATH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3516.17	63.22423	2	1698.854647	1698.861723	K	G	181	196
PSM	ENTLNQLVGAAFGAAGQR	1768	sp|Q9EQ20|MMSA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3555.4	64.33505	3	1815.919871	1815.922760	K	C	299	317
PSM	ALEDVCIETIEAGFMTK	1769	sp|O88844|IDHC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	6-UNIMOD:4	ms_run[1]:scan=1.1.3645.21	66.90504	2	1925.902047	1925.911452	K	D	358	375
PSM	FLDGNELTLADCNLLPK	1770	sp|Q9Z1Q5|CLIC1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	12-UNIMOD:4	ms_run[1]:scan=1.1.3557.21	64.40701	2	1931.961847	1931.966264	K	L	167	184
PSM	SLPADILYEDQQCLVFR	1771	sp|Q9D0S9|HINT2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	13-UNIMOD:4	ms_run[1]:scan=1.1.3601.8	65.62479	3	2066.011271	2066.014277	R	D	63	80
PSM	HLYTLDGGDIINALCFSPNR	1772	sp|P68040|RACK1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	15-UNIMOD:4	ms_run[1]:scan=1.1.3533.10	63.70817	3	2275.099271	2275.105552	K	Y	226	246
PSM	KPLVIIAEDVDGEALSTLVLNR	1773	sp|P63038|CH60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3630.14	66.46841	3	2364.321071	2364.326427	R	L	269	291
PSM	VNPSRLPVVIGGLLDVDCSEDVIK	1774	sp|Q68FD5|CLH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	18-UNIMOD:4	ms_run[1]:scan=1.1.3595.18	65.46143	3	2593.377971	2593.378539	K	N	807	831
PSM	VAPEEVSEVIFGHVLTAGCGQNPTR	1775	tr|Q80X81|Q80X81_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	19-UNIMOD:4	ms_run[1]:scan=1.1.3479.17	62.17918	3	2666.310671	2666.312250	K	Q	47	72
PSM	FLASVSTVLTSK	1776	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.6122.2	89.93993	2	1251.695447	1251.707454	K	Y	129	141
PSM	GLLDFLQGLA	1777	sp|Q8VCR7|ABHEB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.4073.2	77.14305	2	1045.573647	1045.580797	K	-	201	211
PSM	LGGSLIVAFEGSPV	1778	sp|Q9R0P5|DEST_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3779.7	70.6699	2	1344.722447	1344.728917	K	-	152	166
PSM	DVNFEFPEFQL	1779	sp|P62082|RS7_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3950.2	75.18197	2	1383.630647	1383.634683	K	-	184	195
PSM	FFPEDVSEELIQEITQR	1780	sp|P26043|RADI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3860.4	72.92643	3	2079.009371	2079.016051	K	L	84	101
PSM	IQWAEELIAAFK	1781	sp|Q8R4N0|CLYBL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3787.2	70.8849	2	1417.751647	1417.760552	K	E	289	301
PSM	EGIPALDNFLDKL	1782	sp|P58252|EF2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3814.9	71.63748	2	1443.757247	1443.760946	K	-	846	859
PSM	LAGVTALSCWLPLR	1783	sp|P97823|LYPA1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	9-UNIMOD:4	ms_run[1]:scan=1.1.3726.4	69.16106	2	1555.850247	1555.854469	K	A	136	150
PSM	FVSILMESIPLPDR	1784	sp|P23492|PNPH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3705.10	68.58514	2	1615.858247	1615.864365	R	G	274	288
PSM	IPEWWLANVACLR	1785	sp|Q3UNX5|ACSM3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	11-UNIMOD:4	ms_run[1]:scan=1.1.3708.9	68.67007	2	1626.824047	1626.834068	K	T	124	137
PSM	KGTVLLADNVIVPGTPDFLAYVR	1786	sp|O88587|COMT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3707.10	68.64072	3	2457.357971	2457.363147	R	G	205	228
PSM	NNLFCWEIPVQITS	1787	sp|Q9Z0J0|NPC2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	5-UNIMOD:4	ms_run[1]:scan=1.1.3872.8	73.26168	2	1719.827647	1719.829043	K	-	136	150
PSM	VAEQTPLTALYVANLIK	1788	sp|P47738|ALDH2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3702.16	68.50668	2	1843.043847	1843.045501	K	E	212	229
PSM	DMANPTALLLSAVMMLR	1789	sp|Q9D6R2|IDH3A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.4102.2	77.48535	3	1845.954671	1845.951482	K	H	300	317
PSM	ATDLLLDDSLVSLFGNR	1790	sp|P99029|PRDX5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3836.12	72.25322	2	1847.963047	1847.962893	K	R	156	173
PSM	GQETSTNPIASIFAWSR	1791	sp|O88844|IDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3716.3	68.88766	3	1863.904571	1863.911526	K	G	322	339
PSM	NPTLFIFAENDTVIPLEQVSTLTQK	1792	sp|Q8R1G2|CMBL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3830.13	72.08908	3	2817.472871	2817.480027	K	L	169	194
PSM	GSVTYIAPPGNYDASDVVLELEFEGVK	1793	sp|P50516|VATA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3783.16	70.79195	3	2868.405371	2868.406922	R	E	174	201
PSM	EEIFGPVLTVYVYPDDK	1794	sp|Q8CHT0|AL4A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3706.21	68.62128	2	1982.985447	1982.987711	K	Y	445	462
PSM	ATDLLLDDSLVSLFGNRR	1795	sp|P99029|PRDX5_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3694.5	68.27492	3	2004.067571	2004.064004	K	L	156	174
PSM	FYPEDVAEELIQDITQK	1796	sp|P26040|EZRI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3891.3	73.77472	3	2036.996171	2036.994253	K	L	84	101
PSM	DLTAVSNNAGVDNFGLGLLLR	1797	sp|Q9D0K2|SCOT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3845.5	72.50269	3	2158.140971	2158.138232	K	S	84	105
PSM	IETELRDICNDVLSLLEK	1798	sp|P63101|1433Z_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	9-UNIMOD:4	ms_run[1]:scan=1.1.3800.10	71.25338	3	2159.113871	2159.114385	K	F	86	104
PSM	AVAEVEEMCNILSMEGVTVR	1799	sp|Q9D964|GATM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	9-UNIMOD:4	ms_run[1]:scan=1.1.3696.6	68.33064	3	2236.047071	2236.053776	K	R	123	143
PSM	SGTTWVSEILDLIYNNGDAEK	1800	sp|Q3UZZ6|ST1D1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3940.4	75.07146	3	2324.118071	2324.117222	K	C	49	70
PSM	TLTAVHDAILEDLVFPSEIVGK	1801	sp|P62082|RS7_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3751.12	69.86777	3	2366.270471	2366.273329	R	R	121	143
PSM	AMSVEQLTDVLINEILHGADGTSIK	1802	sp|Q60866|PTER_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3912.5	74.3609	3	2653.374071	2653.363283	R	C	139	164
PSM	VFQSNANYAENFIQSIVSTVEPALR	1803	sp|Q9D0F9|PGM1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3931.6	74.84132	3	2796.403271	2796.408259	K	Q	28	53
PSM	VLGAHILGPGAGEMVNEAALALEYGASCEDIAR	1804	sp|O08749|DLDH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	28-UNIMOD:4	ms_run[1]:scan=1.1.3758.11	70.06812	4	3353.650494	3353.638412	R	V	450	483
PSM	LLYNNVSNFGR	1805	sp|Q68FD5|CLH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2711.14	40.6603	2	1295.654447	1295.662235	K	L	1216	1227
PSM	QEPERNECFLQHK	1806	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:28,8-UNIMOD:4	ms_run[1]:scan=1.1.2191.19	26.26578	3	1696.7563	1696.7622	K	D	118	131
PSM	QNPDIPQLEPSDYLR	1807	sp|Q9DBM2|ECHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:28	ms_run[1]:scan=1.1.3596.18	65.49039	2	1766.8529	1766.8470	R	R	680	695
PSM	FADGDVDAVLSR	1808	sp|Q8R0Y6|AL1L1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2829.14	43.98058	2	1263.619247	1263.609531	R	A	815	827
PSM	QTANVLSGACGLHR	1809	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:28,10-UNIMOD:4	ms_run[1]:scan=1.1.2663.17	39.3166	2	1465.7032	1465.7091	K	G	92	106
PSM	QEDFELLCPDGTR	1810	sp|Q921I1|TRFE_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	8-UNIMOD:4	ms_run[1]:scan=1.1.2973.13	48.03188	2	1578.689447	1578.698422	K	K	576	589
PSM	APNSPDVLEIEFK	1811	sp|P16460|ASSY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3126.12	52.30118	2	1457.733847	1457.740210	K	K	216	229
PSM	FPGQLNADLR	1812	sp|A2AQ07|TBB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2654.9	39.06713	2	1129.577447	1129.588007	R	K	242	252
PSM	YSGLQPHVVVLVATVR	1813	sp|Q922D8|C1TC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2930.11	46.83087	3	1736.990171	1736.993740	R	A	687	703
PSM	ADMGGAATICSAIVSAAK	1814	sp|Q9CPY7|AMPL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	10-UNIMOD:4	ms_run[1]:scan=1.1.3133.18	52.50437	2	1693.812247	1692.817492	R	L	304	322
PSM	RSELLESLNK	1815	sp|Q61838|PZP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2217.20	26.98097	2	1187.642247	1187.651001	K	D	1175	1185
PSM	IVAATLSDPELFK	1816	sp|P05201|AATC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3091.14	51.32893	2	1404.779447	1402.770782	R	E	306	319
PSM	QIYPPINVLPSLSR	1817	sp|P62814|VATB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:28	ms_run[1]:scan=1.1.3850.6	72.65269	2	1578.8758	1578.8765	R	L	387	401
PSM	AADISQWAGPLCLQEVDEPPQHALR	1818	sp|P70296|PEBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1,12-UNIMOD:4	ms_run[1]:scan=1.1.3718.19	68.95718	3	2842.3735	2842.3703	M	V	2	27
PSM	QEGQNYGFFLR	1819	sp|Q9JIL4|NHRF3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:28	ms_run[1]:scan=1.1.3492.6	62.54298	2	1340.6071	1340.6144	K	I	15	26
PSM	QQLNIHGLLPPCIISQELQVLR	1820	sp|P06801|MAOX_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:28,12-UNIMOD:4	ms_run[1]:scan=1.1.3834.7	72.19643	3	2551.3933	2551.3939	R	I	36	58
PSM	CIGAIAMTEPGAGSDLQGVR	1821	sp|P51174|ACADL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.3700.18	68.4526	2	1984.9343	1984.9341	K	T	166	186
PSM	ASSHTVLMR	1822	sp|Q9Z0S1|BPNT1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1	ms_run[1]:scan=1.1.2176.17	25.84197	2	1042.5131	1042.5224	M	L	2	11
PSM	VSFELFADK	1823	sp|P17742|PPIA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3071.3	50.74828	2	1054.531447	1054.533512	R	V	20	29
PSM	GLQVHVVVDACSSR	1824	sp|P85094|ISC2A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	11-UNIMOD:4	ms_run[1]:scan=1.1.2365.12	31.04995	3	1525.754771	1525.767111	R	S	126	140
PSM	QIGVEHVVVYVNK	1825	sp|Q8BFR5|EFTU_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:28	ms_run[1]:scan=1.1.2964.18	47.78188	2	1466.7872	1465.7922	K	A	170	183
PSM	AAADGDDSLYPIAVLIDELR	1826	sp|Q76MZ3|2AAA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1	ms_run[1]:scan=1.1.4243.2	78.6233	3	2158.0793	2158.0789	M	N	2	22
PSM	AGFVLDEGLANPTDAFTVFYSER	1827	tr|A0A087WPX1|A0A087WPX1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3820.12	71.80883	3	2518.206671	2518.201620	R	S	169	192
PSM	IQIWDTAGQER	1828	sp|Q8K386|RAB15_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2692.18	40.12208	2	1315.643447	1315.652064	R	Y	59	70
PSM	ADRDATLWASHEK	1829	sp|P50431|GLYC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1	ms_run[1]:scan=1.1.2340.11	30.37152	3	1540.7210	1540.7265	M	M	2	15
PSM	LHTQDQFSPFSFSSGR	1830	sp|Q99MR8|MCCA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2853.8	44.65323	3	1839.846671	1839.854011	K	R	524	540
PSM	GFGHIGIAVPDVYSACK	1831	sp|Q9CPU0|LGUL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	16-UNIMOD:4	ms_run[1]:scan=1.1.2998.9	48.71133	3	1789.876571	1789.882141	R	R	124	141
PSM	GYSFSLTTFSPSGK	1832	sp|P49722|PSA2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3169.11	53.5158	2	1477.698847	1477.708910	R	L	5	19
PSM	AVDPDSPAEASGLR	1833	sp|P70441|NHRF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2298.20	29.21233	2	1383.659847	1383.663023	R	A	176	190
PSM	AAFVTLLTGAK	1834	tr|G5E895|G5E895_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1	ms_run[1]:scan=1.1.3920.2	74.56118	2	1132.6407	1132.6487	M	M	2	13
PSM	MELITILEK	1835	sp|P70168|IMB1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1	ms_run[1]:scan=1.1.3937.2	74.99908	2	1130.6171	1130.6252	-	T	1	10
PSM	CIESLIAVFQK	1836	sp|P50543|S10AB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.3977.3	75.82385	2	1289.6621	1289.6684	R	Y	8	19
PSM	AADLGQIPDVDIDSDGVFK	1837	sp|Q9DAK9|PHP14_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1	ms_run[1]:scan=1.1.3816.5	71.6893	3	2015.9698	2015.9682	M	Y	2	21
PSM	QFLLTNLVEVGGR	1838	sp|Q8K4F5|ABHDB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:28	ms_run[1]:scan=1.1.3897.7	73.93352	2	1427.7689	1427.7767	R	F	209	222
PSM	ADNPVLELLLR	1839	sp|Q8C0C7|SYFA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1	ms_run[1]:scan=1.1.3988.2	76.0114	2	1293.7192	1293.7292	M	R	2	13
PSM	QIQTEAAQLLTGL	1840	sp|Q9DCV4|RMD1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:28	ms_run[1]:scan=1.1.4201.2	78.3259	2	1367.7219	1367.7291	K	-	293	306
PSM	AASGSALLWPR	1841	sp|Q9DB29|IAH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2767.10	42.22104	2	1128.604047	1127.608743	R	V	7	18
PSM	SLADELALVDVLEDK	1842	sp|P16125|LDHB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3800.15	71.25757	2	1628.849847	1628.850883	K	L	44	59
PSM	HHPEDVEPALRK	1843	sp|Q9JII6|AK1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.1754.6	14.0786	4	1426.724094	1426.731711	K	T	86	98
PSM	FHHSLTDHTR	1844	sp|Q99LB7|SARDH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.1649.8	11.17463	3	1249.587071	1249.595218	R	W	446	456
PSM	KYAEAVGR	1845	sp|P09411|PGK1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.1671.17	11.79007	2	892.467847	892.476666	K	A	323	331
PSM	EHAALEPR	1846	sp|Q99KI0|ACON_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.1693.15	12.40623	2	921.458447	921.466829	R	H	672	680
PSM	FHVEEEGK	1847	sp|P09041|PGK2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.1762.17	14.31307	2	973.440847	973.450511	R	G	124	132
PSM	KYEATLEK	1848	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.1737.18	13.61743	2	980.508447	980.517862	K	C	376	384
PSM	TPVSEHVTK	1849	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.1663.19	11.5722	2	996.515847	996.524010	K	C	491	500
PSM	CSYDEHAK	1850	sp|P07724|ALBU_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	1-UNIMOD:4	ms_run[1]:scan=1.1.1577.18	9.188833	2	1008.387247	1008.397095	K	L	58	66
PSM	HQGVMVGMGQK	1851	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	8-UNIMOD:35	ms_run[1]:scan=1.1.1693.21	12.41125	2	1186.550247	1186.558698	R	D	40	51
PSM	TAEEEDEADPK	1852	sp|Q9D0J8|PTMS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.1689.21	12.29817	2	1232.492847	1232.504456	R	R	81	92
PSM	VVAGVAAALAHK	1853	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2245.3	27.73483	3	1105.649771	1105.660778	K	Y	134	146
PSM	TPVEPEVAIHR	1854	sp|P60867|RS20_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2181.8	25.97253	3	1246.655771	1246.666986	K	I	9	20
PSM	LSDGVAVLK	1855	sp|P63038|CH60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2322.10	29.8716	2	900.521847	900.528033	K	V	397	406
PSM	SCNCLLLK	1856	sp|P17182|ENOA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	2-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=1.1.2287.7	28.896	2	1006.485647	1006.493973	K	V	336	344
PSM	SCNCLLLK	1857	sp|P17182|ENOA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	2-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=1.1.2294.12	29.09215	2	1006.485647	1006.493973	K	V	336	344
PSM	IGGHGAEYGAEALER	1858	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2222.14	27.1149	3	1528.718771	1528.727020	K	M	18	33
PSM	QRDYETATLSDIK	1859	sp|P57780|ACTN4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2317.17	29.73732	3	1538.748671	1538.757651	K	A	439	452
PSM	APIQWEER	1860	sp|Q9D6R2|IDH3A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2321.15	29.8477	2	1027.502247	1027.508694	K	N	59	67
PSM	ALTSELANAR	1861	sp|P26041|MOES_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2233.12	27.41748	2	1044.546447	1044.556373	K	D	524	534
PSM	TYVGVVDGEK	1862	sp|Q62468|VILI_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2172.14	25.72763	2	1065.526047	1065.534240	R	E	206	216
PSM	HLMESPANEMTPTR	1863	sp|Q9CPY7|AMPL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2228.13	27.2812	3	1612.718171	1612.733762	R	F	201	215
PSM	VVAGVAAALAHK	1864	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2238.4	27.54227	3	1105.649771	1105.660778	K	Y	134	146
PSM	SLSQNYGVLK	1865	sp|Q61171|PRDX2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2356.8	30.80245	2	1107.582047	1107.592424	K	N	110	120
PSM	LIEPNTAVTR	1866	sp|Q9DCU9|HOGA1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2232.16	27.38972	2	1112.608047	1112.618973	R	R	266	276
PSM	VEDDTLQGLK	1867	sp|P50544|ACADV_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2319.15	29.79185	2	1116.556647	1116.566269	K	E	129	139
PSM	YNDEPVQIR	1868	sp|Q62468|VILI_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2237.17	27.52578	2	1132.543647	1132.551287	K	V	470	479
PSM	QHGIPIPVTPK	1869	sp|P16460|ASSY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2308.5	29.47693	3	1185.676271	1185.686993	K	S	166	177
PSM	GLETTATYDPK	1870	sp|Q9R0H0|ACOX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2184.20	26.06763	2	1194.568247	1194.576833	R	T	149	160
PSM	HIYFITGETK	1871	sp|P07901|HS90A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2341.12	30.39602	2	1207.615647	1207.623724	K	D	491	501
PSM	CSEGPGLCLAR	1872	sp|Q8VDK1|NIT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	1-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.2355.14	30.7831	2	1218.547047	1218.548528	R	I	281	292
PSM	DRVTDALNATR	1873	sp|P63038|CH60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2303.21	29.35428	2	1230.623447	1230.631663	K	A	419	430
PSM	DQVANSAFVER	1874	sp|P07901|HS90A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2322.19	29.87912	2	1234.583647	1234.594215	K	L	501	512
PSM	IRYESLTDPSK	1875	sp|P07901|HS90A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2173.10	25.75288	3	1307.664071	1307.672131	K	L	59	70
PSM	GVQVETISPGDGR	1876	sp|P26883|FKB1A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	21		ms_run[1]:scan=1.1.2306.20	29.43505	2	1313.6477	1313.6570	M	T	2	15
PSM	GEGGILINSQGER	1877	sp|Q8K2B3|SDHA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2300.20	29.26927	2	1328.657847	1328.668442	R	F	313	326
PSM	NINNDTTYCIK	1878	sp|Q99KR3|LACB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	9-UNIMOD:4	ms_run[1]:scan=1.1.2228.16	27.28622	2	1354.609847	1354.618715	K	K	92	103
PSM	AQQIQALQSNVR	1879	sp|E9PV24|FIBA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2242.19	27.66463	2	1354.722847	1354.731711	K	A	150	162
PSM	EEAQAEIEQYR	1880	sp|Q9CR51|VATG1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2313.18	29.62588	2	1364.609647	1364.620824	K	L	38	49
PSM	DINAYNGETPTEK	1881	sp|O08709|PRDX6_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2229.19	27.3132	2	1450.652047	1450.657603	K	L	85	98
PSM	NANCSIEESFQR	1882	sp|P38060|HMGCL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	4-UNIMOD:4	ms_run[1]:scan=1.1.2344.21	30.48507	2	1453.617047	1453.625592	K	F	138	150
PSM	RVMVDANEVPIQK	1883	sp|Q9D964|GATM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2320.13	29.81812	3	1497.786071	1497.797348	K	M	369	382
PSM	IWHHTFYNELR	1884	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2330.13	30.09967	3	1514.734571	1514.741882	K	V	85	96
PSM	SALEHSVQCAVDVK	1885	sp|P24270|CATA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	9-UNIMOD:4	ms_run[1]:scan=1.1.2325.21	29.96515	2	1541.742847	1541.750792	R	R	417	431
PSM	IQALQQQADDAEDR	1886	sp|Q6IRU2|TPM4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2194.21	26.35165	2	1599.741647	1599.748878	K	A	14	28
PSM	VDFNVPMK	1887	sp|P09041|PGK2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2635.5	38.5275	2	948.465847	948.473889	R	N	23	31
PSM	IGLFGGAGVGK	1888	sp|P56480|ATPB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2723.4	40.99737	2	974.545447	974.554916	K	T	202	213
PSM	THLPGFVEQAGALK	1889	sp|P99029|PRDX5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2664.7	39.33562	3	1466.781671	1466.788164	K	A	99	113
PSM	AILNYIATK	1890	tr|E9Q6L7|E9Q6L7_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2643.4	38.75392	2	1005.578247	1005.585882	R	Y	70	79
PSM	LLAEPVPGIK	1891	sp|P61089|UBE2N_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2658.4	39.17495	2	1035.623847	1035.632832	R	A	15	25
PSM	MSDGLFLQK	1892	sp|Q9D6R2|IDH3A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2651.9	38.98368	2	1037.513847	1037.521567	R	C	206	215
PSM	NLHHEVELGVLLGK	1893	sp|Q8R0F8|FAHD1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2636.9	38.55937	3	1556.854871	1556.867477	R	R	70	84
PSM	LPEILVETK	1894	sp|Q7TNG8|LDHD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2776.9	42.47272	2	1040.602447	1040.611762	R	E	375	384
PSM	GIVVLNTSLK	1895	sp|Q91WR5|AK1CL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2724.3	41.02487	2	1042.628847	1042.638646	R	E	264	274
PSM	TPIAAGHPSMNLLLR	1896	sp|Q9D6R2|IDH3A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2780.6	42.58302	3	1589.862071	1589.871182	K	K	101	116
PSM	GAEILADTFK	1897	sp|Q9CWS0|DDAH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2743.9	41.55722	2	1063.544447	1063.554976	R	D	150	160
PSM	VQGQNLFFR	1898	tr|A0A087WP24|A0A087WP24_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2706.9	40.51347	2	1107.572647	1107.582528	K	E	13	22
PSM	AVITFNQGLR	1899	sp|Q99NB1|ACS2L_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2655.8	39.09408	2	1117.614647	1117.624393	K	G	208	218
PSM	FPGQLNADLR	1900	sp|A2AQ07|TBB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2648.13	38.90362	2	1129.579247	1129.588007	R	K	242	252
PSM	YEWDVAEAR	1901	sp|P58252|EF2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2636.15	38.56438	2	1137.499447	1137.509088	K	K	639	648
PSM	GDLGIEIPAEK	1902	sp|P52480|KPYM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2778.8	42.52782	2	1140.593647	1140.602654	R	V	295	306
PSM	IGQFQLMQGK	1903	sp|Q9JHI5|IVD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2637.9	38.58793	2	1148.595247	1148.601214	K	M	317	327
PSM	ISFTGSVPTGVK	1904	sp|Q9JLJ2|AL9A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2663.13	39.31327	2	1191.640847	1191.649939	K	I	228	240
PSM	QDAQSLLVPVK	1905	sp|Q99K67|AASS_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2692.13	40.1179	2	1196.668447	1196.676488	R	S	323	334
PSM	QITVNDLPVGR	1906	sp|Q61171|PRDX2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2697.9	40.25593	2	1210.657247	1210.666986	R	S	140	151
PSM	SDDIILSSGYR	1907	sp|Q3UNX5|ACSM3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2632.14	38.45	2	1224.592447	1224.598632	R	I	471	482
PSM	EGTLPAALVQPR	1908	sp|Q9CQ60|6PGL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2716.13	40.8039	2	1250.687447	1250.698286	K	T	220	232
PSM	GVTFNVTTVDTK	1909	sp|Q9Z1Q5|CLIC1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2629.14	38.36657	2	1280.652247	1280.661232	K	R	38	50
PSM	GLCAIAQAESLR	1910	sp|P62908|RS3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	3-UNIMOD:4	ms_run[1]:scan=1.1.2722.14	40.97713	2	1287.652647	1287.660521	R	Y	95	107
PSM	KAPDFVFYAPR	1911	sp|P26040|EZRI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2730.16	41.19898	2	1309.674247	1309.681908	K	L	263	274
PSM	HLGFQSAVEALR	1912	tr|A0A0J9YTU1|A0A0J9YTU1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2696.6	40.22495	3	1326.693071	1326.704434	K	G	198	210
PSM	TDTDAELDLVSR	1913	sp|Q922D8|C1TC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2699.16	40.31918	2	1333.627447	1333.636139	K	L	761	773
PSM	SGALNSNDAFVLK	1914	sp|P13020|GELS_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2708.17	40.57689	2	1334.675047	1334.683030	K	T	583	596
PSM	YALYDATYETK	1915	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2590.17	37.29332	2	1336.611647	1336.618698	R	E	82	93
PSM	MLLQQDLSSYK	1916	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	1-UNIMOD:35	ms_run[1]:scan=1.1.2614.15	37.95347	2	1340.652047	1340.664603	R	F	318	329
PSM	FHADFLLQHVK	1917	sp|Q8R164|BPHL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2599.6	37.53293	3	1353.707471	1353.719356	R	G	250	261
PSM	LVQMSICSSLAR	1918	sp|Q9Z0S1|BPNT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	7-UNIMOD:4	ms_run[1]:scan=1.1.2779.18	42.56452	2	1363.687647	1363.695192	R	K	53	65
PSM	TGQQAEPLVVDLK	1919	sp|P98078|DAB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2717.18	40.83681	2	1396.745247	1396.756195	K	D	151	164
PSM	IIAINVNDPEAEK	1920	sp|Q91VM9|IPYR2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2657.9	39.14977	2	1424.743647	1424.751109	K	F	199	212
PSM	MVNSNLASVEELK	1921	sp|P35486|ODPA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2703.19	40.43645	2	1432.714047	1432.723180	R	E	324	337
PSM	QFVTPADVVSGNPK	1922	sp|Q3V0K9|PLSI_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2717.19	40.83765	2	1457.740047	1457.751444	R	L	350	364
PSM	THLPGFVEQAGALK	1923	sp|P99029|PRDX5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2671.9	39.5322	3	1466.781671	1466.788164	K	A	99	113
PSM	QLICDPSYIPDR	1924	sp|P50396|GDIA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	4-UNIMOD:4	ms_run[1]:scan=1.1.2784.20	42.70907	2	1475.699047	1475.707865	K	V	279	291
PSM	ECYQTWAQLER	1925	sp|Q9D826|SOX_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	2-UNIMOD:4	ms_run[1]:scan=1.1.2763.17	42.11523	2	1482.646247	1482.656163	K	E	70	81
PSM	ASSTANLIFEDCR	1926	sp|Q07417|ACADS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	12-UNIMOD:4	ms_run[1]:scan=1.1.2722.20	40.98213	2	1482.668847	1482.677293	R	I	235	248
PSM	EVSFQATGDSEWR	1927	sp|O35658|C1QBP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2703.21	40.43813	2	1510.661047	1510.668836	K	D	204	217
PSM	LINSLYPEGQAPVK	1928	sp|Q9WVA4|TAGL2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2709.21	40.6086	2	1527.821647	1527.829694	K	K	65	79
PSM	DIANENEAQFQIR	1929	sp|O35643|AP1B1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2742.20	41.53838	2	1546.727647	1546.737585	K	D	849	862
PSM	FEPQINAEESEIR	1930	sp|Q64516|GLPK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2649.20	38.93748	2	1560.730847	1560.742001	R	Y	493	506
PSM	NTQIIIQEESGIPK	1931	sp|P16332|MUTA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2708.19	40.57855	2	1568.830847	1568.840987	R	V	405	419
PSM	EQWSNCPTIGQIR	1932	sp|P10605|CATB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	6-UNIMOD:4	ms_run[1]:scan=1.1.2697.20	40.26512	2	1587.737847	1587.746375	R	D	88	101
PSM	MISSYVGENAEFER	1933	sp|Q9D0K2|SCOT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2727.15	41.11993	2	1630.724047	1630.729722	R	Q	111	125
PSM	LSAEERDQLLPNLR	1934	sp|P61458|PHS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2674.12	39.62033	3	1652.877071	1652.884583	R	A	8	22
PSM	WIDIHNPATNEVVGR	1935	sp|Q9EQ20|MMSA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2768.10	42.249	3	1719.859871	1719.869268	K	V	56	71
PSM	VIVVGNPANTNCLTASK	1936	sp|P14152|MDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	12-UNIMOD:4	ms_run[1]:scan=1.1.2620.21	38.12095	2	1756.910247	1756.914169	K	S	126	143
PSM	SGAQATWTEVSWPHEK	1937	sp|Q91X72|HEMO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2712.14	40.6891	3	1812.830471	1812.843112	K	V	385	401
PSM	AYEAQTEPVLQYYQK	1938	sp|Q9WTP7|KAD3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2787.21	42.79588	2	1829.877847	1829.883580	K	K	175	190
PSM	LASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEK	1939	tr|A0A5F8MPY2|A0A5F8MPY2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2775.21	42.45492	3	2773.419671	2773.424637	K	K	62	95
PSM	PNIVLFSGSSHQDLSQR	1940	sp|Q9CS42|PRPS2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	21		ms_run[1]:scan=1.1.2664.16	39.34313	3	1883.9416	1883.9484	M	V	2	19
PSM	VAPEEHPVLLTEAPLNPK	1941	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2758.13	41.9715	3	1953.063971	1953.057128	R	A	96	114
PSM	VAPEEHPTLLTEAPLNPK	1942	sp|P62737|ACTA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2689.17	40.03831	3	1955.029571	1955.036393	R	A	98	116
PSM	RSEPEPQILDFQTQQYK	1943	sp|Q9R0H0|ACOX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2760.19	42.03303	3	2106.030971	2106.038184	K	L	314	331
PSM	AGDELTKIEDEDEQGWCK	1944	sp|Q9WVE8|PACN2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	17-UNIMOD:4	ms_run[1]:scan=1.1.2770.17	42.31108	3	2121.905171	2121.916079	K	G	449	467
PSM	QTIENSQGAYQEAFDISKK	1945	sp|P68254|1433T_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2628.19	38.34288	3	2156.036171	2156.038577	K	E	140	159
PSM	NHYQAEVFSVNFAESEEAKK	1946	sp|P07758|A1AT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2634.21	38.5124	3	2326.080971	2326.086590	K	V	154	174
PSM	LPEILVETKEEIK	1947	sp|Q7TNG8|LDHD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2819.9	43.69032	3	1539.864071	1539.875976	R	A	375	388
PSM	YPQLLSGIR	1948	sp|P50247|SAHH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2843.6	44.36887	2	1045.581847	1045.592030	K	G	143	152
PSM	ELLHLGCNVVIASR	1949	sp|Q99MZ7|PECR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	7-UNIMOD:4	ms_run[1]:scan=1.1.2834.7	44.11767	3	1579.841771	1579.850447	R	K	37	51
PSM	LGVGGAVLLER	1950	sp|Q99LB7|SARDH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2824.6	43.83107	2	1082.636647	1082.644794	K	E	89	100
PSM	ASSTLDNLFK	1951	sp|P97816|S100G_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2813.8	43.51743	2	1094.552847	1094.560789	K	E	46	56
PSM	VFAELSALCK	1952	sp|Q9DBM2|ECHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	9-UNIMOD:4	ms_run[1]:scan=1.1.2883.8	45.50426	2	1136.580847	1136.589981	K	P	387	397
PSM	QGLLGINIAEK	1953	sp|P51174|ACADL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2958.12	47.60593	2	1154.657247	1154.665923	K	H	96	107
PSM	VVPEMTEILK	1954	sp|Q99LC5|ETFA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2924.10	46.65865	2	1157.629847	1157.636597	K	K	322	332
PSM	LVLGDNSLAIR	1955	sp|P05201|AATC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2870.11	45.14352	2	1169.669447	1169.676822	R	E	87	98
PSM	GPLQSVQVFGR	1956	sp|P14131|RS16_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2820.9	43.71893	2	1186.640847	1186.645856	K	K	5	16
PSM	LAEYTDLMLK	1957	sp|P12658|CALB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2956.9	47.54698	2	1195.608847	1195.615862	K	L	143	153
PSM	NETLGGTCLNVGCIPSK	1958	sp|O08749|DLDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	8-UNIMOD:4,13-UNIMOD:4	ms_run[1]:scan=1.1.2826.14	43.89507	3	1818.852371	1818.860419	K	A	73	90
PSM	IVPNILLEQGK	1959	sp|Q9CZU6|CISY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2888.6	45.64231	2	1222.719647	1222.728524	K	A	383	394
PSM	VAVLLLAGGQGTR	1960	sp|Q3TW96|UAP1L_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2858.15	44.80255	2	1253.735447	1253.745571	K	L	106	119
PSM	IAATILTSPDLR	1961	sp|P05202|AATM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2900.15	45.98507	2	1269.719447	1269.729252	R	K	326	338
PSM	ISEFEDVIGQR	1962	sp|Q61847|MEP1B_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2816.16	43.61037	2	1291.633247	1291.640831	R	M	229	240
PSM	VLETTVEIFNK	1963	sp|Q9EQH3|VPS35_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2906.15	46.15491	2	1291.691447	1291.702368	K	L	372	383
PSM	NNLAGAEELFAR	1964	sp|Q68FD5|CLH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2913.11	46.3483	2	1303.644447	1303.652064	R	K	355	367
PSM	TSIAIDTIINQK	1965	sp|Q03265|ATPA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2924.16	46.66367	2	1315.728447	1315.734731	K	R	219	231
PSM	TSIAIDTIINQK	1966	sp|Q03265|ATPA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2918.10	46.48735	2	1315.728447	1315.734731	K	R	219	231
PSM	IMNTFSVVPSPK	1967	sp|P68372|TBB4B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2848.16	44.51735	2	1318.687447	1318.695509	R	V	163	175
PSM	QGFGNLPICMAK	1968	sp|Q922D8|C1TC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	9-UNIMOD:4	ms_run[1]:scan=1.1.2988.9	48.43753	2	1334.636647	1334.647513	K	T	855	867
PSM	IAEEFEVELER	1969	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2958.18	47.61095	2	1362.657647	1362.666711	K	G	1044	1055
PSM	VIRPLDQPSSFDATPYIK	1970	sp|Q6ZQ38|CAND1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2926.14	46.719	3	2046.072971	2046.078592	K	D	549	567
PSM	IQDTIEITGTFK	1971	sp|O35488|S27A2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2878.15	45.37198	2	1364.709847	1364.718747	R	H	561	573
PSM	VVDLMAYMASKE	1972	tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	5-UNIMOD:35	ms_run[1]:scan=1.1.2872.18	45.20685	2	1371.633047	1371.641425	R	-	322	334
PSM	TIIPLISQCTPK	1973	sp|P08249|MDHM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	9-UNIMOD:4	ms_run[1]:scan=1.1.2966.15	47.83635	2	1369.757847	1369.763923	K	V	204	216
PSM	MLQTSSVLVSGLR	1974	sp|Q02053|UBA1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2918.14	46.49068	2	1389.754447	1389.764985	K	G	69	82
PSM	LIVAVEQEEIPR	1975	sp|Q91YP0|L2HDH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2834.17	44.126	2	1394.767047	1394.776930	K	L	138	150
PSM	GAVDAAVPTNIIAAK	1976	sp|Q8BVE3|VATH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2825.19	43.87058	2	1409.781447	1409.787829	R	A	8	23
PSM	VVIEDGVGDAVLTR	1977	sp|P01027|CO3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2865.17	45.00492	2	1441.768847	1441.777659	R	K	292	306
PSM	GLYAAFDCTATMK	1978	sp|Q05920|PYC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	8-UNIMOD:4	ms_run[1]:scan=1.1.2871.15	45.17563	2	1447.644047	1447.647573	R	S	843	856
PSM	GVVDSDDLPLNVSR	1979	sp|P08113|ENPL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2900.19	45.9884	2	1484.742647	1484.747087	K	E	435	449
PSM	GIMEEDSYPYIGK	1980	sp|P49935|CATH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2885.18	45.56816	2	1500.672247	1500.680647	K	D	196	209
PSM	LVSIGAEEIVDGNAK	1981	sp|P57780|ACTN4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2835.20	44.15708	2	1513.791247	1513.798788	K	M	127	142
PSM	VNMVTASYITPAMK	1982	sp|Q99K67|AASS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2895.16	45.84593	2	1524.760447	1524.768022	R	E	571	585
PSM	AENACVPPFTVEVK	1983	sp|Q9D964|GATM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	5-UNIMOD:4	ms_run[1]:scan=1.1.2892.17	45.76315	2	1559.760847	1559.765380	R	A	83	97
PSM	VIPLFSPQCGECR	1984	sp|P00329|ADH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	9-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.2906.20	46.15908	2	1561.735447	1561.738119	K	I	90	103
PSM	ITPSYVAFTPEGER	1985	sp|P20029|BIP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2833.21	44.10065	2	1565.762647	1565.772573	R	L	62	76
PSM	ILGADTSVDLEETGR	1986	sp|Q03265|ATPA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2803.21	43.24813	2	1574.772247	1574.778781	R	V	59	74
PSM	SLAPAFESFCQGNR	1987	sp|Q8BH86|GLUCM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	10-UNIMOD:4	ms_run[1]:scan=1.1.2905.19	46.1301	2	1582.714447	1582.719826	R	G	45	59
PSM	QVIHPNQIAVVQEQFTPTPEK	1988	sp|Q8R4N0|CLYBL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2851.20	44.60585	3	2402.249771	2402.259410	K	I	268	289
PSM	GAGIGGLGITVEGPSESK	1989	sp|Q80X90|FLNB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2927.20	46.75253	2	1627.831847	1627.841715	R	I	1355	1373
PSM	NFILDQTNVSAAAQR	1990	sp|Q8VEK3|HNRPU_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2846.21	44.4651	2	1646.853047	1646.837633	R	R	552	567
PSM	LVLEVAQHLGESTVR	1991	sp|P56480|ATPB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2828.20	43.95705	2	1649.902847	1649.910070	R	T	95	110
PSM	TSFDEMLPGTHFQR	1992	sp|Q60597|ODO1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2869.7	45.11145	3	1664.753471	1664.761691	R	V	870	884
PSM	FQIQDISVETEDNK	1993	sp|Q62261|SPTB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2916.19	46.43843	2	1664.785247	1664.789346	R	E	157	171
PSM	VYGTVFHINQGNPFK	1994	sp|Q9DCY0|KEG1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2860.10	44.85575	3	1719.866471	1719.873290	K	L	27	42
PSM	IQQEIAVQNPLVSER	1995	sp|Q7TQI3|OTUB1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2854.21	44.69285	2	1722.915847	1722.926448	R	L	37	52
PSM	VYGTVFHINQGNPFK	1996	sp|Q9DCY0|KEG1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2854.20	44.69202	2	1719.865047	1719.873290	K	L	27	42
PSM	YSNSDVIIYVGCGER	1997	sp|P50516|VATA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	12-UNIMOD:4	ms_run[1]:scan=1.1.2891.21	45.73845	2	1730.788047	1730.793385	K	G	266	281
PSM	EVFTEQADLSGITEAK	1998	tr|A0A0R4J0I1|A0A0R4J0I1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2959.19	47.64023	2	1736.835247	1736.846860	K	K	335	351
PSM	IFDLQDWSQEDERDK	1999	sp|Q9Z2I9|SUCB1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2999.11	48.7415	3	1922.856671	1922.864636	K	E	288	303
PSM	RPTEICADPQFIIGGATR	2000	sp|O08529|CAN2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	6-UNIMOD:4	ms_run[1]:scan=1.1.2862.16	44.9181	3	2001.005171	2001.010195	K	T	77	95
PSM	AFGYVCGGEGQHQFFAIK	2001	sp|P98078|DAB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	6-UNIMOD:4	ms_run[1]:scan=1.1.2930.16	46.83503	3	2014.929971	2014.935967	R	T	133	151
PSM	RGTGGVDTAATGSVFDISNLDR	2002	sp|P30275|KCRU_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2999.17	48.74652	3	2208.072971	2208.077088	K	L	354	376
PSM	VAGHPDVVINNAAGNFISPSER	2003	sp|Q9CQ62|DECR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2797.15	43.07277	3	2263.129271	2263.134544	K	L	134	156
PSM	VTNEPILAFSQGSPERDALQK	2004	sp|Q8CHT0|AL4A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2874.20	45.26498	3	2299.179671	2299.180825	K	A	31	52
PSM	LGFMSAFVK	2005	sp|Q9D2G2|ODO2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3138.3	52.63518	2	998.516447	998.525924	K	A	279	288
PSM	LLSHCLLVTLASHHPADFTPAVHASLDK	2006	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	5-UNIMOD:4	ms_run[1]:scan=1.1.3032.3	49.63867	6	3049.584741	3049.580761	K	F	101	129
PSM	VDFPQDQLATLTGR	2007	sp|P08249|MDHM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3207.3	54.57732	3	1559.786171	1559.794371	K	I	216	230
PSM	INEAFDLLR	2008	sp|P00329|ADH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3038.6	49.81247	2	1089.573647	1089.581859	K	S	356	365
PSM	SPAHGISLFLVENGMK	2009	sp|P51174|ACADL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3015.2	49.17593	3	1698.867071	1698.876327	R	G	225	241
PSM	GFAFVTFDDHDTVDK	2010	sp|Q8BG05|ROA3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3019.3	49.2851	3	1712.764871	1712.768216	R	I	168	183
PSM	YAFVNWINK	2011	sp|Q61233|PLSL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3085.11	51.1556	2	1153.584847	1153.592030	K	A	124	133
PSM	PHPLVTSTDIVLTITK	2012	sp|P28271|ACOC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3042.3	49.9249	3	1733.987771	1733.992737	K	H	251	267
PSM	EIRPALELLEPIEQK	2013	sp|Q61598|GDIB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3174.6	53.6518	3	1776.991271	1776.998551	K	F	365	380
PSM	DAGTIAGLNVLR	2014	sp|P63017|HSP7C_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3093.4	51.37638	2	1198.659847	1198.666986	K	I	160	172
PSM	LTPLDQQLFK	2015	sp|Q9DCY0|KEG1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3031.8	49.61473	2	1201.664647	1201.670674	K	F	159	169
PSM	YIVPMITVDGK	2016	sp|Q9JII6|AK1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3109.7	51.82035	2	1234.654847	1234.663146	R	R	298	309
PSM	YAVPDQILVVK	2017	sp|Q99NB1|ACS2L_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3016.3	49.20445	2	1243.705847	1243.717624	K	R	616	627
PSM	FLASVSTVLTSK	2018	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3002.11	48.8269	2	1251.696047	1251.707454	K	Y	129	141
PSM	MVLVLQQLEDK	2019	sp|Q61133|GSTT2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3153.11	53.07478	2	1314.712847	1314.721724	R	F	139	150
PSM	DPSGGPVSLDFVK	2020	sp|Q99LB7|SARDH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3084.13	51.12855	2	1316.653447	1316.661232	R	N	873	886
PSM	LAGQIFLGGSIVR	2021	sp|P17563|SBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3138.10	52.64103	2	1329.768447	1329.776871	R	G	345	358
PSM	LQYAVISEAWR	2022	sp|Q99KP3|CRYL1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3062.13	50.49767	2	1334.693247	1334.698286	R	L	198	209
PSM	IFNNGADLSGITEENAPLK	2023	sp|P07758|A1AT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3078.13	50.95513	3	2001.982271	2002.000735	R	L	329	348
PSM	FTASAGIQVVGDDLTVTNPK	2024	sp|P17182|ENOA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3170.7	53.54018	3	2032.042871	2032.047686	K	R	307	327
PSM	AEMQQILQGLDK	2025	sp|Q91YI0|ARLY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3066.16	50.61583	2	1372.693847	1372.702051	K	V	58	70
PSM	AEMQQILQGLDK	2026	sp|Q91YI0|ARLY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3060.14	50.44077	2	1372.693847	1372.702051	K	V	58	70
PSM	RPWLVDYGESGEQVAGFVK	2027	sp|P16675|PPGB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3144.15	52.81748	3	2136.051671	2136.064004	R	E	418	437
PSM	YFHVVIAGPQDSPFEGGTFK	2028	sp|P61089|UBE2N_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3189.12	54.0709	3	2195.070971	2195.068755	R	L	34	54
PSM	ITQLTPFIGYAGGK	2029	sp|O35488|S27A2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3103.11	51.65765	2	1464.788847	1464.797666	K	T	429	443
PSM	AFDNDVDALCNLR	2030	sp|Q99MN9|PCCB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	10-UNIMOD:4	ms_run[1]:scan=1.1.3015.6	49.18595	2	1521.678847	1521.688192	R	E	262	275
PSM	DLGATWVVLGHSER	2031	sp|P17751|TPIS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3021.3	49.3373	3	1538.775671	1538.784141	K	R	136	150
PSM	GQFSTDELVAEVEK	2032	sp|Q68FD5|CLH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3081.18	51.04592	2	1550.734647	1550.746418	R	R	838	852
PSM	VKPGYLGTAFAHYDVQVIDEQGNVLPPGK	2033	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3155.16	53.13687	4	3111.603294	3111.602936	K	E	379	408
PSM	VDFPQDQLATLTGR	2034	sp|P08249|MDHM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3195.17	54.24502	2	1559.786047	1559.794371	K	I	216	230
PSM	LTLLEVGCGTGANFK	2035	tr|G3X9G9|G3X9G9_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	8-UNIMOD:4	ms_run[1]:scan=1.1.3096.15	51.468	2	1578.797647	1578.807579	K	F	72	87
PSM	TVGIDDLTGEPLIQR	2036	sp|Q9WTP7|KAD3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3191.20	54.13325	2	1625.852647	1625.862451	K	E	147	162
PSM	SQEQLAAELAEYTAK	2037	sp|P26040|EZRI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3097.13	51.49373	2	1650.802047	1650.810081	K	I	413	428
PSM	DVAPQAPVHFLVIPR	2038	sp|Q9D0S9|HINT2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3157.13	53.19557	2	1657.917647	1657.930411	R	K	80	95
PSM	TPDFESTGLYSAMPR	2039	sp|Q9D964|GATM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3073.18	50.81715	2	1670.754447	1670.761022	K	D	155	170
PSM	VPLPSLSPTMQAGTIAR	2040	sp|Q8BMF4|ODP2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3100.19	51.58143	2	1737.939047	1737.944741	K	W	93	110
PSM	VFLTTAEVISQQVSDK	2041	sp|P06801|MAOX_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3125.20	52.27923	2	1763.917647	1763.930531	K	H	477	493
PSM	SYELPDGQVITIGNER	2042	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3073.20	50.81882	2	1789.874647	1789.884643	K	F	239	255
PSM	SGNSVTLLVLDGDSYEK	2043	sp|Q9JIL4|NHRF3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3169.20	53.5233	2	1795.881047	1795.883974	K	A	78	95
PSM	VSHALAEGLGVIACIGEK	2044	sp|P17751|TPIS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	14-UNIMOD:4	ms_run[1]:scan=1.1.3138.5	52.63687	3	1822.960271	1822.961119	K	L	164	182
PSM	AKPNEVVFLDDFGSNLK	2045	sp|P34914|HYES_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3121.9	52.15637	3	1891.958171	1891.967979	K	P	175	192
PSM	FQDEEEVFEWNNEVK	2046	sp|Q9DBF1|AL7A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3174.21	53.66432	2	1940.836647	1940.842838	K	Q	438	453
PSM	FQDEEEVFEWNNEVK	2047	sp|Q9DBF1|AL7A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3167.21	53.46881	2	1940.836647	1940.842838	K	Q	438	453
PSM	ATEIGGILVNTPEDPNLSK	2048	sp|P34914|HYES_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3138.21	52.65022	2	1967.013447	1967.021136	K	I	421	440
PSM	EIIVTDYTPQNLQELQK	2049	sp|P40936|INMT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3183.14	53.9079	3	2031.048071	2031.052437	R	W	81	98
PSM	QAGIAQLYGIAGSTNVTGDQVK	2050	sp|Q9QXD6|F16P1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3137.12	52.614	3	2190.123371	2190.128061	R	K	51	73
PSM	GAQEVFNELPCEYVEPHELR	2051	sp|Q99K67|AASS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	11-UNIMOD:4	ms_run[1]:scan=1.1.3118.18	52.07893	3	2415.109871	2415.116511	K	E	230	250
PSM	DDNPSLPPFERPEAEAMCTSFK	2052	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	18-UNIMOD:4	ms_run[1]:scan=1.1.3147.20	52.90812	3	2537.118371	2537.120275	K	E	131	153
PSM	GFCHLCDGQEACCVGLEAGINPTDHLITAYR	2053	sp|P35486|ODPA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	3-UNIMOD:4,6-UNIMOD:4,12-UNIMOD:4,13-UNIMOD:4	ms_run[1]:scan=1.1.3138.19	52.64855	4	3533.558094	3533.558465	R	A	89	120
PSM	LLVPYLIEAVR	2054	sp|Q61425|HCDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3572.4	64.81537	2	1284.776247	1284.780559	R	L	222	233
PSM	EVMQMLVELAK	2055	sp|P06745|G6PI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3465.4	61.7776	2	1289.663847	1289.672331	K	S	63	74
PSM	INVLPLGSGAIAGNPLGVDR	2056	sp|Q91YI0|ARLY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3483.8	62.28625	3	1932.070271	1932.079260	R	E	194	214
PSM	EVMQMLVELAK	2057	sp|P06745|G6PI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3472.4	61.96938	2	1289.663847	1289.672331	K	S	63	74
PSM	IILDLISESPIK	2058	sp|P61979|HNRPK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3480.9	62.20132	2	1339.788847	1339.796269	K	G	208	220
PSM	NLQNLLILTAIK	2059	sp|Q68FD5|CLH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3602.7	65.65272	2	1352.835247	1352.839137	R	A	1023	1035
PSM	SSRPVFDWKDPLILEEQLTADEK	2060	sp|Q60759|GCDH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	21		ms_run[1]:scan=1.1.3482.8	62.25768	4	2715.3767	2715.3750	K	L	43	66
PSM	KDGSASGTTLLEALDCILPPTRPTDK	2061	sp|P10126|EF1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	21	16-UNIMOD:4	ms_run[1]:scan=1.1.3508.8	62.99413	4	2755.4088	2755.4057	R	P	219	245
PSM	NSNILEDLETLR	2062	sp|Q5XJY5|COPD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3459.11	61.61893	2	1415.718247	1415.725623	K	L	73	85
PSM	LICCDILDVLDK	2063	sp|P62259|1433E_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	3-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=1.1.3574.14	64.8809	2	1475.731847	1475.736388	K	H	95	107
PSM	GLETIASDVVSLASK	2064	sp|Q8BMF4|ODP2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3598.9	65.53933	2	1488.800847	1488.803539	K	A	528	543
PSM	HLYTLDGGDIINALCFSPNR	2065	sp|P68040|RACK1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	15-UNIMOD:4	ms_run[1]:scan=1.1.3526.13	63.50938	3	2275.099271	2275.105552	K	Y	226	246
PSM	LLGQFTLIGIPPAPR	2066	sp|P38647|GRP75_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3628.12	66.40908	2	1591.939847	1591.944999	K	G	499	514
PSM	LYTLVTYVPVTTFK	2067	sp|P62900|RL31_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3485.16	62.35002	2	1643.914247	1643.917447	K	N	102	116
PSM	IAEVGGVPYLLPLVNK	2068	sp|Q91V76|CK054_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3599.11	65.57477	2	1680.980247	1680.981444	R	K	59	75
PSM	IGEWELIQESGVPLK	2069	sp|P56399|UBP5_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3441.8	61.1211	2	1696.886847	1696.903587	R	P	304	319
PSM	QGLLPLTFADPSDYNK	2070	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3509.15	63.0262	2	1777.887847	1777.888666	K	I	702	718
PSM	EEFQQFAGLLQAGIEK	2071	sp|P47199|QOR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3601.17	65.63396	2	1806.913847	1806.915215	K	G	279	295
PSM	SLRPGVAIADFVIFPPR	2072	sp|O09173|HGD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3501.3	62.79995	3	1854.041471	1854.051589	K	W	305	322
PSM	SLDLFNCEVTNLNAYR	2073	sp|O35381|AN32A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	7-UNIMOD:4	ms_run[1]:scan=1.1.3445.21	61.23488	2	1927.901647	1927.909812	K	E	117	133
PSM	LENVSVALEFLDHESIK	2074	sp|Q80X90|FLNB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3441.3	61.11275	3	1941.998171	1942.004758	K	L	77	94
PSM	EGDSPQLMAIMNHVLGPR	2075	sp|Q62468|VILI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3473.6	61.99883	3	1963.953371	1963.960802	K	K	216	234
PSM	SVSAFAPICNPVLCSWGK	2076	sp|Q9R0P3|ESTD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	9-UNIMOD:4,14-UNIMOD:4	ms_run[1]:scan=1.1.3505.5	62.92313	2	1991.957447	1991.959739	R	K	168	186
PSM	LNPNFLVDFGKEPLGPALAHELR	2077	sp|P17563|SBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3490.9	62.48742	4	2546.366494	2546.364544	K	Y	438	461
PSM	AGWTIVTPPTPVIPDDHPLWMSSK	2078	sp|Q9D964|GATM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3614.16	66.00645	3	2644.337171	2644.335946	K	W	333	357
PSM	KDGSASGTTLLEALDCILPPTRPTDK	2079	sp|P10126|EF1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	21	16-UNIMOD:4	ms_run[1]:scan=1.1.3506.5	62.94015	4	2755.4088	2755.4057	R	P	219	245
PSM	GLLDFLQGLA	2080	sp|Q8VCR7|ABHEB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.4084.2	77.31523	2	1045.573647	1045.580797	K	-	201	211
PSM	DSTLIMQLLR	2081	sp|O70456|1433S_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3672.5	67.64378	2	1188.647247	1188.653644	K	D	215	225
PSM	GYADIVQLLLAK	2082	sp|Q62422|OSTF1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3805.2	71.3847	2	1302.751047	1302.754738	K	G	151	163
PSM	AEELGLPILGVLR	2083	sp|Q8VCH0|THIKB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3740.4	69.55517	2	1378.813247	1378.818401	K	S	293	306
PSM	SICTTVLELLDK	2084	sp|P68254|1433T_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	3-UNIMOD:4	ms_run[1]:scan=1.1.3675.7	67.73113	2	1390.731447	1390.737768	R	Y	92	104
PSM	TVLIMELINNVAK	2085	sp|P56480|ATPB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3771.7	70.44102	2	1456.826647	1456.832337	K	A	213	226
PSM	ISGSILNELIGLVR	2086	sp|Q6ZQ38|CAND1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3832.4	72.13435	2	1482.876247	1482.876979	K	S	730	744
PSM	DLAILLGMLDPVEK	2087	sp|O08709|PRDX6_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3914.2	74.41248	2	1525.839247	1525.842567	R	D	109	123
PSM	TIAECLADELINAAK	2088	tr|D3YYM6|D3YYM6_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	5-UNIMOD:4	ms_run[1]:scan=1.1.3725.2	69.13247	3	1630.815371	1630.823623	K	-	168	183
PSM	ITSCIFQLLQEAGIK	2089	sp|Q9DCL9|PUR6_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	4-UNIMOD:4	ms_run[1]:scan=1.1.3791.14	71.00359	2	1719.917047	1719.922943	K	T	60	75
PSM	VLVCGAGPVGMVTLLVAK	2090	sp|Q64442|DHSO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	4-UNIMOD:4	ms_run[1]:scan=1.1.3713.17	68.81364	2	1783.006247	1783.009984	K	A	176	194
PSM	GLLPEELTPLILETQK	2091	sp|Q99LC5|ETFA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3752.4	69.89003	3	1793.015771	1793.018617	K	Q	86	102
PSM	GQLTIDQVFPYPSVLSEEQAQFLK	2092	sp|P50544|ACADV_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3799.19	71.23282	3	2736.395171	2736.401048	K	E	81	105
PSM	NIANPTAMLLSATNMLR	2093	tr|Q91VA7|Q91VA7_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3771.16	70.44853	2	1829.940047	1829.949174	R	H	317	334
PSM	VTGEPLYNAVVWLDLR	2094	sp|Q64516|GLPK_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3786.2	70.85703	3	1843.966271	1843.983235	K	T	103	119
PSM	EISLWFQPEELVEYK	2095	sp|P15532|NDKA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3781.18	70.73515	2	1908.943247	1908.950932	K	S	129	144
PSM	ITTEEEIEFYIQQFK	2096	sp|P34914|HYES_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3791.7	70.99775	3	1916.939771	1916.940761	K	K	440	455
PSM	NGPVEGAFTVFSDFLTYK	2097	sp|P10605|CATB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3848.14	72.59834	2	1990.966847	1990.967644	K	S	246	264
PSM	GVDVIIEMLANENLSNDLK	2098	sp|P47199|QOR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3856.6	72.8259	3	2086.054271	2086.061621	K	L	219	238
PSM	ALMLQGVDLLADAVAVTMGPK	2099	sp|P63038|CH60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3918.2	74.52177	3	2112.128771	2112.132284	R	G	38	59
PSM	GVDIYTGLLSALASVPTLPSES	2100	tr|A0A0R4J050|A0A0R4J050_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.4067.2	77.04288	3	2189.143871	2189.146731	R	-	387	409
PSM	VRGPEYDAFLDEFMEAASSK	2101	sp|P06801|MAOX_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3659.7	67.28862	3	2261.039471	2261.031049	R	Y	216	236
PSM	NPLSDPLYDCIFTVEGAGLTK	2102	sp|P21981|TGM2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	10-UNIMOD:4	ms_run[1]:scan=1.1.3760.11	70.12532	3	2309.129171	2309.124950	K	E	610	631
PSM	VTPGSTCAVFGLGGVGLSVIIGCK	2103	sp|P00329|ADH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	7-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=1.1.3783.8	70.7811	3	2348.213771	2348.223225	K	A	190	214
PSM	KFDVNTSAVQVLIEHIGNLDR	2104	sp|Q68FD5|CLH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3651.3	67.0581	4	2367.250094	2367.254659	R	A	1074	1095
PSM	LILPYVELDLHSYDLGIENR	2105	sp|O88844|IDHC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3743.11	69.64332	3	2371.243571	2371.242363	K	D	30	50
PSM	IYPEEMIQTGISAIDGMNSIAR	2106	sp|P62814|VATB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3809.13	71.50165	3	2408.175671	2408.171582	R	G	164	186
PSM	ILELLTVTRPNAVALVDAFDFK	2107	sp|Q9R0H0|ACOX1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3795.13	71.11567	3	2444.364971	2444.367898	R	D	592	614
PSM	EPGQDLVVLSLPITPEFIPSFR	2108	sp|P01027|CO3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3883.5	73.57288	3	2453.319071	2453.320613	R	L	509	531
PSM	ACGANLPENFSISQIFSQAMAAR	2109	sp|P34914|HYES_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	2-UNIMOD:4	ms_run[1]:scan=1.1.3791.13	71.00275	3	2482.171271	2482.173314	K	S	77	100
PSM	DCVGPEVENACANPAAGTVILLENLR	2110	sp|P09411|PGK1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	2-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=1.1.3791.20	71.0086	3	2781.348371	2781.342564	K	F	98	124
PSM	LAALADQWQFLVQK	2111	sp|P16546|SPTN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3519.11	63.3057	2	1629.880047	1629.887878	R	S	1633	1647
PSM	CLELFTELAEDK	2112	sp|P07901|HS90A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.3987.2	75.99612	2	1449.6671	1449.6692	K	E	421	433
PSM	SFLVGSAAQSLSK	2113	sp|Q9R0H0|ACOX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2711.14	40.6603	2	1293.684647	1293.692866	R	A	283	296
PSM	QHGIPIPVTPK	2114	sp|P16460|ASSY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:28	ms_run[1]:scan=1.1.2703.10	40.42895	2	1168.6513	1168.6599	K	S	166	177
PSM	EVGADFTIQVGK	2115	sp|Q64442|DHSO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2817.13	43.63648	2	1262.641247	1262.650667	K	E	215	227
PSM	CQPPDAVVWPQNVDQVSR	2116	sp|Q7TNG8|LDHD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.3516.9	63.21757	3	2076.9625	2076.9682	R	V	63	81
PSM	QFSYTHICAGASAFGK	2117	sp|Q99LC5|ETFA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:28,8-UNIMOD:4	ms_run[1]:scan=1.1.3068.19	50.67605	2	1726.7679	1726.7768	K	N	102	118
PSM	KIPIVSSMAEPLVAGPDEK	2118	sp|Q9JIL4|NHRF3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3008.6	48.9901	3	1980.055271	1980.060165	K	G	467	486
PSM	AIFASGSPFDPVTLPDGR	2119	sp|P06801|MAOX_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3470.20	61.92764	2	1845.923247	1845.926114	R	T	428	446
PSM	QITINDLPVGR	2120	sp|P35700|PRDX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:28	ms_run[1]:scan=1.1.3467.2	61.83057	2	1207.6474	1207.6556	R	S	141	152
PSM	VNPTVFFDITADDEPLGR	2121	sp|P17742|PPIA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:1	ms_run[1]:scan=1.1.3963.2	75.5397	3	2046.9898	2046.9893	M	V	2	20
PSM	QGIDHEYLSSVDLK	2122	sp|Q9D826|SOX_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:28	ms_run[1]:scan=1.1.3002.20	48.83442	2	1585.7561	1585.7619	R	Q	113	127
PSM	YPIEHGIITNWDDMEK	2123	sp|P62737|ACTA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2916.14	46.43425	3	1959.913871	1959.903664	K	I	71	87
PSM	HLGLPVFNTVK	2124	sp|Q9WUM5|SUCA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2752.15	41.80725	2	1223.694447	1223.702643	K	E	95	106
PSM	ADLEEQLSDEEK	2125	sp|P47754|CAZA2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:1	ms_run[1]:scan=1.1.3091.18	51.33227	2	1446.6319	1446.6357	M	V	2	14
PSM	LGGSAVISLEGKPL	2126	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2990.9	48.48969	2	1339.763247	1339.771117	K	-	153	167
PSM	QVELALWDTAGQEDYDR	2127	sp|Q9QUI0|RHOA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:28	ms_run[1]:scan=1.1.3821.18	71.84182	2	1990.8925	1990.8903	K	L	52	69
PSM	NINNDTTYCIK	2128	sp|Q99KR3|LACB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	9-UNIMOD:4	ms_run[1]:scan=1.1.2235.13	27.47313	2	1354.609847	1354.618715	K	K	92	103
PSM	CLAFHDISPQAPTHFLVIPK	2129	sp|P70349|HINT1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.3549.11	64.16891	3	2273.1632	2273.1662	R	K	38	58
PSM	VLELYLDLLSQPCR	2130	sp|Q64471|GSTT1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	21	13-UNIMOD:4	ms_run[1]:scan=1.1.3755.12	69.983	2	1717.9046	1717.9068	M	A	2	16
PSM	SQPVHLPLTFESGPDEVR	2131	sp|Q99K30|ES8L2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2934.14	46.94827	3	2007.005771	2007.006155	R	A	620	638
PSM	MEALILEPSLYTVK	2132	sp|P61924|COPZ1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:1	ms_run[1]:scan=1.1.3903.2	74.11238	2	1647.8741	1647.8788	-	A	1	15
PSM	AAGAAAALAFLNQESR	2133	sp|Q9CPP0|NPM3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:1	ms_run[1]:scan=1.1.3852.6	72.70573	2	1601.8161	1601.8156	M	A	2	18
PSM	VPVENVLGEVGGGFK	2134	sp|Q8JZN5|ACAD9_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3170.12	53.54436	2	1500.810847	1499.798394	R	V	284	299
PSM	ATLCLFDMDGTLTAPR	2135	sp|Q9Z2M7|PMM2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:1,4-UNIMOD:4	ms_run[1]:scan=1.1.3877.8	73.40031	2	1822.8547	1822.8588	M	Q	2	18
PSM	DPSQELEFIADILSQDAK	2136	sp|Q61239|FNTA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3958.2	75.40605	3	2018.990771	2017.984417	K	N	181	199
PSM	QAMGEQAVALAK	2137	sp|Q91ZA3|PCCA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2308.15	29.48527	2	1214.622247	1215.628158	R	A	310	322
PSM	MTNGFSGADLTEICQR	2138	sp|Q01853|TERA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	14-UNIMOD:4	ms_run[1]:scan=1.1.3019.11	49.29847	2	1799.793847	1798.797819	K	A	678	694
PSM	NFPNAIEHTLQWAR	2139	sp|Q02053|UBA1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3044.8	49.9866	3	1696.836071	1695.848138	K	D	636	650
PSM	AADVHEVR	2140	sp|P52480|KPYM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.1633.13	10.73748	2	895.442447	895.451179	K	K	248	256
PSM	HGVYNPNK	2141	sp|P08249|MDHM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.1620.13	10.38095	2	927.447847	927.456265	K	I	158	166
PSM	KAEAQIAAK	2142	sp|P05202|AATM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.1609.13	10.07477	2	928.525047	928.534181	R	N	82	91
PSM	HALDAHQR	2143	sp|Q9D1K2|VATF_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.1572.17	9.047816	2	946.468047	946.473312	R	S	76	84
PSM	KTEEIVQK	2144	sp|Q9DC50|OCTC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.1642.18	10.98683	2	973.535247	973.544411	K	F	50	58
PSM	KYEATLEK	2145	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.1744.17	13.80892	2	980.508447	980.517862	K	C	376	384
PSM	VLGTAGSEEGK	2146	sp|P47199|QOR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.1772.19	14.59463	2	1046.514247	1046.524404	K	K	176	187
PSM	EHMQPTHPIR	2147	sp|P61982|1433G_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.1687.21	12.24162	2	1244.600847	1244.608425	K	L	163	173
PSM	EQHGHDESMHR	2148	sp|Q7TNG8|LDHD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.1564.15	8.82755	3	1361.542871	1361.553095	R	C	52	63
PSM	VGASFLQR	2149	sp|P05202|AATM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2323.7	29.89717	2	876.475447	876.481751	R	F	140	148
PSM	TIAPALVSK	2150	sp|P17182|ENOA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2260.12	28.15477	2	898.540847	898.548768	K	K	72	81
PSM	ATDFVVDR	2151	sp|P54071|IDHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2228.9	27.2762	2	921.446847	921.455596	K	A	181	189
PSM	ATDFVVDR	2152	sp|P54071|IDHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2221.14	27.0873	2	921.446847	921.455596	K	A	181	189
PSM	DSQGNLFR	2153	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2240.11	27.60295	2	935.437447	935.446094	K	N	88	96
PSM	DSQGNLFR	2154	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2233.7	27.40915	2	935.437447	935.446094	K	N	88	96
PSM	FDSQTVLK	2155	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2251.11	27.9089	2	936.485847	936.491647	K	V	292	300
PSM	ILDWHVANTDKK	2156	sp|Q93092|TALDO_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2226.12	27.22408	3	1438.748471	1438.756864	R	S	193	205
PSM	GLTSVINQK	2157	sp|P16125|LDHB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2221.17	27.08982	2	958.537647	958.544745	R	L	300	309
PSM	LTAAVDELR	2158	sp|Q99MZ7|PECR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2359.5	30.88382	2	986.530247	986.539660	R	A	55	64
PSM	NTYYASIAK	2159	sp|P45952|ACADM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2179.14	25.92193	2	1029.504447	1029.513111	R	A	350	359
PSM	EVNLAVENAK	2160	sp|Q9JLJ2|AL9A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2172.15	25.72847	2	1085.562847	1085.571688	K	A	50	60
PSM	GISEETTTGVHNLYK	2161	sp|P50247|SAHH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2316.16	29.70828	3	1647.800771	1647.810415	R	M	152	167
PSM	ILSTAQRPLE	2162	sp|Q3TNA1|XYLB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2258.14	28.10162	2	1126.626047	1126.634623	R	-	542	552
PSM	GYSFTTTAER	2163	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2259.15	28.12977	2	1131.514047	1131.519653	R	E	197	207
PSM	PFFHSLCDK	2164	sp|P10639|THIO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	7-UNIMOD:4	ms_run[1]:scan=1.1.2299.3	29.2266	3	1149.518471	1149.527715	K	Y	40	49
PSM	YLAEVAAGDDK	2165	sp|P63101|1433Z_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2192.15	26.29043	2	1150.542247	1150.550619	R	K	128	139
PSM	GDDVINASGYR	2166	sp|Q91VA0|ACSM1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2273.16	28.51898	2	1165.531247	1165.536366	R	I	464	475
PSM	TKPADMVIEAYGHGQR	2167	sp|Q9Z2Y8|PLPHP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2372.11	31.2415	3	1771.854071	1771.867553	K	T	48	64
PSM	VMLGETNPADSKPGTIR	2168	sp|P15532|NDKA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2327.19	30.01975	3	1784.904971	1784.909084	R	G	89	106
PSM	EAAENSLVAYK	2169	sp|P62259|1433E_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2279.17	28.68825	2	1193.586447	1193.592818	K	A	143	154
PSM	AIQDAGCQVLK	2170	sp|P40936|INMT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	7-UNIMOD:4	ms_run[1]:scan=1.1.2274.18	28.54882	2	1201.603047	1201.612508	K	C	225	236
PSM	EELGAQQPDLK	2171	sp|Q64105|SPRE_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2219.20	27.03695	2	1226.606247	1226.614282	K	V	53	64
PSM	MEEFKDQLPADECNK	2172	sp|P38647|GRP75_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	13-UNIMOD:4	ms_run[1]:scan=1.1.2351.16	30.6744	3	1852.794671	1852.797150	K	L	596	611
PSM	ASQRPDVLTTGGGNPIGDK	2173	sp|P24270|CATA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2304.16	29.37738	3	1881.944171	1881.954454	R	L	20	39
PSM	DHGGALGPEEFK	2174	sp|P57780|ACTN4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2226.19	27.22993	2	1255.573847	1255.583316	K	A	781	793
PSM	KPAPSQALLFGK	2175	sp|O35855|BCAT2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2337.16	30.29155	2	1255.718047	1255.728858	K	T	48	60
PSM	IDEPLEGSEDR	2176	sp|P61979|HNRPK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2200.19	26.51882	2	1258.561447	1258.567725	K	I	423	434
PSM	AVAGNISDPGLQK	2177	sp|Q64727|VINC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2235.11	27.4698	2	1268.664847	1268.672465	K	S	803	816
PSM	LHGSGDLEAWEK	2178	sp|Q9CPY7|AMPL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2309.20	29.51677	2	1340.627847	1340.636080	K	G	177	189
PSM	INVYYNEAAGNK	2179	sp|Q7TMM9|TBB2A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2296.19	29.15453	2	1354.644847	1354.651730	R	Y	47	59
PSM	RPFFPFHSPSR	2180	sp|P23927|CRYAB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2338.6	30.31017	3	1373.693771	1373.699289	R	L	12	23
PSM	FSSQEAASSFGDDR	2181	sp|Q91ZA3|PCCA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2374.21	31.30465	2	1502.619247	1502.627366	R	L	240	254
PSM	IWHHTFYNELR	2182	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2337.5	30.28238	3	1514.734571	1514.741882	K	V	85	96
PSM	ESNTELAEDCEIK	2183	sp|O08677|KNG1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	10-UNIMOD:4	ms_run[1]:scan=1.1.2258.20	28.10662	2	1536.652647	1536.661368	K	H	330	343
PSM	KGAAIEALNDGELQK	2184	sp|Q99L47|F10A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2308.13	29.4836	3	1555.809071	1555.820586	K	A	117	132
PSM	IQTFQGDSDHNWK	2185	sp|P28825|MEP1A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2210.8	26.78332	3	1574.707871	1574.711370	K	I	376	389
PSM	SDFDPGQDTYQHPPK	2186	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2227.16	27.25513	3	1730.745071	1730.753629	R	D	535	550
PSM	VMLGETNPADSKPGTIR	2187	sp|P15532|NDKA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	2-UNIMOD:35	ms_run[1]:scan=1.1.2234.14	27.44448	3	1800.899471	1800.903999	R	G	89	106
PSM	EQAGGDATENFEDVGHSTDAR	2188	sp|P56395|CYB5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2314.20	29.6556	3	2204.907971	2204.920647	R	E	53	74
PSM	YYVTIIDAPGHR	2189	sp|P10126|EF1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2594.6	37.3953	3	1403.710871	1403.719750	K	D	85	97
PSM	ALAEGVLLR	2190	sp|P51855|GSHB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2636.5	38.55603	2	940.561247	940.570566	R	S	26	35
PSM	AHTMTDDVTFWK	2191	sp|Q68FD5|CLH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2708.7	40.56853	3	1450.646171	1450.655101	K	W	101	113
PSM	ALASLMTYK	2192	sp|P26443|DHE3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2640.8	38.67208	2	996.522647	996.531404	K	C	163	172
PSM	DVNAAIATIK	2193	sp|P05213|TBA1B_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2591.4	37.31057	2	1014.562447	1014.570960	K	T	327	337
PSM	MFASFPTTK	2194	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2621.6	38.13617	2	1028.492447	1028.500103	R	T	33	42
PSM	LPEILVETK	2195	sp|Q7TNG8|LDHD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2770.8	42.30359	2	1040.602447	1040.611762	R	E	375	384
PSM	LPAVVTADLR	2196	sp|Q9DCW4|ETFB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2723.9	41.00153	2	1053.608447	1053.618245	K	L	177	187
PSM	RIPQSTLSEFYPR	2197	sp|P62814|VATB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2699.7	40.31168	3	1592.822471	1592.831091	K	D	494	507
PSM	RGGGSVVIVGSVAGFTR	2198	sp|Q99LB2|DHRS4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2702.11	40.40103	3	1617.888671	1617.895088	K	F	160	177
PSM	LGDVYVNDAFGTAHR	2199	sp|P09041|PGK2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2674.11	39.6195	3	1633.778771	1633.784869	K	A	157	172
PSM	MEIQEIQLK	2200	sp|P58771|TPM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2779.11	42.55868	2	1130.593047	1130.600546	K	E	141	150
PSM	AVAQALEVIPR	2201	sp|P80318|TCPG_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2790.14	42.87538	2	1165.671447	1165.681908	R	T	439	450
PSM	GILLYGPPGTGK	2202	sp|Q01853|TERA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2794.10	42.98438	2	1171.651247	1171.660110	R	T	240	252
PSM	HLEINPDHSIIETLR	2203	sp|P07901|HS90A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2736.13	41.36245	3	1785.930371	1785.937347	K	Q	634	649
PSM	HNNLDLVIIR	2204	tr|Q91VA7|Q91VA7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2670.3	39.49888	3	1205.678171	1205.688056	R	E	154	164
PSM	HNNLDLVIIR	2205	tr|Q91VA7|Q91VA7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2668.14	39.45207	2	1205.680647	1205.688056	R	E	154	164
PSM	QITVNDLPVGR	2206	sp|Q61171|PRDX2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2703.11	40.42978	2	1210.657247	1210.666986	R	S	140	151
PSM	LTGTIQNDILK	2207	sp|P16332|MUTA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2629.13	38.36573	2	1214.675847	1214.687053	K	E	211	222
PSM	VFQPLPHENKPLTLSSYQTNK	2208	sp|Q62426|CYTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2592.15	37.3476	4	2440.268094	2440.275060	R	E	69	90
PSM	GVLFASGQNLAR	2209	sp|Q9CPY7|AMPL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2648.14	38.90445	2	1231.658847	1231.667320	K	H	189	201
PSM	YMACCLLYR	2210	sp|P05213|TBA1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	4-UNIMOD:4,5-UNIMOD:4	ms_run[1]:scan=1.1.2751.10	41.77588	2	1248.535647	1248.545356	K	G	312	321
PSM	QVVDSAYEVIK	2211	sp|P06151|LDHA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2606.19	37.73935	2	1249.645847	1249.655418	K	L	233	244
PSM	MNPQSAFFQGK	2212	sp|P32020|NLTP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2598.15	37.51273	2	1253.574447	1253.586293	K	L	512	523
PSM	RTPFGAYGGLLK	2213	sp|Q8BWT1|THIM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2673.17	39.59598	2	1278.699847	1278.708457	K	D	14	26
PSM	CPDIAIQLAGTK	2214	sp|P51855|GSHB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	1-UNIMOD:4	ms_run[1]:scan=1.1.2760.16	42.03053	2	1285.661647	1285.670023	K	K	294	306
PSM	KYTPEQVAMATVTALHR	2215	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	9-UNIMOD:35	ms_run[1]:scan=1.1.2696.17	40.23413	3	1930.985171	1930.993482	K	T	243	260
PSM	FNVWDTAGQEK	2216	sp|P62827|RAN_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2692.17	40.12125	2	1293.593847	1293.598966	K	F	61	72
PSM	NPAVLSAASFDGR	2217	sp|Q3UPL0|SC31A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2697.12	40.25843	2	1303.645047	1303.652064	R	I	315	328
PSM	VGIPVVAVESDPK	2218	sp|Q9DBM2|ECHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2780.17	42.59218	2	1308.720447	1308.728917	R	Q	317	330
PSM	TCLLISYTTNK	2219	sp|P60766|CDC42_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	2-UNIMOD:4	ms_run[1]:scan=1.1.2712.18	40.69245	2	1312.661447	1312.669688	K	F	17	28
PSM	SLLPGCQSVISR	2220	sp|Q9DCM0|ETHE1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	6-UNIMOD:4	ms_run[1]:scan=1.1.2678.16	39.73785	2	1315.684247	1315.691821	R	L	93	105
PSM	EAAQMDMVNDGVEDLRGK	2221	sp|P19157|GSTP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2746.16	41.64562	3	1976.885171	1976.893176	R	Y	86	104
PSM	GVAINFVTEEDK	2222	sp|P10630|IF4A2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2764.14	42.14063	2	1320.645647	1320.656146	K	R	371	383
PSM	ISENMIPVVAEK	2223	sp|Q8VCT4|CES1D_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2777.17	42.50732	2	1328.692847	1328.700988	K	Y	389	401
PSM	VVGAMQLYSVDR	2224	sp|Q68FD5|CLH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2767.17	42.22688	2	1336.668647	1336.680921	R	K	177	189
PSM	DGTYAVTYIPDK	2225	sp|Q80X90|FLNB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2752.17	41.80892	2	1341.636247	1341.645247	K	T	1573	1585
PSM	TVIIEQSWGSPK	2226	sp|P63038|CH60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2703.15	40.43312	2	1343.698847	1343.708516	R	V	61	73
PSM	HFSVEGQLEFR	2227	sp|P07901|HS90A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2653.5	39.03605	3	1347.647471	1347.657149	K	A	329	340
PSM	DTEQVDNWMSK	2228	sp|P16546|SPTN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2627.17	38.31333	2	1351.560247	1351.571431	R	Q	475	486
PSM	CLYASVLTAQPR	2229	sp|P58252|EF2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	1-UNIMOD:4	ms_run[1]:scan=1.1.2790.21	42.88123	2	1377.696847	1377.707471	R	L	728	740
PSM	ETTIQGLDGLSER	2230	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2738.19	41.42462	2	1417.698047	1417.704888	K	C	122	135
PSM	PFETLLSQNQGGK	2231	sp|P19157|GSTP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2659.16	39.20767	2	1417.709647	1417.720144	K	A	129	142
PSM	NAQLNIEQDVAPH	2232	sp|Q99KQ4|NAMPT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2644.18	38.79415	2	1447.695247	1447.705556	K	-	479	492
PSM	NVETMNYADIER	2233	sp|Q9D2G2|ODO2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2596.19	37.46098	2	1453.647047	1453.650744	R	T	335	347
PSM	LREMLNISGPPLK	2234	sp|Q9CPY7|AMPL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2717.4	40.82513	3	1466.817671	1466.827920	K	A	67	80
PSM	ECYQTWAQLER	2235	sp|Q9D826|SOX_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	2-UNIMOD:4	ms_run[1]:scan=1.1.2760.20	42.03387	2	1482.646247	1482.656163	K	E	70	81
PSM	GATTNICYNVLDR	2236	sp|Q9QXG4|ACSA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	7-UNIMOD:4	ms_run[1]:scan=1.1.2713.21	40.72387	2	1495.703647	1495.708927	K	N	98	111
PSM	FKLEAPDADELPR	2237	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2769.5	42.27287	3	1499.751671	1499.762009	K	S	522	535
PSM	HVTIVVGTSGDTGSAAIESVQGSK	2238	sp|Q80W22|THNS2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2633.20	38.48328	3	2299.161671	2299.165569	K	N	134	158
PSM	ETVSEESNVLCLSK	2239	sp|P58252|EF2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	11-UNIMOD:4	ms_run[1]:scan=1.1.2676.20	39.68427	2	1593.747847	1593.755603	R	S	581	595
PSM	MISSYVGENAEFER	2240	sp|Q9D0K2|SCOT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2715.19	40.78003	2	1630.724047	1630.729722	R	Q	111	125
PSM	RLYATTSLYSAWDK	2241	sp|P17563|SBP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2763.19	42.1169	2	1673.831247	1673.841322	K	Q	398	412
PSM	NQLTSNPENTVFDAK	2242	sp|P20029|BIP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2608.21	37.79667	2	1676.784047	1676.800579	K	R	83	98
PSM	ELGATECINPQDYSK	2243	sp|P00329|ADH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	7-UNIMOD:4	ms_run[1]:scan=1.1.2607.21	37.76947	2	1723.766247	1723.772316	K	P	235	250
PSM	ILIRPLYSNPPLNGAR	2244	sp|P05202|AATM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2790.16	42.87705	3	1793.019371	1793.031188	K	I	310	326
PSM	ADRDQYELLCLDNTR	2245	sp|Q921I1|TRFE_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	10-UNIMOD:4	ms_run[1]:scan=1.1.2783.13	42.67465	3	1880.861771	1880.868676	K	K	237	252
PSM	GEVITTYCPANNEPIAR	2246	sp|Q9DBF1|AL7A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	8-UNIMOD:4	ms_run[1]:scan=1.1.2650.21	38.96603	2	1903.903447	1903.909812	R	V	63	80
PSM	YPIEHGIITNWDDMEK	2247	sp|P62737|ACTA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	14-UNIMOD:35	ms_run[1]:scan=1.1.2728.9	41.14373	3	1975.894271	1975.898579	K	I	71	87
PSM	LEAYHTQTTPLVEYYR	2248	sp|Q9WTP6|KAD2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2707.18	40.54932	3	1982.964071	1982.973792	R	K	187	203
PSM	VLAVNQENEHLMEDYER	2249	sp|P57780|ACTN4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2644.16	38.79248	3	2087.955371	2087.958219	K	L	285	302
PSM	LTGFHETSNINDFSAGVANR	2250	sp|P15105|GLNA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2715.17	40.77837	3	2149.014671	2149.018845	R	G	300	320
PSM	ASGAVGLSYGAHSNLCVNQIVR	2251	sp|Q9JHI5|IVD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	16-UNIMOD:4	ms_run[1]:scan=1.1.2781.17	42.62063	3	2272.130771	2272.138249	R	N	119	141
PSM	ASGEPVVLSGQITGLTEGQHGFHVHQYGDNTQGCTSAGPHFNPHSK	2252	sp|P08228|SODC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	20	34-UNIMOD:4	ms_run[1]:scan=1.1.2722.19	40.9813	7	4840.2722	4840.2432	K	K	25	71
PSM	AAEMLLFGK	2253	sp|Q78JN3|ECI3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2913.4	46.34245	2	978.514447	978.520839	K	K	217	226
PSM	ARFEELNADLFR	2254	sp|P17156|HSP72_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2907.4	46.17385	3	1479.738371	1479.747027	R	G	303	315
PSM	TSNHAIVLAQLITR	2255	sp|Q9R0H0|ACOX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2857.5	44.7656	3	1535.866571	1535.878376	K	G	183	197
PSM	ANTIGISLIK	2256	sp|P13707|GPDA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2798.5	43.09257	2	1028.614247	1028.622996	K	G	111	121
PSM	LHVVGAPGGQSLSLSLDDLHK	2257	sp|Q8R086|SUOX_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2918.4	46.48233	4	2142.132894	2142.143317	R	F	233	254
PSM	VALLQDPEFYEHR	2258	sp|O88428|PAPS2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2845.6	44.42447	3	1615.785071	1615.799457	R	K	331	344
PSM	VGEVIVTKDDAMLLK	2259	sp|P63038|CH60_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2800.6	43.15018	3	1629.895571	1629.901145	K	G	345	360
PSM	KYDNCWLALTDPR	2260	sp|Q9Z2V4|PCKGC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	5-UNIMOD:4	ms_run[1]:scan=1.1.2917.8	46.4574	3	1650.773171	1650.782427	K	D	71	84
PSM	FNIIQPGPIK	2261	sp|Q9CQ62|DECR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2850.10	44.56902	2	1125.645647	1125.654630	R	T	235	245
PSM	VADIGLAAWGR	2262	sp|P50247|SAHH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2977.8	48.1339	2	1127.599847	1127.608743	K	K	9	20
PSM	FEDENFILK	2263	sp|P17742|PPIA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2894.8	45.8115	2	1153.558847	1153.565540	K	H	83	92
PSM	FLVGPDGVPVR	2264	sp|P11352|GPX1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2839.7	44.25933	2	1154.637047	1154.644794	K	R	165	176
PSM	LVIIEGDLER	2265	tr|D3Z2H9|D3Z2H9_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2826.10	43.89172	2	1155.641647	1155.649939	K	T	133	143
PSM	DVTGAEALLER	2266	sp|P16546|SPTN1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2903.11	46.06707	2	1172.597047	1172.603717	K	H	1370	1381
PSM	IENVVLVVPAK	2267	sp|Q6P1B1|XPP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2807.11	43.35077	2	1179.714247	1179.722710	R	T	536	547
PSM	LGGSVELVDIGK	2268	sp|Q9D1A2|CNDP2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2839.11	44.26266	2	1185.651647	1185.660504	R	Q	55	67
PSM	VLELVSITANK	2269	sp|Q9CZN7|GLYM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2901.14	46.01254	2	1185.688447	1185.696889	R	N	399	410
PSM	VLELVSITANK	2270	sp|Q9CZN7|GLYM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2895.9	45.84008	2	1185.688447	1185.696889	R	N	399	410
PSM	KVEFVLDLPK	2271	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2883.10	45.50593	2	1186.689047	1186.696161	R	T	544	554
PSM	VGDDPAVWQLK	2272	sp|P26039|TLN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2822.12	43.7788	2	1226.623447	1226.629538	K	N	2105	2116
PSM	ALVQQLEQFR	2273	sp|P06728|APOA4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2929.10	46.80128	2	1230.662647	1230.672071	K	Q	317	327
PSM	TVFGVEPDLTR	2274	sp|Q9D1A2|CNDP2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2870.15	45.14687	2	1232.629047	1232.640102	K	E	403	414
PSM	TVFGVEPDLTR	2275	sp|Q9D1A2|CNDP2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2864.15	44.97465	2	1232.629047	1232.640102	K	E	403	414
PSM	LNAFGNAFLNR	2276	sp|Q9QXY6|EHD3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2950.9	47.38168	2	1235.633447	1235.641105	K	F	125	136
PSM	PLGCNIINVPSDEHGIIPEGLKK	2277	sp|Q9WVM8|AADAT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	4-UNIMOD:4	ms_run[1]:scan=1.1.2968.13	47.89183	4	2499.312894	2499.315545	K	I	151	174
PSM	RPCFSALTVDETYVPK	2278	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	3-UNIMOD:4	ms_run[1]:scan=1.1.2852.14	44.62962	3	1881.930071	1881.929485	R	E	509	525
PSM	PMFIVNTNVPR	2279	sp|P34884|MIF_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	20		ms_run[1]:scan=1.1.2883.14	45.50928	2	1286.6717	1286.6800	M	A	2	13
PSM	LGWSIGPAHLIK	2280	sp|Q71RI9|KAT3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2913.2	46.34078	3	1290.737471	1290.744842	K	H	290	302
PSM	VIVLWTANTER	2281	sp|Q9JHU9|INO1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2924.15	46.66282	2	1300.707247	1300.713936	K	F	223	234
PSM	YALYDASFETK	2282	sp|Q9R0P5|DEST_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2800.13	43.15602	2	1306.600647	1306.608134	R	E	82	93
PSM	ISAFGYLECSAK	2283	sp|Q62159|RHOC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	9-UNIMOD:4	ms_run[1]:scan=1.1.2907.15	46.18303	2	1344.630247	1344.638388	R	T	151	163
PSM	GIICGLTQFTNK	2284	sp|Q64516|GLPK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	4-UNIMOD:4	ms_run[1]:scan=1.1.2968.17	47.89517	2	1350.691047	1350.696572	R	C	384	396
PSM	LVILANNCPALR	2285	sp|P62889|RL30_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	8-UNIMOD:4	ms_run[1]:scan=1.1.2823.16	43.81085	2	1352.748847	1352.759841	K	K	45	57
PSM	TLEDFDLGTTEK	2286	sp|Q8R4N0|CLYBL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2805.17	43.30052	2	1367.638247	1367.645641	K	C	91	103
PSM	DFTPVCTTELGR	2287	sp|O08709|PRDX6_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	6-UNIMOD:4	ms_run[1]:scan=1.1.2820.15	43.72393	2	1394.643247	1394.650015	R	A	42	54
PSM	FFGNNWAETYR	2288	sp|Q8CG76|ARK72_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2956.17	47.55367	2	1403.618047	1403.625849	R	N	259	270
PSM	FAVYLPPQAESGK	2289	sp|Q9R0P3|ESTD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2863.13	44.9443	2	1405.716247	1405.724166	R	C	32	45
PSM	LCGSGFQSIVSGCQEICSK	2290	sp|Q8BWT1|THIM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	2-UNIMOD:4,13-UNIMOD:4,17-UNIMOD:4	ms_run[1]:scan=1.1.2934.17	46.95077	3	2115.933971	2115.938746	R	D	91	110
PSM	LTFSCLGGSDNFK	2291	sp|Q9R0Q7|TEBP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	5-UNIMOD:4	ms_run[1]:scan=1.1.2915.20	46.41142	2	1444.660647	1444.665666	K	H	36	49
PSM	FVTVQTISGTGALR	2292	sp|P05202|AATM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2848.19	44.51985	2	1448.792047	1448.798728	R	V	126	140
PSM	ARFEELNADLFR	2293	sp|P17156|HSP72_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2904.6	46.0912	3	1479.738371	1479.747027	R	G	303	315
PSM	VIQGSLDSLPQAVR	2294	sp|Q9Z2V4|PCKGC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2803.18	43.24563	2	1481.811247	1481.820192	K	K	15	29
PSM	GAFSNPETLDLYR	2295	sp|Q9D2R0|AACS_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2974.6	48.05402	2	1481.709247	1481.715058	R	D	652	665
PSM	HNDDEQYAWESSAGGSFTVR	2296	sp|P07901|HS90A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2814.20	43.55635	3	2254.947371	2254.951553	K	T	154	174
PSM	VCENIPIVLCGNK	2297	sp|P62827|RAN_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	2-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.2857.19	44.77728	2	1514.752247	1514.758520	R	V	111	124
PSM	LLIHQSLAGGIIGVK	2298	sp|P61979|HNRPK_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2869.6	45.11061	3	1517.919671	1517.929349	R	G	149	164
PSM	GLEVTAYSPLGSSDR	2299	sp|Q9JII6|AK1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2882.20	45.4867	2	1550.751247	1550.757651	R	A	204	219
PSM	VWFVSNIDGTHIAK	2300	sp|P06745|G6PI_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2924.6	46.65532	3	1585.818071	1585.825277	R	T	181	195
PSM	AVLVDLEPGTMDSVR	2301	sp|P68372|TBB4B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	11-UNIMOD:35	ms_run[1]:scan=1.1.2878.20	45.37615	2	1616.801247	1616.807973	R	S	63	78
PSM	GLYDGPVCEVSVTPK	2302	sp|O08553|DPYL2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	8-UNIMOD:4	ms_run[1]:scan=1.1.2843.20	44.38055	2	1619.780047	1619.786509	R	T	497	512
PSM	LVINGKPITIFQER	2303	tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2924.8	46.65698	3	1626.941471	1626.945727	K	D	65	79
PSM	AHCQTSGWSLTEQDPYNNIVR	2304	sp|P16332|MUTA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	3-UNIMOD:4	ms_run[1]:scan=1.1.2859.19	44.83457	3	2475.108371	2475.123721	R	T	347	368
PSM	WVVIGDENYGEGSSR	2305	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2863.19	44.94932	2	1666.752247	1666.758714	R	E	657	672
PSM	AIVQVFEGTSGIDSQK	2306	tr|Q91YH6|Q91YH6_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2914.21	46.38442	2	1677.851847	1677.857366	K	T	88	104
PSM	QATLGAGLPISTPCTTVNK	2307	sp|Q8QZT1|THIL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	14-UNIMOD:4	ms_run[1]:scan=1.1.2925.21	46.6963	2	1928.002047	1928.003713	R	V	103	122
PSM	VRGDVGMAGVAIDTVEDTK	2308	sp|P16332|MUTA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2827.13	43.92272	3	1931.953271	1931.962241	R	I	151	170
PSM	EQGATVLCGGEVYVPEDPK	2309	sp|Q9JLJ2|AL9A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	8-UNIMOD:4	ms_run[1]:scan=1.1.2898.12	45.92563	3	2046.948071	2046.956822	K	L	348	367
PSM	YLGTQPEPDIVGLDSGHIR	2310	sp|P52196|THTR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2911.18	46.29847	3	2066.037071	2066.043269	R	G	188	207
PSM	HCVSAGEPINPEVMEQWR	2311	sp|Q3UNX5|ACSM3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	2-UNIMOD:4	ms_run[1]:scan=1.1.2888.18	45.65232	3	2137.962971	2137.967344	K	K	342	360
PSM	AIVICGANDNFCAGADIHGFK	2312	sp|Q9DBM2|ECHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	5-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.2961.18	47.69637	3	2249.030471	2249.035758	R	S	47	68
PSM	HNDDEQYAWESSAGGSFTVR	2313	sp|P07901|HS90A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2802.19	43.21815	3	2254.947371	2254.951553	K	T	154	174
PSM	NQALNTDNYGHDLASVQALQR	2314	sp|P16546|SPTN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2799.18	43.13173	3	2327.126771	2327.125435	K	K	1253	1274
PSM	DLTDYLMK	2315	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3176.2	53.70498	2	997.473647	997.479034	R	I	184	192
PSM	VVFIFGPDK	2316	sp|O08709|PRDX6_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3049.3	50.12565	2	1020.556047	1020.564418	R	K	133	142
PSM	RFGLEGCEVLIPALK	2317	sp|Q60597|ODO1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	7-UNIMOD:4	ms_run[1]:scan=1.1.3189.5	54.06507	3	1700.920571	1700.928363	K	T	277	292
PSM	VDGMDILCVR	2318	sp|P35486|ODPA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	8-UNIMOD:4	ms_run[1]:scan=1.1.3043.7	49.95698	2	1176.555847	1176.563115	R	E	254	264
PSM	RFDEILEASDGIMVAR	2319	sp|P52480|KPYM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3191.3	54.11907	3	1820.905571	1820.909084	R	G	279	295
PSM	IIQLLDDYPK	2320	sp|P14869|RLA0_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3023.4	49.39458	2	1216.660647	1216.670340	K	C	17	27
PSM	VVDLMAYMASK	2321	tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3193.6	54.17827	2	1226.598047	1226.603917	R	E	322	333
PSM	TDGLVSLLTTSK	2322	sp|Q9R0N0|GALK1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3137.5	52.60817	2	1233.669847	1233.681633	R	D	69	81
PSM	TDIANLAEEFK	2323	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3118.7	52.06975	2	1249.611247	1249.619033	R	D	313	324
PSM	VFFDVDIGGER	2324	sp|Q9CR16|PPID_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3191.6	54.12157	2	1252.604247	1252.608802	R	V	18	29
PSM	QLLCDLVGISR	2325	sp|Q99K67|AASS_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	4-UNIMOD:4	ms_run[1]:scan=1.1.3166.11	53.4328	2	1272.677047	1272.686007	K	S	762	773
PSM	LPPSYDLAPFR	2326	sp|Q9D826|SOX_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3026.9	49.47755	2	1274.655447	1274.665923	K	M	368	379
PSM	LPPSYDLAPFR	2327	sp|Q9D826|SOX_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3019.7	49.29178	2	1274.655447	1274.665923	K	M	368	379
PSM	MALDIEIATYR	2328	sp|P15331|PERI_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3176.8	53.70998	2	1294.653447	1294.659123	K	K	391	402
PSM	DSVVAGFQWATK	2329	sp|P58252|EF2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3126.8	52.29785	2	1307.643847	1307.651001	K	E	677	689
PSM	IFNSGADLSGITEENAPLK	2330	sp|Q00898|A1AT5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3090.16	51.30215	3	1974.984371	1974.989836	R	L	329	348
PSM	GPILMELQTYR	2331	sp|P35486|ODPA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3084.14	51.12938	2	1319.682447	1319.690758	K	Y	278	289
PSM	LYCIYVAIGQK	2332	sp|Q03265|ATPA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	3-UNIMOD:4	ms_run[1]:scan=1.1.3012.7	49.10525	2	1326.688847	1326.700594	K	R	242	253
PSM	LAGQIFLGGSIVR	2333	sp|P17563|SBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3126.9	52.29868	2	1329.768447	1329.776871	R	G	345	358
PSM	TLTIVDTGIGMTK	2334	sp|P07901|HS90A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3006.13	48.94088	2	1348.718647	1348.727203	R	A	88	101
PSM	DQSPASHEIATNLGDFALR	2335	sp|Q00897|A1AT4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3103.8	51.65515	3	2040.992771	2040.986482	K	L	36	55
PSM	AVATLQGEGLSVTGIVCHVGK	2336	sp|Q99LB2|DHRS4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	17-UNIMOD:4	ms_run[1]:scan=1.1.3035.17	49.73563	3	2095.100471	2095.109575	R	A	73	94
PSM	CDVIAQGIVMAVK	2337	sp|Q9Z2I9|SUCB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	1-UNIMOD:4	ms_run[1]:scan=1.1.3123.14	52.21732	2	1402.720247	1402.731243	R	D	384	397
PSM	AVAQAGTVGTLLIVK	2338	sp|Q8VC30|TKFC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3006.16	48.9434	2	1439.861847	1439.871165	R	N	95	110
PSM	LVAYYTLIGASGQR	2339	sp|P01027|CO3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3069.18	50.70382	2	1510.804447	1510.814378	R	E	531	545
PSM	VVLDDKDYFLFR	2340	sp|Q64433|CH10_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3164.4	53.37207	3	1528.786571	1528.792580	K	D	81	93
PSM	DAALMVTNDGATILK	2341	sp|P80314|TCPB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3089.16	51.27355	2	1531.783447	1531.791594	R	N	58	73
PSM	SVIGMGTGAGAYILTR	2342	sp|Q62433|NDRG1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3124.18	52.24915	2	1565.811247	1565.823563	K	F	133	149
PSM	TIQNLASIQSFQIK	2343	sp|Q91XE0|GLYAT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3151.15	53.02002	2	1589.871647	1589.877707	K	H	114	128
PSM	IIPGFMCQGGDFTR	2344	sp|P17742|PPIA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	7-UNIMOD:4	ms_run[1]:scan=1.1.3091.6	51.32227	3	1597.733771	1597.738119	R	H	56	70
PSM	GGSVQVLEDQELTCQPEPLVVK	2345	sp|P17563|SBP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	14-UNIMOD:4	ms_run[1]:scan=1.1.3188.15	54.04587	3	2424.212471	2424.220641	R	G	358	380
PSM	WGLGGTCVNVGCIPK	2346	sp|Q9JLT4|TRXR2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	7-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.3087.16	51.2167	2	1616.777847	1616.780318	K	K	80	95
PSM	SQQEGGILPLLDSPAK	2347	sp|Q6ZQM8|UD17C_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3165.18	53.41118	2	1651.872847	1651.878101	K	G	100	116
PSM	TIILYDTNLPDVSAK	2348	sp|P97328|KHK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3198.19	54.33282	2	1661.882247	1661.887603	R	D	109	124
PSM	TQEFILNSPTVTSIK	2349	sp|Q9R0H0|ACOX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3020.14	49.32203	2	1676.889847	1676.898502	K	W	160	175
PSM	HSGNITFDEIVNIAR	2350	sp|P35979|RL12_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3115.6	51.9845	3	1684.842671	1684.853283	K	Q	100	115
PSM	SAVYPTSAVQMEAALR	2351	sp|Q9D6Y7|MSRA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3003.18	48.86102	2	1692.842847	1692.850506	R	S	157	173
PSM	VTGTQFPEAPLPVPCNPNDVSHGYVTVKPGIR	2352	sp|P34914|HYES_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	15-UNIMOD:4	ms_run[1]:scan=1.1.3072.20	50.79068	4	3445.748094	3445.745260	K	L	216	248
PSM	GQNILDGGAPFYTTYK	2353	sp|O09174|AMACR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3129.20	52.3933	2	1743.836647	1743.846801	R	T	208	224
PSM	LISWYDNEYGYSNR	2354	tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3028.18	49.53975	2	1778.780647	1778.790014	K	V	308	322
PSM	FLTTVSMEQPEMLEK	2355	sp|Q9DCM2|GSTK1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3112.17	51.91245	2	1781.854047	1781.857959	R	V	102	117
PSM	AEEYEFLTPMEEAPK	2356	sp|Q99PT1|GDIR1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3161.9	53.30423	2	1782.798447	1782.802218	R	G	153	168
PSM	QNPDIPQLEPSDYLR	2357	sp|Q9DBM2|ECHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3179.19	53.80197	2	1783.866647	1783.874078	R	R	680	695
PSM	VYAILTHGIFSGPAISR	2358	tr|G3UXL2|G3UXL2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3136.10	52.5837	3	1800.977471	1800.988654	R	I	244	261
PSM	LDTHPAMVTVLEMGAAR	2359	sp|Q9CQN1|TRAP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3078.10	50.95263	3	1810.903271	1810.906975	R	H	605	622
PSM	GSRVEIEAIAVQGPFIK	2360	sp|P52760|RIDA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3047.9	50.07355	3	1812.996371	1813.009784	R	A	118	135
PSM	HNQLPLVIEFTEQTAPK	2361	sp|P09103|PDIA1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3155.8	53.13018	3	1964.031971	1964.036727	K	I	233	250
PSM	RPWLVDYGESGEQVAGFVK	2362	sp|P16675|PPGB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3150.16	52.99173	3	2136.051671	2136.064004	R	E	418	437
PSM	GNDQVRFELTCYSLAPQIK	2363	sp|P16460|ASSY_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	11-UNIMOD:4	ms_run[1]:scan=1.1.3141.15	52.73135	3	2238.103871	2238.110303	K	V	122	141
PSM	AFQFVETHGEVCPANWTPESPTIK	2364	sp|P20108|PRDX3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	12-UNIMOD:4	ms_run[1]:scan=1.1.3148.20	52.93707	3	2744.285471	2744.290452	K	P	219	243
PSM	TFPTVNPSTGEVICQVAEGNKEDVDK	2365	sp|P47738|ALDH2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	14-UNIMOD:4	ms_run[1]:scan=1.1.3027.20	49.51405	3	2833.335971	2833.344004	K	A	55	81
PSM	LQVEHTVTEEITDVDLVHAQIHVSEGR	2366	sp|Q05920|PYC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3039.9	49.84378	5	3053.552118	3053.541792	R	S	329	356
PSM	DLEDLQILIK	2367	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3550.3	64.19077	2	1198.674447	1198.680905	K	V	578	588
PSM	LASDLLEWIR	2368	sp|P57780|ACTN4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3584.2	65.14658	2	1214.661247	1214.665923	R	R	302	312
PSM	LLVPYLIEAVR	2369	sp|Q61425|HCDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3578.4	64.98417	2	1284.776247	1284.780559	R	L	222	233
PSM	FVFSLVDAMNGK	2370	sp|P08249|MDHM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3461.6	61.66932	2	1326.656247	1326.664209	R	E	258	270
PSM	DDGSAVIWVTFR	2371	sp|Q9CQI6|COTL1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3568.10	64.70713	2	1364.674247	1364.672465	R	Y	19	31
PSM	GTIEILSDVQLIK	2372	sp|P14869|RLA0_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3446.9	61.25243	2	1427.815847	1427.823546	R	T	150	163
PSM	VALTGLTVAEYFR	2373	sp|P56480|ATPB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3449.12	61.33928	2	1438.770047	1438.782016	R	D	282	295
PSM	VVGVPVALDLITSGR	2374	sp|Q9DBM2|ECHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3565.9	64.6221	2	1494.874047	1494.876979	R	H	140	155
PSM	GGQQLVFNFYSFK	2375	sp|G5E8K5|ANK3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3439.5	61.0656	2	1533.766847	1533.761615	K	E	1380	1393
PSM	LDQLIYIPLPDEK	2376	sp|Q01853|TERA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3517.12	63.24875	2	1555.842447	1555.849761	R	S	639	652
PSM	LLGQFTLIGIPPAPR	2377	sp|P38647|GRP75_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3640.11	66.76152	2	1591.939847	1591.944999	K	G	499	514
PSM	LLGQFTLIGIPPAPR	2378	sp|P38647|GRP75_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3622.12	66.23362	2	1591.939847	1591.944999	K	G	499	514
PSM	EIVLADVIDNDSWR	2379	sp|Q9DCL9|PUR6_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3549.15	64.17226	2	1643.808647	1643.815501	K	L	202	216
PSM	PWEPTFLSMDVDGR	2380	sp|Q9WVM8|AADAT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3499.16	62.75422	2	1648.749247	1648.755543	K	V	241	255
PSM	VSILIGASQDLIPQLK	2381	sp|O88587|COMT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3607.19	65.80624	2	1693.993047	1693.997822	K	K	155	171
PSM	YWLQNPGELQRPSFSAMPVLANPAATAACCR	2382	sp|Q91XE4|ACY3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	29-UNIMOD:4,30-UNIMOD:4	ms_run[1]:scan=1.1.3498.21	62.72968	4	3475.665294	3475.658771	R	Y	33	64
PSM	DAFQNAYLELGGLGER	2383	sp|Q8VDN2|AT1A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3583.8	65.13194	2	1751.841847	1751.847863	K	V	536	552
PSM	QGLLPLTFADPSDYNK	2384	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3502.11	62.8354	2	1777.887847	1777.888666	K	I	702	718
PSM	EIGLLTEEVELYGETK	2385	sp|Q922D8|C1TC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3476.19	62.0946	2	1821.919447	1821.924776	R	A	337	353
PSM	SWIEEQEMGSFLSVAK	2386	sp|Q9CPY7|AMPL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3537.21	63.83242	2	1839.869047	1839.871301	K	G	238	254
PSM	SLRPGVAIADFVIFPPR	2387	sp|O09173|HGD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3508.4	62.98995	3	1854.036671	1854.051589	K	W	305	322
PSM	ISVGSDADLVIWDPDSVK	2388	sp|O08553|DPYL2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3502.12	62.83708	2	1914.952647	1914.957474	R	T	401	419
PSM	YFDSFGDLSSASAIMGNAK	2389	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3516.21	63.22758	2	1979.896247	1979.893493	R	V	42	61
PSM	SVSAFAPICNPVLCSWGK	2390	sp|Q9R0P3|ESTD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	9-UNIMOD:4,14-UNIMOD:4	ms_run[1]:scan=1.1.3512.21	63.11372	2	1991.957447	1991.959739	R	K	168	186
PSM	AIMTYVSSFYHAFSGAQK	2391	sp|P57780|ACTN4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3448.9	61.30835	3	2006.945471	2006.956034	K	A	257	275
PSM	AIMTYVSSFYHAFSGAQK	2392	sp|P57780|ACTN4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3447.10	61.28113	3	2006.945471	2006.956034	K	A	257	275
PSM	KEDLVFIFWAPENAPLK	2393	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3644.6	66.865	3	2016.064871	2016.072050	K	S	96	113
PSM	NQAGYFMLPTVITDIKDESR	2394	sp|Q8BH00|AL8A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3520.15	63.33778	3	2297.133071	2297.136183	R	C	367	387
PSM	AYGAGLLSSFGELQYCLSDKPK	2395	sp|P16331|PH4H_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	16-UNIMOD:4	ms_run[1]:scan=1.1.3473.17	62.00802	3	2403.173771	2403.178048	K	L	342	364
PSM	ENTEGEYSGIEHVIVDGVVQSIK	2396	sp|Q9D6R2|IDH3A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3566.16	64.65597	3	2501.231471	2501.228563	R	L	147	170
PSM	YCVGDEVSMADVCLVPQVANAER	2397	sp|Q9WVL0|MAAI_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	2-UNIMOD:4,13-UNIMOD:4	ms_run[1]:scan=1.1.3469.11	61.89445	3	2581.162271	2581.161095	K	F	153	176
PSM	IVGCTHITAQTAVLMETLGALGAQCR	2398	sp|Q68FL4|SAHH3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	4-UNIMOD:4,25-UNIMOD:4	ms_run[1]:scan=1.1.3619.20	66.15446	3	2770.394771	2770.392826	K	W	231	257
PSM	EVEEIDRYLEDQVNTDLPYEIER	2399	sp|Q9Z2V4|PCKGC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3541.19	63.94713	3	2866.353971	2866.350863	K	E	588	611
PSM	LNCPVAPTLFLEFHGSQQTLAEQLQR	2400	sp|Q7TNG8|LDHD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	3-UNIMOD:4	ms_run[1]:scan=1.1.3532.21	63.68863	3	2996.523971	2996.517826	K	T	293	319
PSM	DHLVPDPGCQYDQVIEINLNELKPHINGPFTPDLAHPVADVGTVAEK	2401	sp|Q99KI0|ACON_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	20	9-UNIMOD:4	ms_run[1]:scan=1.1.3638.12	66.70188	6	5171.5932	5171.5662	K	E	324	371
PSM	ETAFEFLSSA	2402	sp|P14152|MDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3656.4	67.2038	2	1100.497447	1100.502606	K	-	325	335
PSM	DIFQEIFDK	2403	sp|P54071|IDHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3706.4	68.6071	2	1153.559847	1153.565540	K	H	264	273
PSM	LGLMEMIAFAK	2404	sp|P13707|GPDA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3677.5	67.78723	2	1222.639447	1222.645388	R	L	230	241
PSM	AILFLPLPVSSD	2405	sp|P61148|FGF1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3917.2	74.49728	2	1270.712447	1270.717290	K	-	144	156
PSM	ALGVLAQLIWSR	2406	sp|Q9CZU6|CISY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3730.3	69.26804	2	1325.774647	1325.781956	R	A	429	441
PSM	GVMLAVDAVIAELK	2407	sp|P63038|CH60_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3799.11	71.22615	2	1427.799247	1427.805788	R	K	143	157
PSM	ESYVETELIFALAK	2408	sp|Q68FD5|CLH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3722.2	69.052	2	1611.829047	1611.839590	R	T	1166	1180
PSM	EAETFPFNPFDLTK	2409	sp|P24270|CATA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3746.13	69.72781	2	1654.786647	1654.787889	K	V	288	302
PSM	LVLLELNFLPTTGTK	2410	sp|Q9CX56|PSMD8_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3769.16	70.39114	2	1657.961447	1657.965459	K	L	124	139
PSM	EFADSLGIPFLETSAK	2411	sp|P62821|RAB1A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3727.9	69.1947	2	1723.862447	1723.866868	K	N	141	157
PSM	GRDLAILLGMLDPVEK	2412	sp|O08709|PRDX6_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3700.3	68.43925	3	1738.959071	1738.965142	K	D	107	123
PSM	KLEGDSTDLSDQIAELQAQIAELK	2413	sp|Q8VDD5|MYH9_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3764.16	70.24635	3	2614.337771	2614.333757	R	M	1052	1076
PSM	AQLGVQAFADALLIIPK	2414	sp|P80317|TCPZ_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3833.11	72.17406	2	1767.027647	1767.029457	R	V	433	450
PSM	VAVLGASGGIGQPLSLLLK	2415	sp|P08249|MDHM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3749.20	69.81748	2	1792.081847	1792.082221	K	N	27	46
PSM	ADDPSSYMEVVQAANASGNWEELVK	2416	sp|Q68FD5|CLH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3753.21	69.93307	3	2709.222071	2709.222826	K	Y	1131	1156
PSM	DAQVVQVVLDGLSNILK	2417	sp|O35343|IMA3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3991.2	76.08248	3	1810.014971	1810.020014	K	M	424	441
PSM	GQMEAIPCVVGDEEVWTSDIQYQLSPFNHAHK	2418	sp|Q8CHT0|AL4A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	8-UNIMOD:4	ms_run[1]:scan=1.1.3659.17	67.29695	4	3684.710094	3684.697718	K	V	58	90
PSM	IQEGVESLAGYADIFLR	2419	sp|Q99MN9|PCCB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3782.13	70.76152	2	1879.959047	1879.967979	R	N	168	185
PSM	DLPITEAVFSALVTGHAR	2420	sp|Q6PB66|LPPRC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3782.3	70.74983	3	1896.004271	1896.010512	K	A	226	244
PSM	IAALQAFADQLIAVDHYAK	2421	sp|P16546|SPTN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3690.4	68.16195	3	2057.091971	2057.094576	K	G	1501	1520
PSM	ALINADELANDVAGAEALLDR	2422	sp|P16546|SPTN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3826.7	71.96964	3	2153.092271	2153.096427	K	H	382	403
PSM	NTTPDELLSAVLTAVLQDVR	2423	sp|Q921H8|THIKA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.4148.2	77.91672	3	2154.153071	2154.153213	K	L	58	78
PSM	DFNDTSQDPDFTQVVELDLK	2424	sp|P28271|ACOC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3732.10	69.3298	3	2325.067571	2325.064852	R	T	345	365
PSM	AEGSDVANAVLDGADCIMLSGETAK	2425	sp|P52480|KPYM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	16-UNIMOD:4	ms_run[1]:scan=1.1.3664.9	67.43124	3	2493.123071	2493.136319	R	G	343	368
PSM	LPDSVTFEEGALIEPLSVGIYACR	2426	sp|Q64442|DHSO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	23-UNIMOD:4	ms_run[1]:scan=1.1.3796.14	71.1445	3	2635.321271	2635.320355	K	R	143	167
PSM	ALDLFSDNAPPPELLEIINEDIAK	2427	sp|Q922R8|PDIA6_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3891.7	73.7864	3	2636.355371	2636.358515	R	K	265	289
PSM	VLLSICSLLCDPNPDDPLVPEIAR	2428	sp|P61079|UB2D3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	6-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.3841.11	72.39629	3	2705.378771	2705.376825	K	I	102	126
PSM	NLSDLIDLVPSLCEDLLSSVDQPLK	2429	sp|P47757|CAPZB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	13-UNIMOD:4	ms_run[1]:scan=1.1.4006.4	76.3438	3	2782.435571	2782.431028	K	I	24	49
PSM	LPIPDSQVLTINPALPVEDAAEDYAR	2430	sp|Q9CQ60|6PGL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3765.18	70.27708	3	2806.436171	2806.438890	K	K	103	129
PSM	TALLDAAGVASLLTTAEAVVTEIPKEEK	2431	sp|P63038|CH60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3914.3	74.42083	3	2839.551671	2839.543021	R	D	527	555
PSM	VEPDVAEVVGYQWLSPSEATECFLSK	2432	sp|P11930|NUD19_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	22-UNIMOD:4	ms_run[1]:scan=1.1.3804.11	71.37278	3	2939.392871	2939.389892	R	E	206	232
PSM	LLDVPILLTEQYPEGLGPTVPELGAQGIRPVSK	2433	sp|P85094|ISC2A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3768.12	70.35892	4	3498.940494	3498.933772	R	T	50	83
PSM	HFSVEGQLEFR	2434	sp|P07901|HS90A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	20		ms_run[1]:scan=1.1.2661.2	39.25072	3	1348.6742	1347.6562	K	A	329	340
PSM	KSQVFSTAADGQTQVEIK	2435	sp|P38647|GRP75_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2360.20	30.91998	3	1936.980071	1935.990171	K	V	468	486
PSM	VALVYGQMNEPPGAR	2436	sp|P56480|ATPB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2698.20	40.2938	2	1601.797847	1600.803162	K	A	265	280
PSM	ARPFPDGLAEDIDKGEVSAR	2437	sp|P58252|EF2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	20		ms_run[1]:scan=1.1.2754.19	41.86508	3	2142.0542	2142.0702	K	Q	606	626
PSM	VMVAEALDISR	2438	sp|Q9Z2I8|SUCB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2866.12	45.02942	2	1202.624047	1202.632909	K	E	141	152
PSM	GAPTTSLVSVAVTK	2439	sp|Q9DBF1|AL7A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2654.18	39.07463	2	1329.741847	1329.750381	K	I	219	233
PSM	ETVTVLPGASFFSSDESFAMIR	2440	sp|Q9D0K2|SCOT1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3793.10	71.05655	3	2389.132271	2390.146413	K	G	369	391
PSM	QGLLGINIAEK	2441	sp|P51174|ACADL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:28	ms_run[1]:scan=1.1.3536.5	63.79015	2	1137.6295	1137.6388	K	H	96	107
PSM	VTNGAFTGEISPGMIK	2442	sp|P17751|TPIS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3009.12	49.02455	2	1620.806047	1620.818143	K	D	120	136
PSM	CYEMASHLR	2443	sp|P62962|PROF1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.2688.9	40.0044	2	1148.4661	1148.4738	K	R	128	137
PSM	CLEEVEDLIVK	2444	sp|P61922|GABT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.3911.4	74.32445	2	1328.6457	1328.6528	R	Y	269	280
PSM	FLASVSTVLTSK	2445	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3010.4	49.04653	2	1251.696047	1251.707454	K	Y	129	141
PSM	MSIFGHSMGGHGALICALK	2446	sp|Q9R0P3|ESTD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	16-UNIMOD:4	ms_run[1]:scan=1.1.2897.12	45.89787	3	1986.970271	1985.963779	R	N	143	162
PSM	ASASYHISNLLEK	2447	sp|Q6ZQ38|CAND1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1	ms_run[1]:scan=1.1.2950.15	47.38668	2	1473.7352	1473.7462	M	M	2	15
PSM	GLQVHVVVDACSSR	2448	sp|P85094|ISC2A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	11-UNIMOD:4	ms_run[1]:scan=1.1.2372.7	31.23815	3	1525.754771	1525.767111	R	S	126	140
PSM	QSGAFLATSESLILQLVR	2449	sp|P85094|ISC2A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:28	ms_run[1]:scan=1.1.4102.3	77.4937	2	1915.0416	1915.0410	R	D	153	171
PSM	EPVPDSGLLSLFQGQSPLTSC	2450	sp|P85094|ISC2A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	21-UNIMOD:4	ms_run[1]:scan=1.1.3923.3	74.63467	3	2231.093471	2231.078000	K	-	186	207
PSM	SIVNNGHSFNVEFDDSQDNAVLK	2451	sp|P00920|CAH2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3118.20	52.0806	3	2549.161871	2548.183010	K	G	58	81
PSM	LLIIGDSGVGK	2452	sp|Q6PHN9|RAB35_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2849.9	44.53978	2	1070.624647	1070.633560	K	S	11	22
PSM	QLCSQQDLDMLPWVQEFNK	2453	sp|Q9QXN5|MIOX_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:28,3-UNIMOD:4	ms_run[1]:scan=1.1.3902.3	74.07193	3	2361.0754	2361.0764	R	F	233	252
PSM	VNIDGGAIALGHPLGASGCR	2454	sp|Q8CAY6|THIC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	19-UNIMOD:4	ms_run[1]:scan=1.1.2771.15	42.3379	3	1933.970471	1933.979229	K	I	342	362
PSM	CEAVIADILDK	2455	sp|P51660|DHB4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.3867.2	73.11725	2	1228.5931	1228.6004	K	G	424	435
PSM	QIQELVEAIVLPMNHK	2456	sp|O88685|PRS6A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:28	ms_run[1]:scan=1.1.3906.3	74.19742	2	1843.9819	1843.9861	K	E	197	213
PSM	QHVPLDEYSANLR	2457	sp|Q9DB29|IAH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:28	ms_run[1]:scan=1.1.2843.18	44.37888	2	1523.7303	1523.7363	K	D	100	113
PSM	LVAIVDVIDQNR	2458	sp|Q9CR57|RL14_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3193.10	54.1816	2	1353.753047	1353.761615	K	A	24	36
PSM	CMQLTDFILK	2459	sp|Q9CR57|RL14_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.3900.2	74.01398	2	1250.5957	1250.6034	K	F	54	64
PSM	IDFVGELNDK	2460	sp|Q11011|PSA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2852.8	44.62462	2	1148.569047	1148.571354	K	M	147	157
PSM	NQNINLENSLGDVEAR	2461	sp|P05784|K1C18_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2849.12	44.54228	3	1784.868971	1784.865304	K	Y	308	324
PSM	SDKPDMAEIEK	2462	sp|P20065-2|TYB4-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1	ms_run[1]:scan=1.1.2316.21	29.71245	2	1303.5870	1303.5961	M	F	2	13
PSM	FDYTVTNLAGGPK	2463	sp|Q8BP40|PPA6_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2861.16	44.88943	2	1381.683247	1381.687781	R	P	82	95
PSM	LVILANNCPALR	2464	sp|P62889|RL30_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	8-UNIMOD:4	ms_run[1]:scan=1.1.2827.14	43.92355	2	1353.750647	1352.759841	K	K	45	57
PSM	SHTILLVQPTK	2465	sp|P84089|ERH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1	ms_run[1]:scan=1.1.2693.10	40.1433	2	1277.7259	1277.7338	M	R	2	13
PSM	VVTDTDETELAR	2466	sp|Q6ZWX6|IF2A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2225.21	27.20365	2	1348.653247	1347.651789	K	Q	277	289
PSM	EVGVGFATR	2467	sp|P04117|FABP4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2301.10	29.28937	2	933.485647	934.487231	K	K	23	32
PSM	GYENGNFVGPTIISNVKPSMTCYK	2468	sp|Q9EQ20|MMSA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	22-UNIMOD:4	ms_run[1]:scan=1.1.3138.20	52.64938	3	2676.252071	2675.272359	K	E	392	416
PSM	VAVLGASGGIGQPLSLLLK	2469	sp|P08249|MDHM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3742.17	69.62088	2	1795.090647	1792.082221	K	N	27	46
PSM	EVLLVPGNGFFIDGSAPTSFFR	2470	sp|Q9WVM8|AADAT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3853.9	72.73322	3	2370.185771	2369.205583	R	A	378	400
PSM	AEVGVIAK	2471	sp|Q9JME5|AP3B2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1639.10	10.89768	2	785.464847	785.464704	K	A	335	343
PSM	HQGVMVGMGQK	2472	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	5-UNIMOD:35	ms_run[1]:scan=1.1.1768.11	14.476	3	1186.546871	1186.558698	R	D	40	51
PSM	LAGESESNLRK	2473	sp|Q01853|TERA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1742.9	13.74787	3	1202.614271	1202.625515	K	A	278	289
PSM	RMGHAGAIIAGGK	2474	sp|Q9WUM5|SUCA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1749.11	13.94193	3	1237.659671	1237.671360	R	G	296	309
PSM	GAGHMVPTDKPR	2475	sp|P16675|PPGB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1694.13	12.43283	3	1264.623071	1264.634640	K	A	448	460
PSM	MAEHSHCSLGIK	2476	sp|Q8K0L3|ACSM2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	7-UNIMOD:4	ms_run[1]:scan=1.1.1765.16	14.3964	3	1368.615971	1368.627840	K	A	230	242
PSM	RQVEIAQR	2477	sp|P16460|ASSY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1699.15	12.57288	2	998.553647	998.562127	R	E	101	109
PSM	RQVEIAQR	2478	sp|P16460|ASSY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1693.18	12.40875	2	998.553647	998.562127	R	E	101	109
PSM	THTTVSGVAHR	2479	sp|Q99MN9|PCCB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1620.21	10.38762	2	1164.590247	1164.599969	K	A	251	262
PSM	VEYTEEERK	2480	sp|P16331|PH4H_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1696.21	12.49595	2	1181.546647	1181.556432	R	T	177	186
PSM	PASPGADETQGTK	2481	sp|A2ARV4|LRP2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1684.20	12.15622	2	1257.575647	1257.583710	K	W	4575	4588
PSM	PNMVTAGHACTK	2482	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	10-UNIMOD:4	ms_run[1]:scan=1.1.1733.12	13.50002	3	1285.578371	1285.590726	K	K	231	243
PSM	RDHALLEEQSK	2483	sp|P57780|ACTN4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1720.19	13.1483	2	1324.663447	1324.673528	K	Q	634	645
PSM	TATPQQAQEVHEK	2484	sp|P17751|TPIS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1708.21	12.82615	2	1465.705847	1465.716121	K	L	226	239
PSM	DLIHDQDEEEEEEEGQR	2485	sp|Q9CZ44|NSF1C_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2311.20	29.5719	3	2098.851371	2098.856316	R	F	77	94
PSM	VVAGVAAALAHK	2486	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2263.4	28.23107	3	1105.649771	1105.660778	K	Y	134	146
PSM	VAGILTVK	2487	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2335.2	30.22685	2	799.509047	799.516740	K	G	251	259
PSM	ASDETGFIAVHK	2488	sp|P34914|HYES_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2189.12	26.20358	3	1273.620371	1273.630266	R	A	409	421
PSM	GAVDGGLSIPHSTK	2489	sp|P47962|RL5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2237.10	27.51995	3	1337.682671	1337.693929	K	R	165	179
PSM	ADEGISFR	2490	sp|P35700|PRDX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2268.9	28.37358	2	893.415647	893.424296	K	G	121	129
PSM	ADEGISFR	2491	sp|P35700|PRDX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2261.9	28.1798	2	893.415647	893.424296	K	G	121	129
PSM	FDSQTVLK	2492	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2245.11	27.7415	2	936.485847	936.491647	K	V	292	300
PSM	ANIIYPGHGPVIHNAEAK	2493	sp|Q99KR3|LACB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2219.15	27.03277	4	1899.988094	1899.995531	K	I	192	210
PSM	MLEIDPQK	2494	sp|Q8QZT1|THIL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2352.11	30.69745	2	972.486247	972.495018	K	V	363	371
PSM	VTLVSAAPEK	2495	sp|Q9CQR4|ACO13_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2179.13	25.9211	2	1013.568047	1013.575711	K	L	28	38
PSM	LVLVGDGGTGK	2496	sp|P62827|RAN_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2304.11	29.3732	2	1014.562047	1014.570960	K	T	13	24
PSM	NTYYASIAK	2497	sp|P45952|ACADM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2173.18	25.75955	2	1029.504447	1029.513111	R	A	350	359
PSM	LDGNQDLIR	2498	sp|P54071|IDHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2251.14	27.9114	2	1042.531247	1042.540723	K	F	385	394
PSM	HVLNQDLTFQHIK	2499	sp|Q3UFF7|LYPL1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2343.16	30.4535	3	1591.833371	1591.847076	K	I	44	57
PSM	LRVDPVNFK	2500	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2361.2	30.93197	3	1086.610871	1086.618579	K	L	92	101
PSM	LRVDPVNFK	2501	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2353.5	30.72268	2	1086.611247	1086.618579	K	L	92	101
PSM	FADLSEAANR	2502	sp|P20152|VIME_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2297.12	29.17718	2	1092.511647	1092.519987	K	N	295	305
PSM	LHIVQVVCK	2503	sp|Q9Z1Q5|CLIC1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	8-UNIMOD:4	ms_run[1]:scan=1.1.2200.15	26.51548	2	1094.619447	1094.627036	K	K	184	193
PSM	GLCGTVLIHK	2504	sp|Q8VC30|TKFC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	3-UNIMOD:4	ms_run[1]:scan=1.1.2223.15	27.1432	2	1096.599647	1096.606300	R	V	153	163
PSM	LHVDPENFR	2505	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2281.2	28.73042	3	1125.547571	1125.556707	K	L	97	106
PSM	GYSFTTTAER	2506	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2246.16	27.7738	2	1131.514047	1131.519653	R	E	197	207
PSM	DVNQQEFVR	2507	sp|Q9CZX8|RS19_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2261.17	28.18648	2	1133.537847	1133.546536	K	A	8	17
PSM	LAAIQESGVER	2508	sp|Q60692|PSB6_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2186.16	26.12138	2	1171.612247	1171.619701	R	Q	209	220
PSM	QHGIPIPVTPK	2509	sp|P16460|ASSY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2315.4	29.67023	3	1185.676271	1185.686993	K	S	166	177
PSM	HIYFITGETK	2510	sp|P07901|HS90A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2348.15	30.59128	2	1207.615647	1207.623724	K	D	491	501
PSM	NQFTVAQYEK	2511	sp|Q3UZZ6|ST1D1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2349.20	30.62303	2	1226.585447	1226.593152	K	F	266	276
PSM	EELGAQQPDLK	2512	sp|Q64105|SPRE_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2226.18	27.2291	2	1226.606247	1226.614282	K	V	53	64
PSM	GGGHVAQIYAIR	2513	sp|P14131|RS16_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2178.19	25.89848	2	1240.657847	1240.667655	K	Q	74	86
PSM	TEGGYYQITGR	2514	sp|Q99NB1|ACS2L_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2312.16	29.59637	2	1243.574447	1243.583316	R	M	531	542
PSM	TEGGYYQITGR	2515	sp|Q99NB1|ACS2L_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2318.17	29.76542	2	1243.574447	1243.583316	R	M	531	542
PSM	YVGSMVADIHR	2516	sp|Q9QXD6|F16P1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2311.7	29.56105	3	1246.602971	1246.612842	R	T	245	256
PSM	RTIAQDYGVLK	2517	sp|P35700|PRDX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2296.17	29.15287	2	1262.690247	1262.698286	K	A	110	121
PSM	ETAEADVASLNR	2518	tr|E9Q453|E9Q453_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2278.18	28.66113	2	1274.603247	1274.610259	R	R	43	55
PSM	VNADEVGGEALGR	2519	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2378.19	31.41448	2	1285.621247	1285.626243	K	L	19	32
PSM	RSGSDWILNGSK	2520	sp|P51174|ACADL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2270.20	28.43815	2	1318.655647	1318.662963	K	V	190	202
PSM	YLIANATNPESK	2521	sp|P68254|1433T_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2320.18	29.82228	2	1319.663647	1319.672131	K	V	104	116
PSM	YLIANATNPESK	2522	sp|P68254|1433T_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2326.20	29.99242	2	1319.663647	1319.672131	K	V	104	116
PSM	TLIQNCGASTIR	2523	sp|P80318|TCPG_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	6-UNIMOD:4	ms_run[1]:scan=1.1.2263.19	28.24358	2	1332.673847	1332.681984	R	L	450	462
PSM	LGTVADCGVPEAR	2524	sp|Q8BWF0|SSDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	7-UNIMOD:4	ms_run[1]:scan=1.1.2320.19	29.82312	2	1343.641047	1343.650350	K	A	75	88
PSM	AHSSMVGVNLPQK	2525	sp|P09411|PGK1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2180.21	25.9555	2	1366.693047	1366.702719	R	A	172	185
PSM	AVPREELFVTSK	2526	sp|Q9JII6|AK1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2350.10	30.6421	3	1374.742271	1374.750716	K	L	69	81
PSM	SEPIPESNEGPVK	2527	sp|P27773|PDIA3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2187.21	26.1542	2	1381.666847	1381.672525	K	V	367	380
PSM	YLAEFATGNDRK	2528	sp|P62259|1433E_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2193.21	26.32345	2	1383.670647	1383.678279	R	E	131	143
PSM	INEVQTDVSVDTK	2529	sp|Q91YR1|TWF1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2301.21	29.29855	2	1446.710447	1446.720203	K	H	159	172
PSM	STGSVVGQQPFGGAR	2530	sp|Q8CHT0|AL4A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2353.9	30.7302	2	1446.712047	1446.721541	K	A	509	524
PSM	FSTVTGESGSADTVR	2531	sp|P24270|CATA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2199.21	26.49312	2	1512.697847	1512.705616	R	D	113	128
PSM	IIAEGANGPTTPEADK	2532	sp|P26443|DHE3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2172.21	25.73347	2	1582.775247	1582.783866	K	I	400	416
PSM	IILLAEGR	2533	sp|P50247|SAHH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1000663, ProteinPilot, ]	19		ms_run[1]:scan=1.1.2588.4	37.22555	2	883.54024709566	883.5491022090698	R	L	336	344
PSM	VAIDLGYR	2534	sp|P45376|ALDR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2603.5	37.64298	2	905.489847	905.497067	K	H	34	42
PSM	LLEVIPSR	2535	sp|Q9DBM2|ECHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2638.5	38.61307	2	925.551847	925.559667	R	Y	437	445
PSM	ALAEGVLLR	2536	sp|P51855|GSHB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2630.6	38.38772	2	940.561247	940.570566	R	S	26	35
PSM	AFALDVINSAHER	2537	sp|Q91VM9|IPYR2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2713.9	40.71385	3	1441.719371	1441.731377	K	W	257	270
PSM	IGLFGGAGVGK	2538	sp|P56480|ATPB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2717.3	40.8243	2	974.545447	974.554916	K	T	202	213
PSM	DRATLGINDTLIR	2539	sp|Q8VCN5|CGL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2729.3	41.16258	3	1456.788671	1456.799791	K	L	362	375
PSM	SINRPMLQAAIALK	2540	sp|P34914|HYES_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2723.6	40.99903	3	1524.870071	1524.881018	R	K	100	114
PSM	NFNLPMCK	2541	sp|Q9D0K2|SCOT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	7-UNIMOD:4	ms_run[1]:scan=1.1.2624.10	38.2233	2	1022.459247	1022.467758	R	A	229	237
PSM	IEGRPGASLPPLNLK	2542	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2642.7	38.72812	3	1560.889571	1560.898777	R	E	974	989
PSM	YSVDIPLDK	2543	sp|P61358|RL27_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2751.5	41.7717	2	1048.537047	1048.544077	R	T	85	94
PSM	RIPQSTLSEFYPR	2544	sp|P62814|VATB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2705.8	40.48418	3	1592.822471	1592.831091	K	D	494	507
PSM	VNFTVDQIR	2545	sp|P58252|EF2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	19		ms_run[1]:scan=1.1.2635.10	38.53168	2	1090.5677	1090.5766	M	A	2	11
PSM	NPGAPFQIIR	2546	sp|Q60866|PTER_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2771.9	42.3329	2	1111.605447	1111.613828	R	I	205	215
PSM	LYQVEYAFK	2547	sp|Q9QUM9|PSA6_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2790.13	42.87455	2	1159.587047	1159.591361	R	A	22	31
PSM	VITSGFNALEK	2548	sp|Q9WVL0|MAAI_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2591.11	37.31642	2	1177.625047	1177.634289	K	I	134	145
PSM	VDATEESDLAQQYGVR	2549	sp|P09103|PDIA1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2782.16	42.6484	3	1779.814271	1779.827522	K	G	84	100
PSM	HLEINPDHPIVETLR	2550	sp|P11499|HS90B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2606.18	37.73852	3	1781.931971	1781.942433	K	Q	625	640
PSM	ITVTSEVPFSK	2551	sp|P67984|RL22_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2696.14	40.23163	2	1206.641247	1206.649604	K	R	70	81
PSM	ITVTSEVPFSK	2552	sp|P67984|RL22_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2690.12	40.06158	2	1206.641247	1206.649604	K	R	70	81
PSM	YNDIDLTIDK	2553	sp|P97494|GSH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2688.12	40.00692	2	1208.580647	1208.592484	K	E	343	353
PSM	VYNIEFNPPK	2554	sp|Q9WTP7|KAD3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2760.15	42.0297	2	1219.614447	1219.623724	R	T	137	147
PSM	VYNIEFNPPK	2555	sp|Q9WTP7|KAD3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2766.13	42.19565	2	1219.614447	1219.623724	R	T	137	147
PSM	HLGLPVFNTVK	2556	sp|Q9WUM5|SUCA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2739.14	41.44882	2	1223.694447	1223.702643	K	E	95	106
PSM	RPDPIDWSLK	2557	sp|Q9D964|GATM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2626.14	38.2827	2	1225.637847	1225.645522	R	Y	143	153
PSM	INFDDNAEFR	2558	sp|Q9Z2I8|SUCB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2670.13	39.50723	2	1239.545647	1239.552016	K	Q	261	271
PSM	LGGDLGTYVINK	2559	sp|O35943|FRDA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2772.11	42.36285	2	1248.660047	1248.671403	K	Q	133	145
PSM	MVVNEGADGGQSVYHIHLHVLGGR	2560	sp|P70349|HINT1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2690.16	40.06492	4	2544.268894	2544.265575	R	Q	96	120
PSM	LLVVDPETDER	2561	sp|P70441|NHRF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2615.14	37.97957	2	1284.649847	1284.656146	R	L	88	99
PSM	LLVVDPETDER	2562	sp|P70441|NHRF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2608.14	37.79082	2	1284.649847	1284.656146	R	L	88	99
PSM	TSCEFTGDILR	2563	sp|P62814|VATB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	3-UNIMOD:4	ms_run[1]:scan=1.1.2725.11	41.05877	2	1297.586647	1297.597252	K	T	110	121
PSM	DATSLNQAALYR	2564	sp|P51660|DHB4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2604.17	37.6811	2	1321.654247	1321.662629	R	L	494	506
PSM	ASAAFSSVGSVITK	2565	sp|Q62393|TPD52_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2675.14	39.65075	2	1323.708647	1323.703431	K	K	149	163
PSM	ALQHIICQLGGTVCDGEK	2566	sp|Q9D826|SOX_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	7-UNIMOD:4,14-UNIMOD:4	ms_run[1]:scan=1.1.2765.18	42.17193	3	1997.953871	1997.966281	R	V	157	175
PSM	AYAQQLTEWAR	2567	sp|Q9WVE8|PACN2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2786.17	42.76382	2	1335.647847	1335.657149	K	R	54	65
PSM	ASDTSITWNNLK	2568	sp|Q921I1|TRFE_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2669.17	39.4825	2	1348.656647	1348.662294	K	G	456	468
PSM	FHADFLLQHVK	2569	sp|Q8R164|BPHL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2598.5	37.50438	3	1353.707471	1353.719356	R	G	250	261
PSM	APNVLASEPEIPK	2570	sp|Q9WTP6|KAD2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	19		ms_run[1]:scan=1.1.2709.15	40.60358	2	1363.7212	1363.7342	M	G	2	15
PSM	RFSMVIDNGIVK	2571	sp|P99029|PRDX5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2694.3	40.16558	3	1377.735071	1377.743856	K	A	176	188
PSM	DLAGCIHGLSNVK	2572	sp|P54071|IDHP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	5-UNIMOD:4	ms_run[1]:scan=1.1.2659.5	39.1985	3	1382.687471	1382.697634	K	L	414	427
PSM	CNEPAVWSQLAK	2573	sp|Q68FD5|CLH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	1-UNIMOD:4	ms_run[1]:scan=1.1.2788.17	42.82112	2	1401.662647	1401.671085	R	A	1102	1114
PSM	QLFHPEQLITGK	2574	sp|P05213|TBA1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2752.19	41.81059	2	1409.758247	1409.766700	R	E	85	97
PSM	IIAINVNDPEAEK	2575	sp|Q91VM9|IPYR2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2664.18	39.3448	2	1424.743647	1424.751109	K	F	199	212
PSM	TTPSVVAFTADGER	2576	sp|P38647|GRP75_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2678.19	39.74035	2	1449.702847	1449.709973	R	L	86	100
PSM	LQAGTVFVNTYNK	2577	sp|Q8R0Y6|AL1L1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2638.17	38.62309	2	1453.750247	1453.756529	K	T	853	866
PSM	SQFTITPGSEQIR	2578	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2632.18	38.45335	2	1462.734647	1462.741607	K	A	412	425
PSM	TVFGELPSGGGTVEK	2579	sp|Q8K157|GALM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2693.16	40.14832	2	1476.734647	1476.746024	R	F	7	22
PSM	YGYTHLSAGELLR	2580	sp|Q9DBP5|KCY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2669.8	39.475	3	1478.743871	1478.751778	K	D	27	40
PSM	VWCTSLHPELVR	2581	sp|Q91WR5|AK1CL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	3-UNIMOD:4	ms_run[1]:scan=1.1.2655.5	39.09075	3	1495.748471	1495.760569	K	A	85	97
PSM	SLTNDWEEHLAVK	2582	sp|P07901|HS90A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2757.9	41.94002	3	1540.743971	1540.752172	K	H	316	329
PSM	AEAEAQAEELSFPR	2583	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2711.20	40.6653	2	1546.715447	1546.726351	R	S	929	943
PSM	EAYPGDVFYLHSR	2584	sp|Q03265|ATPA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2775.8	42.44407	3	1552.720871	1552.731043	R	L	335	348
PSM	NTQIIIQEESGIPK	2585	sp|P16332|MUTA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2714.20	40.75193	2	1568.830847	1568.840987	R	V	405	419
PSM	QELAVFCSPEPPAK	2586	sp|P26039|TLN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	7-UNIMOD:4	ms_run[1]:scan=1.1.2789.21	42.85292	2	1571.767047	1571.765380	R	T	2155	2169
PSM	ILGADTSVDLEETGR	2587	sp|Q03265|ATPA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2791.20	42.90855	2	1574.772247	1574.778781	R	V	59	74
PSM	TPIAAGHPSMNLLLR	2588	sp|Q9D6R2|IDH3A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2774.7	42.41545	3	1589.862071	1589.871182	K	K	101	116
PSM	EYTTGQQGGVLTLQR	2589	sp|Q61847|MEP1B_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2592.21	37.35262	2	1649.834647	1649.837299	R	Q	362	377
PSM	DGFNPAHVEAGLYGSR	2590	sp|P17563|SBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2783.8	42.67048	3	1688.783771	1688.790683	K	I	212	228
PSM	ARVDEYLAWQHTGLR	2591	sp|Q64471|GSTT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2668.15	39.45292	3	1813.924271	1813.922366	R	R	93	108
PSM	ELQELVQYPVEHPDK	2592	sp|Q01853|TERA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2706.12	40.51597	3	1822.901771	1822.910129	R	F	488	503
PSM	AYEAQTEPVLQYYQK	2593	sp|Q9WTP7|KAD3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2781.19	42.6223	2	1829.877847	1829.883580	K	K	175	190
PSM	TDVLTPAGTTIHGLHALER	2594	sp|Q9DCC4|P5CR3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2722.16	40.9788	3	2001.054371	2001.064339	R	G	232	251
PSM	IREDLPNLESSEETEQINK	2595	sp|Q9EQH3|VPS35_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2621.19	38.14702	3	2243.085071	2243.091735	K	H	750	769
PSM	VGEGPGVCWLAPEQTAGK	2596	sp|Q8VCT3|AMPB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	8-UNIMOD:4	ms_run[1]:scan=1.1.2991.14	48.52673	2	1854.881247	1854.893434	R	K	144	162
PSM	AVDLQILPK	2597	sp|P47911|RL6_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2849.5	44.53643	2	995.592647	995.601532	K	I	260	269
PSM	ANTIGISLIK	2598	sp|P13707|GPDA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2799.7	43.12257	2	1028.614247	1028.622996	K	G	111	121
PSM	EIDGFVLNR	2599	sp|Q99KP3|CRYL1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2800.5	43.14935	2	1061.543047	1061.550559	K	L	189	198
PSM	LNNLVLFDK	2600	sp|P62852|RS25_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2908.5	46.20313	2	1074.598047	1074.607346	K	A	44	53
PSM	LLIYTEFGK	2601	sp|O09173|HGD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2995.7	48.6248	2	1082.591847	1082.601198	K	M	163	172
PSM	LKGEMMDLQHGSLFLQTPK	2602	sp|P16125|LDHB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2915.8	46.4014	4	2172.107294	2172.107132	K	I	59	78
PSM	VVDLLAPYAK	2603	sp|P56480|ATPB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2936.8	47.00102	2	1087.619647	1087.627747	K	G	189	199
PSM	CLDAFPNLR	2604	sp|P10649|GSTM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	1-UNIMOD:4	ms_run[1]:scan=1.1.2833.8	44.0898	2	1104.532847	1104.538614	K	D	174	183
PSM	MIAEAIPELK	2605	sp|P08249|MDHM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2851.8	44.59583	2	1113.600647	1113.610382	K	A	315	325
PSM	IFEGANDILR	2606	sp|P50544|ACADV_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2849.10	44.54062	2	1146.594647	1146.603323	R	L	461	471
PSM	CEFQDAYVLLSEKK	2607	sp|P63038|CH60_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	1-UNIMOD:4	ms_run[1]:scan=1.1.2952.7	47.43465	3	1728.831071	1728.839273	K	I	237	251
PSM	FSVLLLHGIR	2608	sp|Q8VCR7|ABHEB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2940.5	47.11038	2	1153.687647	1153.697164	R	F	33	43
PSM	DIDQVVTAGLK	2609	sp|Q60928|GGT1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2951.9	47.4089	2	1157.620447	1157.629203	K	I	517	528
PSM	IHYLDTTTLIEPVAR	2610	sp|Q64010|CRK_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2966.10	47.83218	3	1740.936671	1740.941036	K	S	106	121
PSM	FLQASEDLLK	2611	sp|P15532|NDKA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2824.11	43.83523	2	1162.614447	1162.623390	K	E	40	50
PSM	RMATEVAADALGEEWK	2612	sp|P62754|RS6_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2834.10	44.12017	3	1775.844071	1775.851234	K	G	31	47
PSM	LAEYTDLMLK	2613	sp|P12658|CALB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2962.8	47.71648	2	1195.608847	1195.615862	K	L	143	153
PSM	ILIRPLYSNPPLNGAR	2614	sp|P05202|AATM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2796.11	43.0413	3	1793.019371	1793.031188	K	I	310	326
PSM	IQLINNMLDK	2615	sp|P09411|PGK1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2920.9	46.54352	2	1200.647647	1200.653644	K	V	221	231
PSM	VMVAEALDISR	2616	sp|Q9Z2I8|SUCB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2858.13	44.80088	2	1202.624047	1202.632909	K	E	141	152
PSM	GQTLVVQFTVK	2617	sp|P14211|CALR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2874.10	45.25663	2	1218.689047	1218.697223	K	H	88	99
PSM	ADVVESWIGEK	2618	sp|P08032|SPTA1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2903.12	46.0679	2	1231.605247	1231.608468	K	E	1933	1944
PSM	DFANVYVDAVK	2619	sp|Q00623|APOA1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2998.11	48.713	2	1239.606247	1239.613553	K	D	36	47
PSM	ISGETIFVTAPHEATAGIIGVNRK	2620	sp|Q68FD5|CLH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2904.13	46.09705	4	2480.334094	2480.338723	R	G	298	322
PSM	ADIEMPFDPSK	2621	sp|Q80X90|FLNB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2974.4	48.05068	2	1248.563647	1248.569640	K	V	1125	1136
PSM	FLASVSTVLTSK	2622	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2976.12	48.10958	2	1251.699847	1251.707454	K	Y	129	141
PSM	RPCFSALTVDETYVPK	2623	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	3-UNIMOD:4	ms_run[1]:scan=1.1.2833.16	44.09647	3	1881.930071	1881.929485	R	E	509	525
PSM	AETFTFHSDICTLPEK	2624	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	11-UNIMOD:4	ms_run[1]:scan=1.1.2817.14	43.63732	3	1894.885271	1894.877115	K	E	528	544
PSM	EVGADFTIQVGK	2625	sp|Q64442|DHSO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2841.8	44.31548	2	1262.641247	1262.650667	K	E	215	227
PSM	FNPETDFLTGK	2626	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2966.14	47.83552	2	1267.602447	1267.608468	K	D	507	518
PSM	AGTQIENIDEDFRDGLK	2627	sp|P57780|ACTN4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2890.9	45.70057	3	1919.922071	1919.922485	K	L	68	85
PSM	DIPGLTDTTVPR	2628	sp|P62754|RS6_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2908.11	46.20815	2	1283.665647	1283.672131	K	R	120	132
PSM	DVEDEETWIR	2629	sp|P16546|SPTN1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2839.15	44.266	2	1290.571047	1290.572811	R	E	792	802
PSM	GFVPVAPICTDK	2630	sp|Q8VCR7|ABHEB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	9-UNIMOD:4	ms_run[1]:scan=1.1.2823.15	43.81002	2	1302.657847	1302.664209	R	I	130	142
PSM	GFVPVAPICTDK	2631	sp|Q8VCR7|ABHEB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	9-UNIMOD:4	ms_run[1]:scan=1.1.2829.16	43.98225	2	1302.657847	1302.664209	R	I	130	142
PSM	RCEAFGWHTIIVDGHSVEELCK	2632	sp|P40142|TKT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	2-UNIMOD:4,21-UNIMOD:4	ms_run[1]:scan=1.1.2860.17	44.8616	4	2642.227694	2642.236977	K	A	205	227
PSM	LAETVFNFQEK	2633	sp|Q9JHU4|DYHC1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2891.12	45.73095	2	1324.657247	1324.666317	R	V	834	845
PSM	IMNTFSVMPSPK	2634	sp|Q7TMM9|TBB2A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2873.16	45.23363	2	1350.659247	1350.667580	R	V	163	175
PSM	LGPALATGNVVVMK	2635	sp|P47738|ALDH2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2873.17	45.23447	2	1368.773847	1368.779907	K	V	198	212
PSM	TIIPLISQCTPK	2636	sp|P08249|MDHM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	9-UNIMOD:4	ms_run[1]:scan=1.1.2972.12	48.00063	2	1369.757847	1369.763923	K	V	204	216
PSM	CVIAEGDLGIVQK	2637	sp|Q9Z0S1|BPNT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	1-UNIMOD:4	ms_run[1]:scan=1.1.2809.16	43.41045	2	1400.725847	1400.733351	R	T	28	41
PSM	LEEGPPVTTVLTR	2638	sp|P35486|ODPA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2803.16	43.24397	2	1410.764447	1410.771845	R	E	46	59
PSM	DQLLLGPTYATPK	2639	sp|Q99JY0|ECHB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2972.13	48.00148	2	1415.755047	1415.766031	K	V	350	363
PSM	YCTQDAFFQIK	2640	sp|O35459|ECH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	2-UNIMOD:4	ms_run[1]:scan=1.1.2965.14	47.80702	2	1419.643247	1419.649287	R	E	185	196
PSM	VECVGDDIAWMK	2641	sp|Q9Z2V4|PCKGC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	3-UNIMOD:4	ms_run[1]:scan=1.1.2965.15	47.80785	2	1421.629647	1421.631923	K	F	305	317
PSM	VAGMDVELTVEER	2642	sp|P62259|1433E_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2890.13	45.7039	2	1446.690847	1446.702445	K	N	30	43
PSM	VAGMDVELTVEER	2643	sp|P62259|1433E_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2884.17	45.5395	2	1446.690847	1446.702445	K	N	30	43
PSM	RDPLHEELLGQGCVFQER	2644	sp|Q99LB7|SARDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	13-UNIMOD:4	ms_run[1]:scan=1.1.2800.18	43.16018	3	2182.053071	2182.058936	R	Q	486	504
PSM	ILLNACCPGWVR	2645	tr|A0A1B0GRG8|A0A1B0GRG8_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	6-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=1.1.2974.5	48.05235	2	1457.716847	1457.727161	K	T	221	233
PSM	LNTGAWGCCPFAK	2646	sp|P28798|GRN_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	8-UNIMOD:4,9-UNIMOD:4	ms_run[1]:scan=1.1.2814.19	43.55552	2	1480.654247	1480.659141	R	A	297	310
PSM	LNTGAWGCCPFAK	2647	sp|P28798|GRN_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	8-UNIMOD:4,9-UNIMOD:4	ms_run[1]:scan=1.1.2816.21	43.61453	2	1480.654247	1480.659141	R	A	297	310
PSM	GTTASQMAQALALDK	2648	sp|Q60854|SPB6_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2857.18	44.77645	2	1504.750047	1504.755543	K	C	47	62
PSM	IQGLTVEQAEAVVR	2649	sp|Q9JHU4|DYHC1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2927.17	46.75003	2	1511.820447	1511.830757	K	L	3922	3936
PSM	AVVQVFEGTSGIDAK	2650	sp|P62814|VATB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2812.21	43.49958	2	1519.779647	1519.788223	K	K	94	109
PSM	GDLNDCFIPCTPK	2651	sp|Q922D8|C1TC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	6-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.2851.19	44.60501	2	1535.667647	1535.674850	R	G	138	151
PSM	VTWDSSFCAVNPR	2652	sp|Q9WUM4|COR1C_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	8-UNIMOD:4	ms_run[1]:scan=1.1.2904.19	46.10205	2	1537.695247	1537.698363	R	F	32	45
PSM	AENACVPPFTVEVK	2653	sp|Q9D964|GATM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	5-UNIMOD:4	ms_run[1]:scan=1.1.2886.20	45.5979	2	1559.760847	1559.765380	R	A	83	97
PSM	VVAFSGDNPASLAGMR	2654	sp|Q3TNA1|XYLB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2973.14	48.03355	2	1590.775647	1590.782426	K	L	289	305
PSM	DLEQGVVGAHGLLCR	2655	sp|Q91Z53|GRHPR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	14-UNIMOD:4	ms_run[1]:scan=1.1.2827.21	43.9294	2	1622.813247	1622.819875	K	L	44	59
PSM	YAPSGFYIASGDISGK	2656	sp|O88342|WDR1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2963.19	47.75408	2	1631.774847	1631.783138	K	L	66	82
PSM	LVLEVAQHLGESTVR	2657	sp|P56480|ATPB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2822.21	43.78632	2	1649.902847	1649.910070	R	T	95	110
PSM	STGGAPTFNVTVTMTAK	2658	sp|P62962|PROF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2890.21	45.71058	2	1681.829247	1681.834522	K	T	92	109
PSM	GPDGLTALEATDNQAIK	2659	sp|P62774|MTPN_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2859.20	44.8354	2	1712.851647	1712.858094	K	A	98	115
PSM	SWCPDCVEAEPVIR	2660	sp|Q9CQM5|TXD17_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	3-UNIMOD:4,6-UNIMOD:4	ms_run[1]:scan=1.1.2906.21	46.15992	2	1716.756247	1716.759977	K	E	41	55
PSM	GQQYTDSFAQVNPLR	2661	sp|Q99L20|GSTT3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2934.21	46.95412	2	1722.818047	1722.832548	K	K	38	53
PSM	GQQYTDSFAQVNPLR	2662	sp|Q99L20|GSTT3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2936.20	47.01103	2	1722.818047	1722.832548	K	K	38	53
PSM	VAFYWEGNEPGETTK	2663	sp|Q9QXG4|ACSA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2892.19	45.76482	2	1726.779247	1726.783866	K	I	121	136
PSM	HGLLPSETIAVVEHIK	2664	sp|Q9Z2Y8|PLPHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2884.11	45.5345	3	1741.965071	1741.972670	K	A	154	170
PSM	TFVVQGFGNVGLHSMR	2665	sp|P26443|DHE3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2964.11	47.77603	3	1747.872671	1747.882809	K	Y	303	319
PSM	IYELAAGGTAVGTGLNTR	2666	sp|P97807|FUMH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2852.9	44.62545	3	1762.910771	1762.921363	R	I	266	284
PSM	KGVNLPGAAVDLPAVSEK	2667	sp|P52480|KPYM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2812.11	43.49125	3	1763.972171	1763.978149	K	D	207	225
PSM	EAAQMDMVNDGVEDLR	2668	sp|P19157|GSTP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2912.21	46.32887	2	1791.772247	1791.776749	R	G	86	102
PSM	YQVADHWYPADLQAR	2669	sp|Q61133|GSTT2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2804.12	43.26859	3	1831.859171	1831.864182	K	A	78	93
PSM	MTDSFTEQADQVTADVGK	2670	sp|Q8BVI4|DHPR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2896.10	45.86852	3	1941.857771	1941.862587	K	L	53	71
PSM	RSTCTINYSTSLPLAQGIK	2671	sp|Q9DBF1|AL7A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	4-UNIMOD:4	ms_run[1]:scan=1.1.2801.19	43.1896	3	2109.082571	2109.088839	R	F	519	538
PSM	AGAIAPCEVTVPAQNTGLGPEK	2672	sp|P14869|RLA0_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	7-UNIMOD:4	ms_run[1]:scan=1.1.2821.18	43.75517	3	2179.085471	2179.094319	R	T	113	135
PSM	FLHDPSATQGFVGCALSSNIQR	2673	sp|P17563|SBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	14-UNIMOD:4	ms_run[1]:scan=1.1.2975.18	48.08717	3	2404.152671	2404.159378	R	F	255	277
PSM	VLEVASGSGQHAAHFAQAFPNAEWQPSDVDQR	2674	sp|Q9DCS2|MTL26_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2948.17	47.3376	4	3448.617294	3448.618480	R	C	31	63
PSM	FLFPEGIK	2675	sp|Q8K009|AL1L2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3006.2	48.93172	2	949.519047	949.527304	R	A	189	197
PSM	FIIPQIVK	2676	sp|P16125|LDHB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3098.3	51.51288	2	956.600047	956.605889	K	Y	120	128
PSM	FIIPQIVK	2677	sp|P16125|LDHB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3091.4	51.32058	2	956.600047	956.605889	K	Y	120	128
PSM	FPLFTAVYK	2678	sp|P13707|GPDA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3179.5	53.79028	2	1084.588447	1084.595718	K	V	319	328
PSM	GDFWLMGDR	2679	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3167.4	53.45463	2	1095.472647	1095.480765	R	G	440	449
PSM	PHPLVTSTDIVLTITK	2680	sp|P28271|ACOC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3035.9	49.72897	3	1733.987771	1733.992737	K	H	251	267
PSM	LLEAGDFICQALNRK	2681	sp|P38060|HMGCL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	9-UNIMOD:4	ms_run[1]:scan=1.1.3199.6	54.35088	3	1746.903671	1746.908690	K	T	299	314
PSM	EGLLLWCQR	2682	sp|O88990|ACTN3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	7-UNIMOD:4	ms_run[1]:scan=1.1.3113.5	51.9282	2	1173.589647	1173.596464	K	K	161	170
PSM	VFLTTAEVISQQVSDK	2683	sp|P06801|MAOX_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3126.6	52.29618	3	1763.917271	1763.930531	K	H	477	493
PSM	ASTLHLQTGNLLNWGR	2684	sp|O09172|GSH0_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3051.6	50.18387	3	1779.928571	1779.938016	R	L	15	31
PSM	TAVETAVLLLR	2685	sp|P80318|TCPG_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3180.4	53.81697	2	1184.707647	1184.712873	K	I	508	519
PSM	AGLILFGNDDR	2686	sp|Q8R0Y6|AL1L1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3042.5	49.92657	2	1189.605047	1189.609137	K	M	275	286
PSM	AGLILFGNDDR	2687	sp|Q8R0Y6|AL1L1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3036.6	49.75515	2	1189.605047	1189.609137	K	M	275	286
PSM	HQVLFIADEIQTGLAR	2688	sp|P29758|OAT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3156.5	53.15495	3	1809.964571	1809.973733	R	T	256	272
PSM	RFDEILEASDGIMVAR	2689	sp|P52480|KPYM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3184.5	53.92785	3	1820.905571	1820.909084	R	G	279	295
PSM	DFLAGGVAAAISK	2690	sp|P51881|ADT2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3171.10	53.57052	2	1218.652047	1218.660838	K	T	11	24
PSM	IHQYFGDLCSQLLSR	2691	sp|Q8JZZ0|UD3A2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	9-UNIMOD:4	ms_run[1]:scan=1.1.3054.8	50.26785	3	1835.895071	1835.898853	K	K	112	127
PSM	YGIDEYLEVK	2692	sp|Q8BWF0|SSDH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3029.10	49.56077	2	1227.593647	1227.602320	K	Y	507	517
PSM	HWHADLRPDDSPLEAGLAFTCK	2693	sp|Q99LB7|SARDH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	21-UNIMOD:4	ms_run[1]:scan=1.1.3004.10	48.88238	4	2535.191694	2535.196492	R	L	780	802
PSM	KEPGAYDWSSIVQHACELEGDR	2694	sp|P40936|INMT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	16-UNIMOD:4	ms_run[1]:scan=1.1.3200.7	54.38037	4	2546.148894	2546.149602	K	S	101	123
PSM	VHLVGIDIFTGK	2695	sp|P63242|IF5A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3090.15	51.30132	2	1297.728847	1297.739423	K	K	56	68
PSM	DVLSVAFSSDNR	2696	sp|P68040|RACK1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3044.15	49.99243	2	1308.622247	1308.630994	K	Q	107	119
PSM	AVEEIWFETAK	2697	sp|Q5U5V2|HYKK_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3042.10	49.93073	2	1321.646247	1321.655418	K	S	358	369
PSM	QVEAELLPCLR	2698	sp|Q8CG76|ARK72_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	9-UNIMOD:4	ms_run[1]:scan=1.1.3004.11	48.88322	2	1326.688847	1326.696572	R	H	214	225
PSM	GFPTIYFSPANK	2699	sp|P27773|PDIA3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3110.11	51.8512	2	1340.668047	1340.676488	K	K	449	461
PSM	DLQILAEFHEK	2700	sp|P07759|SPA3K_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3032.14	49.64785	2	1341.685647	1341.692866	K	T	145	156
PSM	FLVYVANFDEK	2701	sp|Q61598|GDIB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3169.8	53.5133	2	1343.672047	1343.676154	K	D	143	154
PSM	PKPHSEAGTAFIQTQQLHAAMADTFLEHMCR	2702	sp|P52480|KPYM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	19	30-UNIMOD:4	ms_run[1]:scan=1.1.3042.15	49.9349	5	3522.6616	3522.6590	M	L	2	33
PSM	VLDPFTIKPLDR	2703	sp|P40142|TKT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3023.2	49.39123	3	1412.791571	1412.802751	R	K	531	543
PSM	RILIDTGEPSVPEYISCLK	2704	sp|Q99KR3|LACB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	17-UNIMOD:4	ms_run[1]:scan=1.1.3186.8	53.98513	3	2189.139671	2189.140206	R	Q	42	61
PSM	NFNTVPYIVGINK	2705	tr|D3Z298|D3Z298_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3121.13	52.1597	2	1477.784447	1477.792915	K	Q	340	353
PSM	LGVEFDEITADDR	2706	sp|P04117|FABP4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3025.9	49.4554	2	1478.688847	1478.688903	K	K	67	80
PSM	SCVITYLAQVDPK	2707	sp|Q9JMD3|STA10_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	2-UNIMOD:4	ms_run[1]:scan=1.1.3067.10	50.63968	2	1492.752447	1492.759566	K	G	180	193
PSM	NSTLTFVTMSGELK	2708	sp|Q9DCG6|PBLD1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3112.13	51.90743	2	1526.758047	1526.765045	R	A	98	112
PSM	LYTLVLTDPDAPSR	2709	sp|P70296|PEBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3094.17	51.41485	2	1559.812047	1559.819523	K	K	63	77
PSM	TIQNLASIQSFQIK	2710	sp|Q91XE0|GLYAT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3139.16	52.67468	2	1589.871647	1589.877707	K	H	114	128
PSM	TSLSPGSGVVTYYLR	2711	sp|P28271|ACOC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3076.18	50.90208	2	1598.823247	1598.830422	K	E	469	484
PSM	EAFEEAGVLLLRPR	2712	sp|P11930|NUD19_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3107.3	51.76198	3	1598.871371	1598.878041	R	D	112	126
PSM	QAIMTILDQEADTR	2713	sp|P28825|MEP1A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3079.17	50.9873	2	1603.786447	1603.787571	R	N	506	520
PSM	VPEANSSWMDTVIR	2714	sp|Q8BMF4|ODP2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3092.15	51.35787	2	1603.758447	1603.766442	K	Q	486	500
PSM	CQLEINFNTLQTK	2715	sp|O88990|ACTN3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	1-UNIMOD:4	ms_run[1]:scan=1.1.3050.17	50.16545	2	1607.787647	1607.797742	K	L	345	358
PSM	VDAILCVAGGWAGGNAK	2716	sp|Q8BVI4|DHPR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	6-UNIMOD:4	ms_run[1]:scan=1.1.3179.16	53.79947	2	1657.818647	1657.824626	K	S	77	94
PSM	AGTEETILYSDIDLK	2717	sp|Q9JHW2|NIT2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3137.16	52.61733	2	1666.823247	1666.830148	K	K	235	250
PSM	TPDFESTGLYSAMPR	2718	sp|Q9D964|GATM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3085.21	51.16393	2	1670.754447	1670.761022	K	D	155	170
PSM	FATASADGQIFIYDGK	2719	sp|O88342|WDR1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3046.20	50.05405	2	1702.809247	1702.820252	R	T	204	220
PSM	VGDAIPSVEVFEGEPGK	2720	sp|P99029|PRDX5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3122.17	52.1914	2	1728.852047	1728.857031	K	K	54	71
PSM	GLVYETSVLDPDEGIR	2721	tr|Q80X68|Q80X68_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3145.20	52.85043	2	1761.878047	1761.878495	K	F	77	93
PSM	AYHEQLTVAEITNACFEPANQMVK	2722	sp|P68373|TBA1C_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	15-UNIMOD:4	ms_run[1]:scan=1.1.3133.21	52.50687	3	2763.294071	2763.299637	K	C	281	305
PSM	SRQDLFAVDTQTGSVTSLTAGGSAGSWK	2723	sp|Q8R146|APEH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3124.21	52.25165	3	2826.372371	2826.378415	R	L	384	412
PSM	AGDEIICMDEVYGGTNR	2724	sp|Q8VCN5|CGL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	7-UNIMOD:4	ms_run[1]:scan=1.1.3027.21	49.51488	2	1898.802647	1898.813863	K	Y	102	119
PSM	VLNNMEIGTSLYDEEGAK	2725	sp|P09411|PGK1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3005.21	48.91952	2	1981.917447	1981.930273	K	I	247	265
PSM	TAFGKPLVEQGTILADIAR	2726	tr|D3Z7X0|D3Z7X0_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3207.9	54.58232	3	1999.103171	1999.110226	R	S	435	454
PSM	IFNNGADLSGITEENAPLK	2727	sp|P07758|A1AT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3072.21	50.79152	2	2001.991447	2002.000735	R	L	329	348
PSM	GIHVEIPGAQAESLGPLQVAR	2728	sp|Q9DCW4|ETFB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3131.12	52.44287	3	2141.154371	2141.159302	R	V	86	107
PSM	VTYMVHDFEEGGGVAMGMYNQDK	2729	sp|O88844|IDHC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3061.19	50.47385	3	2577.085271	2577.097431	K	S	165	188
PSM	IGPSEVENALMEHPAVSETAVISSPDPSRGEVVK	2730	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3169.19	53.52247	4	3530.756894	3530.756278	R	A	474	508
PSM	TDLALILSAGDN	2731	sp|P12658|CALB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3606.4	65.76505	2	1201.613847	1201.619033	R	-	250	262
PSM	SIATLAITTLLK	2732	sp|Q9QXK3|COPG2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3641.4	66.78093	2	1243.765647	1243.775139	R	T	339	351
PSM	EANNFLWPFK	2733	sp|P14148|RL7_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3493.6	62.5719	2	1264.615247	1264.624058	K	L	225	235
PSM	SWAMLFASGGFK	2734	sp|Q99KP3|CRYL1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3508.5	62.99078	2	1300.618847	1300.627429	R	V	20	32
PSM	SVSAFAPICNPVLCSWGK	2735	sp|Q9R0P3|ESTD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	9-UNIMOD:4,14-UNIMOD:4	ms_run[1]:scan=1.1.3512.6	63.1012	3	1991.952071	1991.959739	R	K	168	186
PSM	FFPLEAWQIGK	2736	sp|O35215|DOPD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3559.6	64.45142	2	1334.698047	1334.702309	R	K	100	111
PSM	WSFEELGLLSR	2737	sp|Q3UNX5|ACSM3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3637.4	66.66769	2	1335.677047	1335.682302	R	K	89	100
PSM	DDGSAVIWVTFR	2738	sp|Q9CQI6|COTL1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3562.10	64.53902	2	1364.674247	1364.672465	R	Y	19	31
PSM	VKPIWPIGMFSGYVDNPK	2739	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3472.6	61.97105	3	2047.056971	2047.060105	R	K	415	433
PSM	DLDDFQSWLSR	2740	sp|Q62261|SPTB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3641.7	66.78343	2	1380.620647	1380.630994	R	T	1070	1081
PSM	FSLPSEAFYMIR	2741	sp|Q9QXN5|MIOX_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3578.11	64.99001	2	1459.711847	1459.716973	K	F	207	219
PSM	LICCDILDVLDK	2742	sp|P62259|1433E_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	3-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=1.1.3562.13	64.54153	2	1475.731847	1475.736388	K	H	95	107
PSM	GIDYEIVPINLIK	2743	sp|Q9WVL0|MAAI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3608.8	65.82575	2	1485.840247	1485.844282	K	D	28	41
PSM	TLAESALQLLYTAK	2744	sp|P26039|TLN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3616.11	66.0593	2	1520.838847	1520.845010	K	E	1767	1781
PSM	DNVINLEVVLPDGR	2745	sp|Q7TNG8|LDHD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3522.15	63.3956	2	1551.819847	1551.825671	R	L	185	199
PSM	GVMLAVDAVIAELKK	2746	sp|P63038|CH60_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3623.3	66.25515	3	1555.890671	1555.900751	R	Q	143	158
PSM	MPIPVIQAFGILKR	2747	sp|P97807|FUMH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3485.2	62.33833	3	1581.932171	1581.942890	R	A	85	99
PSM	ELPTAFDYVEFTR	2748	sp|P16546|SPTN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3473.16	62.00718	2	1586.770047	1586.761674	R	S	2455	2468
PSM	LLGQFTLIGIPPAPR	2749	sp|P38647|GRP75_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3610.18	65.89156	2	1591.939847	1591.944999	K	G	499	514
PSM	LLGQFTLIGIPPAPR	2750	sp|P38647|GRP75_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3604.14	65.71608	2	1591.939847	1591.944999	K	G	499	514
PSM	DIPSDAFTGLDPLGDK	2751	sp|P98078|DAB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3535.13	63.7681	2	1659.793847	1659.799182	K	E	629	645
PSM	NLCLLYSLYGISQK	2752	sp|Q9R0H0|ACOX1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	3-UNIMOD:4	ms_run[1]:scan=1.1.3580.11	65.04477	2	1670.865847	1670.870179	R	G	557	571
PSM	IAEVGGVPYLLPLVNK	2753	sp|Q91V76|CK054_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3611.16	65.91883	2	1680.980247	1680.981444	R	K	59	75
PSM	KLDILSNDLVINMLK	2754	sp|Q9QXD6|F16P1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3574.3	64.87172	3	1727.985971	1727.985543	K	S	73	88
PSM	YCNTWPMAISMLASK	2755	sp|Q64442|DHSO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	2-UNIMOD:4	ms_run[1]:scan=1.1.3558.19	64.43387	2	1771.805247	1771.809569	R	T	300	315
PSM	GNPSGIQPDLLISLTAPK	2756	sp|Q8K4Z3|NNRE_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3506.9	62.94682	2	1819.998047	1820.004364	K	K	222	240
PSM	ILPNVPEVEDSTDFFK	2757	sp|Q8R0Y6|AL1L1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3469.14	61.89947	2	1848.908847	1848.914546	R	S	334	350
PSM	SLRPGVAIADFVIFPPR	2758	sp|O09173|HGD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3515.5	63.18538	3	1854.036671	1854.051589	K	W	305	322
PSM	AMTTFLSTLGAQCVIASR	2759	sp|Q9CQ62|DECR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	13-UNIMOD:4	ms_run[1]:scan=1.1.3478.4	62.13951	3	1925.960471	1925.970304	K	N	74	92
PSM	IPNIYAIGDVVAGPMLAHK	2760	sp|O08749|DLDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3517.5	63.2429	3	1978.070171	1978.071004	K	A	347	366
PSM	AIMTYVSSFYHAFSGAQK	2761	sp|P57780|ACTN4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3446.7	61.25075	3	2006.945471	2006.956034	K	A	257	275
PSM	VKPIWPIGMFSGYVDNPK	2762	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3501.10	62.8058	3	2047.056971	2047.060105	R	K	415	433
PSM	EILVGDVGQTVDDPYTTFVK	2763	sp|P18760|COF1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3466.5	61.8058	3	2195.094671	2195.099781	K	M	54	74
PSM	DLYANTVLSGGTTMYPGIADR	2764	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3464.11	61.75595	3	2214.063071	2214.062684	K	M	292	313
PSM	HLYTLDGGDIINALCFSPNR	2765	sp|P68040|RACK1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	15-UNIMOD:4	ms_run[1]:scan=1.1.3530.14	63.62551	3	2275.099271	2275.105552	K	Y	226	246
PSM	ILNKPVPSLPNMDSVFAEAIAK	2766	sp|Q9DBM2|ECHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3472.14	61.97773	3	2353.266371	2353.271554	R	V	196	218
PSM	ISALQSAGVVVSMSPAQLGTTIYK	2767	sp|Q9WUM5|SUCA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3567.9	64.67815	3	2420.297471	2420.298497	K	E	315	339
PSM	YRIPADVDPLTITSSLSSDGVLTVNGPR	2768	sp|P23927|CRYAB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3647.7	66.95772	3	2942.539571	2942.534916	K	K	122	150
PSM	LADDVDLEQVANETHGHVGADLAALCSEAALQAIR	2769	sp|Q01853|TERA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	26-UNIMOD:4	ms_run[1]:scan=1.1.3573.19	64.85654	4	3671.793694	3671.784953	K	K	390	425
PSM	EGGLGPLNIPLLADVTK	2770	sp|Q61171|PRDX2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3788.2	70.91193	3	1705.949771	1705.961437	K	S	93	110
PSM	LIALLEVLSQK	2771	sp|Q80X90|FLNB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3656.6	67.20548	2	1225.756647	1225.764575	R	R	50	61
PSM	LPVVIGGLLDVDCSEDVIK	2772	sp|Q68FD5|CLH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	13-UNIMOD:4	ms_run[1]:scan=1.1.3744.6	69.66666	3	2040.071171	2040.081294	R	N	812	831
PSM	IVSQLLTLMDGLK	2773	sp|Q01853|TERA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3743.6	69.63915	2	1429.818047	1429.821438	R	Q	324	337
PSM	INVNEIFYDLVR	2774	sp|P62835|RAP1A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3793.6	71.05322	2	1493.783447	1493.787829	K	Q	152	164
PSM	DLDTVASDMMVLLK	2775	sp|Q920A5|RISC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3872.3	73.25333	2	1549.768247	1549.773167	K	S	134	148
PSM	SWDVETATELLLSN	2776	sp|P61087|UBE2K_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3899.2	73.99657	2	1576.755247	1576.762068	K	-	187	201
PSM	ELIPNIPFQMLLR	2777	sp|Q05920|PYC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3817.9	71.72037	2	1582.887847	1582.890520	R	G	632	645
PSM	ADGLDIPQLLEAVLR	2778	sp|Q8R2K1|FUCM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3913.3	74.3843	2	1621.899047	1621.903922	R	L	50	65
PSM	SLADELALVDVLEDK	2779	sp|P16125|LDHB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3801.3	71.2758	3	1628.844071	1628.850883	K	L	44	59
PSM	DGVLVDEFGLPQIPAS	2780	sp|Q9D7S9|CHMP5_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3893.3	73.83839	2	1655.834247	1655.840653	K	-	204	220
PSM	LNVTSTWNLASPLLSVNVDGTQR	2781	sp|Q91ZA3|PCCA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3751.17	69.87193	3	2484.292871	2484.297252	K	T	586	609
PSM	AVQQPDGLAVLGIFLK	2782	sp|P00920|CAH2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3817.13	71.72372	2	1667.958847	1667.961043	K	I	133	149
PSM	QQLNIHGLLPPCIISQELQVLR	2783	sp|P06801|MAOX_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	12-UNIMOD:4	ms_run[1]:scan=1.1.3735.17	69.42222	3	2568.425771	2568.421013	R	I	36	58
PSM	EVVDSYLPVILDMIK	2784	sp|Q61207|SAP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3872.9	73.26335	2	1732.923647	1732.932110	K	G	108	123
PSM	NSAVWPDPEVFDPLR	2785	sp|Q64462|CP4B1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3655.12	67.18745	2	1740.842647	1740.847135	R	F	415	430
PSM	VLVCGAGPVGMVTLLVAK	2786	sp|Q64442|DHSO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	4-UNIMOD:4	ms_run[1]:scan=1.1.3723.9	69.09132	2	1783.006247	1783.009984	K	A	176	194
PSM	AMTTGAIAAMLSTILYSR	2787	sp|O09061|PSB1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3888.2	73.686	3	1869.959171	1869.969241	K	R	109	127
PSM	FKLDLDFPNLPYLMDGK	2788	sp|P48774|GSTM5_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3768.3	70.35142	3	2025.025871	2025.028136	K	N	54	71
PSM	AIPDLTAPVAAVQAAVSNLVR	2789	sp|Q64727|VINC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3888.3	73.68933	3	2075.168171	2075.173889	K	V	36	57
PSM	DTTPDELLSAVLTAVLQDVK	2790	sp|Q8VCH0|THIKB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.4436.2	79.98637	3	2127.128471	2127.131081	K	L	58	78
PSM	SLTIQPDPIVVPGDVVVSLEGK	2791	sp|Q60648|SAP3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3753.14	69.92722	3	2261.247071	2261.251865	K	T	50	72
PSM	QTSFDAVFLDPFDVCGLTVAK	2792	sp|Q6ZQM8|UD17C_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	15-UNIMOD:4	ms_run[1]:scan=1.1.3846.9	72.53107	3	2329.125971	2329.130035	K	Y	140	161
PSM	EVAAFAQFGSDLDAATQQLLSR	2793	sp|Q03265|ATPA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3824.9	71.9154	3	2337.153371	2337.160090	R	G	442	464
PSM	TALLDAAGVASLLTTAEAVVTEIPK	2794	sp|P63038|CH60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.4078.2	77.25787	3	2453.366171	2453.362872	R	E	527	552
PSM	DFSALESQLQDTQELLQEENR	2795	sp|Q8VDD5|MYH9_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3789.11	70.94585	3	2492.166971	2492.166691	K	Q	1302	1323
PSM	LCYVALDFEQEMATAASSSSLEK	2796	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	2-UNIMOD:4	ms_run[1]:scan=1.1.3740.11	69.56102	3	2549.165771	2549.166557	K	S	216	239
PSM	GIHCAIDASQTPDIVFASILAAFSK	2797	sp|Q9WTP6|KAD2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	4-UNIMOD:4	ms_run[1]:scan=1.1.3869.8	73.18085	3	2631.337871	2631.336674	R	A	205	230
PSM	GCQLLVYPGAFNLTTGPAHWELLQR	2798	sp|Q9JHW2|NIT2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	2-UNIMOD:4	ms_run[1]:scan=1.1.3709.12	68.70116	3	2840.445371	2840.443205	R	A	169	194
PSM	CCAEANPPACYGTVLAEFQPLVEEPK	2799	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	1-UNIMOD:4,2-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.3855.8	72.80092	3	2949.328871	2949.334702	K	N	384	410
PSM	TVMDDFAQFLDTCCK	2800	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	13-UNIMOD:4,14-UNIMOD:4	ms_run[1]:scan=1.1.3741.3	69.58176	3	1849.768271	1849.768493	K	A	570	585
PSM	NDANPETHAFVTSPEIVTALAIAGTLK	2801	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3842.14	72.42615	3	2780.421071	2779.439225	R	F	480	507
PSM	LCYVALDFEQEMATAASSSSLEK	2802	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	2-UNIMOD:4	ms_run[1]:scan=1.1.3735.16	69.42139	3	2551.177271	2549.166557	K	S	216	239
PSM	KIWCFGPDGTGPNILTDITK	2803	sp|P58252|EF2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	4-UNIMOD:4	ms_run[1]:scan=1.1.3440.5	61.09163	3	2233.124771	2232.124890	R	G	648	668
PSM	CLYASVLTAQPR	2804	sp|P58252|EF2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.3589.6	65.28532	2	1360.6771	1360.6804	R	L	728	740
PSM	TAVCDIPPR	2805	sp|P68372|TBB4B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	4-UNIMOD:4	ms_run[1]:scan=1.1.2203.5	26.58978	2	1027.503447	1027.512065	K	G	351	360
PSM	HIADLAGNPEVILPVPAFNVINGGSHAGNK	2806	sp|P17182|ENOA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3472.10	61.9744	4	3021.570094	3020.583204	R	L	133	163
PSM	ANHAPFETDISTLTR	2807	sp|Q9QXD6|F16P1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:1	ms_run[1]:scan=1.1.3078.18	50.95932	2	1713.8231	1713.8317	M	F	2	17
PSM	YVGSMVADIHR	2808	sp|Q9QXD6|F16P1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2311.19	29.57105	2	1247.605247	1246.612842	R	T	245	256
PSM	HHLDGETEEER	2809	sp|P10649|GSTM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1626.16	10.55135	3	1351.574771	1350.580021	K	I	84	95
PSM	MQLIMLCYNPDFEK	2810	sp|P10649|GSTM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	7-UNIMOD:4	ms_run[1]:scan=1.1.3499.19	62.75672	2	1800.821047	1800.824885	R	Q	109	123
PSM	AVFVDLEPTVIDEIR	2811	sp|P68368|TBA4A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3615.16	66.03457	2	1714.912447	1714.914152	R	N	65	80
PSM	NPAIIFEDANLEECIPATVR	2812	sp|Q8BH00|AL8A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	14-UNIMOD:4	ms_run[1]:scan=1.1.3537.16	63.82825	3	2272.122071	2271.120533	K	S	258	278
PSM	IGIASQALGIAQASLDCAVK	2813	sp|Q07417|ACADS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	17-UNIMOD:4	ms_run[1]:scan=1.1.3616.5	66.05428	3	1985.061971	1985.061562	R	Y	273	293
PSM	KYNLGAPVAGTCYQAEWDDYVPK	2814	sp|P70296|PEBP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	12-UNIMOD:4	ms_run[1]:scan=1.1.3156.19	53.16663	3	2644.226471	2644.226789	K	L	157	180
PSM	VPEANSSWMDTVIR	2815	sp|Q8BMF4|ODP2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3099.17	51.55223	2	1603.758447	1603.766442	K	Q	486	500
PSM	AISESGVAFIPGMFTK	2816	sp|Q91WU0|CES1F_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3434.6	60.93493	2	1653.833647	1653.843630	R	D	243	259
PSM	TKGDNTISLISIDSGSGVK	2817	sp|Q5U5V2|HYKK_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2738.14	41.42045	3	1890.983171	1890.989836	R	S	104	123
PSM	CVIAEGDLGIVQK	2818	sp|Q9Z0S1|BPNT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.3497.10	62.6915	2	1383.6991	1383.7063	R	T	28	41
PSM	CLEEVEDLIVK	2819	sp|P61922|GABT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.3905.2	74.15605	2	1328.6457	1328.6528	R	Y	269	280
PSM	CGLQGFDGIV	2820	tr|A0A0J9YU79|A0A0J9YU79_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.4051.2	76.85361	2	1047.4621	1047.4690	K	-	289	299
PSM	VLSYAPGPLDNDMQQLAR	2821	sp|Q64105|SPRE_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3203.9	54.46786	3	1986.973871	1986.983311	R	E	194	212
PSM	MDDREDLVYQAK	2822	sp|P62259|1433E_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:1	ms_run[1]:scan=1.1.2686.15	39.9551	2	1523.6822	1523.6922	-	L	1	13
PSM	VNPLGGAIALGHPLGCTGAR	2823	sp|Q8VCH0|THIKB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	16-UNIMOD:4	ms_run[1]:scan=1.1.2896.9	45.86768	3	1930.019771	1930.020700	K	Q	366	386
PSM	EQAEAEVASLNR	2824	tr|D3Z6I8|D3Z6I8_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2266.20	28.32765	2	1315.628247	1315.636808	R	R	43	55
PSM	YPIEHGIITNWDDMEK	2825	sp|P62737|ACTA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2917.17	46.46492	3	1959.913871	1959.903664	K	I	71	87
PSM	VDGMDILCVR	2826	sp|P35486|ODPA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	8-UNIMOD:4	ms_run[1]:scan=1.1.3037.7	49.78467	2	1177.558047	1176.563115	R	E	254	264
PSM	VCLLGCGISTGYGAAVNTAK	2827	sp|P28474|ADHX_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	2-UNIMOD:4,6-UNIMOD:4	ms_run[1]:scan=1.1.3032.14	49.64785	3	2010.981971	2010.986683	K	V	169	189
PSM	ISALQSAGVVVSMSPAQLGTTIYK	2828	sp|Q9WUM5|SUCA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3562.17	64.54487	3	2422.304171	2420.298497	K	E	315	339
PSM	LLIIGDSGVGK	2829	sp|Q6PHN9|RAB35_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2843.8	44.37053	2	1070.624647	1070.633560	K	S	11	22
PSM	TFESLVDFCK	2830	sp|Q61425|HCDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	9-UNIMOD:4	ms_run[1]:scan=1.1.3104.7	51.68207	2	1245.569247	1244.574725	K	T	193	203
PSM	ATSWGSILQDEK	2831	sp|P51855|GSHB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:1	ms_run[1]:scan=1.1.3475.7	62.05602	2	1375.6529	1375.6614	M	Q	2	14
PSM	IIQLLDDYPK	2832	sp|P14869|RLA0_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3016.2	49.20278	2	1216.660647	1216.670340	K	C	17	27
PSM	QEALEWLIR	2833	sp|Q6P1B1|XPP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:28	ms_run[1]:scan=1.1.3845.4	72.50101	2	1139.5929	1139.5970	R	E	606	615
PSM	TLAMDTILANAR	2834	sp|O88958|GNPI1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3053.13	50.2447	2	1289.695247	1288.680921	K	F	161	173
PSM	SHIQIPAGLTELLQGYTVEVLR	2835	tr|A0A0A6YX73|A0A0A6YX73_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:1	ms_run[1]:scan=1.1.3888.5	73.69601	3	2478.3439	2478.3477	M	Q	2	24
PSM	GVNWAAFHPTMPLIVSGADDR	2836	sp|Q8CIE6|COPA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3434.3	60.92658	3	2254.109771	2253.100072	R	Q	207	228
PSM	QLLLTPSAVVIVEDAK	2837	sp|Q9WTI7|MYO1C_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:28	ms_run[1]:scan=1.1.3880.5	73.4832	2	1677.9488	1677.9548	R	V	939	955
PSM	GVEITGFPEAQALGLQVFHAGTALK	2838	sp|Q64737|PUR2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3688.7	68.11819	3	2554.348571	2553.359124	K	D	351	376
PSM	ALTDELAALGR	2839	sp|Q9EQ06|DHB11_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3131.5	52.43702	2	1128.604047	1128.613888	R	T	198	209
PSM	FRPSFPASSPYVTTVGGTSFK	2840	sp|O89023|TPP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2981.15	48.25233	3	2232.102371	2232.121519	K	N	373	394
PSM	LAPDYDALDVANK	2841	sp|P62751|RL23A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2766.17	42.199	2	1403.682047	1403.693260	R	I	140	153
PSM	SSTPEEVKK	2842	sp|P18760|COF1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1577.17	9.188	2	1004.515247	1003.518590	K	R	23	32
PSM	EALLSSAVDHGSDEAR	2843	sp|P80314|TCPB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2310.16	29.54097	3	1656.765671	1655.775092	R	F	139	155
PSM	MVDDGSGEVQVWR	2844	sp|Q62468|VILI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2699.20	40.32253	2	1477.655447	1476.666728	K	I	392	405
PSM	LAQAVHER	2845	sp|Q9QYR9|ACOT2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1634.17	10.76778	2	922.491247	922.498464	R	H	161	169
PSM	ASEAHCHYVTVK	2846	sp|Q9R0H0|ACOX1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	6-UNIMOD:4	ms_run[1]:scan=1.1.1702.16	12.6568	3	1400.640971	1400.650684	R	V	526	538
PSM	DSETGENIR	2847	sp|P38647|GRP75_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1772.18	14.5938	2	1019.442647	1019.451967	K	Q	626	635
PSM	EDAANNYAR	2848	sp|P05213|TBA1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1722.18	13.2022	2	1022.434447	1022.441737	K	G	97	106
PSM	VLGTAGSEEGK	2849	sp|P47199|QOR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1766.18	14.42587	2	1046.514247	1046.524404	K	K	176	187
PSM	LRGDHSDQQAELGR	2850	sp|Q9EPL9|ACOX3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1731.20	13.4509	3	1580.752271	1580.765531	R	E	385	399
PSM	TDFQQGCAK	2851	sp|Q9DCM0|ETHE1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	7-UNIMOD:4	ms_run[1]:scan=1.1.1759.19	14.2308	2	1053.450847	1053.454944	R	T	164	173
PSM	KHGVYNPNK	2852	sp|P08249|MDHM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1575.20	9.133583	2	1055.541447	1055.551228	K	I	157	166
PSM	EEFEHQQK	2853	sp|P63017|HSP7C_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1623.18	10.46913	2	1073.467847	1073.477788	K	E	590	598
PSM	NNQITNNQR	2854	sp|P09041|PGK2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1632.13	10.71562	2	1100.527047	1100.532283	K	I	31	40
PSM	GGNIGDGGGAADR	2855	sp|Q01853|TERA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1706.19	12.77003	2	1115.487247	1115.495563	R	V	587	600
PSM	KGESGQSWPR	2856	sp|Q9R0Q7|TEBP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1761.20	14.28765	2	1130.541047	1130.546871	R	L	79	89
PSM	HPESNFCSR	2857	sp|P00329|ADH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	7-UNIMOD:4	ms_run[1]:scan=1.1.1685.20	12.18442	2	1132.463247	1132.471991	K	S	106	115
PSM	RNPGVQEGYK	2858	sp|Q9DCL9|PUR6_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1696.20	12.49512	2	1146.569847	1146.578171	K	F	111	121
PSM	VDCTANTNTCNK	2859	sp|P27773|PDIA3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	3-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.1641.21	10.96173	2	1396.558247	1396.571113	K	Y	83	95
PSM	ACQIAHDHTDHVIR	2860	sp|Q64462|CP4B1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	2-UNIMOD:4	ms_run[1]:scan=1.1.1747.19	13.89298	3	1671.775871	1671.789972	R	Q	249	263
PSM	VAGILTVK	2861	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2342.3	30.4155	2	799.509047	799.516740	K	G	251	259
PSM	NDIGATVHELSR	2862	sp|P16331|PH4H_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2325.10	29.95597	3	1310.649671	1310.657878	R	D	100	112
PSM	VGASFLQR	2863	sp|P05202|AATM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2317.14	29.73482	2	876.475447	876.481751	R	F	140	148
PSM	FPFAANSR	2864	sp|O08749|DLDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2360.6	30.9083	2	908.441847	908.450451	K	A	421	429
PSM	FPFAANSR	2865	sp|O08749|DLDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2367.9	31.103	2	908.441847	908.450451	K	A	421	429
PSM	LADIGACAQIVHK	2866	sp|Q8VCN5|CGL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	7-UNIMOD:4	ms_run[1]:scan=1.1.2364.7	31.01805	3	1394.725871	1394.734020	K	R	165	178
PSM	LFAEGDTPVPHAR	2867	sp|Q91X91|NADC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2340.8	30.36652	3	1408.701071	1408.709913	K	R	285	298
PSM	HELIEFR	2868	sp|Q68FD5|CLH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2305.4	29.39452	2	942.483647	942.492316	K	R	1502	1509
PSM	VEITYTPK	2869	sp|O88844|IDHC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2226.11	27.22325	2	949.503247	949.512048	K	D	152	160
PSM	LSQVAPVLK	2870	sp|Q9DBE0|CSAD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2323.10	29.89967	2	953.583047	953.590967	R	E	434	443
PSM	WTSPQVIK	2871	sp|Q8CHT0|AL4A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2365.10	31.04828	2	957.519447	957.528367	R	E	540	548
PSM	YYAGWADK	2872	sp|P47738|ALDH2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2286.6	28.8708	2	972.426647	972.434132	R	Y	150	158
PSM	LTDIHGNALQYNK	2873	sp|Q9Z0S1|BPNT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2184.13	26.06178	3	1485.747071	1485.757592	K	E	262	275
PSM	FIPQMTAGK	2874	sp|P51174|ACADL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2329.13	30.07123	2	991.506847	991.516088	K	C	157	166
PSM	SLHTLFGDK	2875	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2255.14	28.02247	2	1016.521647	1016.529095	K	L	89	98
PSM	NCDEFLVK	2876	sp|P28271|ACOC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	2-UNIMOD:4	ms_run[1]:scan=1.1.2367.17	31.10968	2	1023.464047	1023.469532	R	K	49	57
PSM	ICEEAFTR	2877	sp|Q60597|ODO1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	2-UNIMOD:4	ms_run[1]:scan=1.1.2182.13	26.00482	2	1024.455847	1024.464781	K	S	565	573
PSM	ENFSCLTR	2878	sp|P14152|MDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	5-UNIMOD:4	ms_run[1]:scan=1.1.2257.14	28.07432	2	1025.452447	1025.460030	K	L	150	158
PSM	LGPGVSDICK	2879	sp|Q61207|SAP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	9-UNIMOD:4	ms_run[1]:scan=1.1.2297.10	29.17552	2	1044.520847	1044.527381	R	N	232	242
PSM	HFGYTSYSVSNSVK	2880	sp|P10605|CATB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2318.11	29.7604	3	1574.726471	1574.736522	K	E	224	238
PSM	RGPGLYYVDSEGNR	2881	sp|O55234|PSB5_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2274.15	28.54632	3	1581.738671	1581.753569	K	I	166	180
PSM	CQVLLEAAR	2882	sp|Q9JLJ2|AL9A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:4	ms_run[1]:scan=1.1.2345.12	30.50525	2	1058.545847	1058.554265	R	I	74	83
PSM	TAAYVNAIEK	2883	sp|P26443|DHE3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2219.18	27.03528	2	1078.557247	1078.565875	R	V	536	546
PSM	EVNLAVENAK	2884	sp|Q9JLJ2|AL9A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2172.16	25.7293	2	1085.562847	1085.571688	K	A	50	60
PSM	VTVAGLAGKDPVQCSR	2885	sp|Q99LX0|PARK7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	14-UNIMOD:4	ms_run[1]:scan=1.1.2347.17	30.56517	3	1656.853571	1656.861740	K	D	33	49
PSM	RQDLFIVSK	2886	sp|P45376|ALDR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2321.17	29.84937	2	1104.620647	1104.629144	K	L	70	79
PSM	RTALVANTSNMPVAAR	2887	sp|P50516|VATA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2267.18	28.35355	3	1670.879171	1670.888623	K	E	308	324
PSM	LFAYPDTHR	2888	sp|P24270|CATA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2227.3	27.24428	3	1118.539871	1118.550893	R	H	355	364
PSM	DLEEAEEYK	2889	sp|P48428|TBCA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2263.14	28.23942	2	1124.479247	1124.487350	K	E	87	96
PSM	LHVDPENFR	2890	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2288.2	28.91887	3	1125.547571	1125.556707	K	L	97	106
PSM	EAESSPFVER	2891	sp|P08113|ENPL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2185.20	26.0962	2	1149.523447	1149.530218	K	L	548	558
PSM	DSACQLESLK	2892	sp|Q91VI7|RINI_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	4-UNIMOD:4	ms_run[1]:scan=1.1.2345.16	30.50858	2	1149.524647	1149.533589	K	L	191	201
PSM	LVASAYSIAQK	2893	sp|Q9Z0S1|BPNT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2359.7	30.88715	2	1149.632247	1149.639374	R	A	11	22
PSM	SDFDPGQDTYQHPPK	2894	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2213.18	26.86883	3	1730.745071	1730.753629	R	D	535	550
PSM	SIEEAAASCIK	2895	sp|Q9DBK0|ACO12_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	9-UNIMOD:4	ms_run[1]:scan=1.1.2324.20	29.9361	2	1177.564847	1177.564889	K	F	532	543
PSM	VIATFACSGEK	2896	sp|Q9JLJ2|AL9A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	7-UNIMOD:4	ms_run[1]:scan=1.1.2248.16	27.83008	2	1181.568047	1181.575060	R	E	39	50
PSM	AAGCDFNNVVK	2897	sp|P52760|RIDA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	4-UNIMOD:4	ms_run[1]:scan=1.1.2248.18	27.83175	2	1193.542047	1193.549907	K	T	68	79
PSM	FAAATGATPIAGR	2898	sp|P14206|RSSA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2297.17	29.18137	2	1202.629647	1202.640771	K	F	90	103
PSM	MMEVAAADVQR	2899	sp|Q9D1A2|CNDP2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2362.18	30.97248	2	1219.569647	1219.568928	R	L	44	55
PSM	TCAELVQEAAR	2900	sp|Q8VDK1|NIT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	2-UNIMOD:4	ms_run[1]:scan=1.1.2229.18	27.31153	2	1246.586447	1246.597586	K	L	62	73
PSM	YQAVTATLEEK	2901	sp|P19253|RL13A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2323.19	29.90718	2	1251.624447	1251.634683	K	R	149	160
PSM	DISTNYYASQK	2902	sp|P08113|ENPL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2289.17	28.95845	2	1288.584647	1288.593546	K	K	672	683
PSM	QELSIGTNCDR	2903	sp|Q61847|MEP1B_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	9-UNIMOD:4	ms_run[1]:scan=1.1.2185.21	26.09703	2	1291.578047	1291.582664	K	I	137	148
PSM	ITWSNPPAQGAR	2904	sp|P05201|AATC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2331.18	30.13135	2	1296.650047	1296.657484	R	I	294	306
PSM	NCIIVSPDAGGAK	2905	sp|Q9CS42|PRPS2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	2-UNIMOD:4	ms_run[1]:scan=1.1.2314.19	29.65477	2	1300.634847	1300.644536	R	R	164	177
PSM	VPGAWTEACGQK	2906	sp|Q8R0Y6|AL1L1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	9-UNIMOD:4	ms_run[1]:scan=1.1.2248.20	27.83342	2	1302.597047	1302.602671	K	L	230	242
PSM	GVQVETISPGDGR	2907	sp|P26883|FKB1A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	18		ms_run[1]:scan=1.1.2300.19	29.26843	2	1313.6477	1313.6570	M	T	2	15
PSM	GAVDGGLSIPHSTK	2908	sp|P47962|RL5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2239.19	27.58217	2	1337.683647	1337.693929	K	R	165	179
PSM	VLIGGDETPEGQK	2909	sp|O70475|UGDH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2240.19	27.60963	2	1341.674447	1341.677610	R	A	178	191
PSM	MAEHNLLLHLR	2910	sp|Q99KR3|LACB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2365.2	31.04162	4	1345.720094	1345.728875	K	K	256	267
PSM	EEAQAEIEQYR	2911	sp|Q9CR51|VATG1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2319.19	29.79518	2	1364.609647	1364.620824	K	L	38	49
PSM	GAAQNIIPASTGAAK	2912	tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2291.19	29.01478	2	1368.727447	1368.736128	R	A	199	214
PSM	AVPREELFVTSK	2913	sp|Q9JII6|AK1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2356.15	30.81163	2	1374.744647	1374.750716	K	L	69	81
PSM	ENPSANYTTMMK	2914	sp|Q3UZZ6|ST1D1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2374.20	31.30382	2	1385.585847	1385.595537	K	E	234	246
PSM	AHGGYSVFAGVGER	2915	sp|P56480|ATPB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2377.21	31.38803	2	1405.664847	1405.673862	K	T	226	240
PSM	SQGGEPTYNVAVGR	2916	sp|Q9JJV2|PROF2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2275.19	28.57782	2	1433.677647	1433.689906	K	A	92	106
PSM	RVMVDANEVPIQK	2917	sp|Q9D964|GATM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2314.10	29.64725	3	1497.786071	1497.797348	K	M	369	382
PSM	IQVLQQQADDAEER	2918	tr|D3Z2H9|D3Z2H9_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2356.16	30.8133	2	1641.796447	1641.795828	K	A	14	28
PSM	ELVSCSNCTDYQAR	2919	sp|P26638|SYSC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	5-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.2224.20	27.17498	2	1701.698647	1701.708670	R	R	391	405
PSM	ANIIYPGHGPVIHNAEAK	2920	sp|Q99KR3|LACB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2224.14	27.16997	3	1899.991571	1899.995531	K	I	192	210
PSM	DELHHSGWNTCSSCFGDSTK	2921	sp|P17563|SBP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	11-UNIMOD:4,14-UNIMOD:4	ms_run[1]:scan=1.1.2317.19	29.73898	4	2323.909294	2323.922244	K	S	70	90
PSM	KWLPELVDR	2922	sp|Q9EQ20|MMSA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2663.2	39.30408	3	1154.637671	1154.644794	K	A	331	340
PSM	VLLPGLQK	2923	sp|P97807|FUMH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2634.3	38.49738	2	866.551047	866.558939	K	L	203	211
PSM	FHADFLLQHVK	2924	sp|Q8R164|BPHL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2606.8	37.73017	3	1353.707471	1353.719356	R	G	250	261
PSM	YIVPMITVDGKR	2925	sp|Q9JII6|AK1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2773.4	42.385	3	1390.752671	1390.764257	R	V	298	310
PSM	LYSEFLGK	2926	sp|O35660|GSTM6_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2641.8	38.70052	2	955.494647	955.501484	K	Q	137	145
PSM	GASAINWTLIHGDK	2927	sp|Q8R0Y6|AL1L1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2689.4	40.02747	3	1481.753471	1481.762677	R	K	115	129
PSM	NLGSVDFPR	2928	sp|Q91XE4|ACY3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2606.10	37.73185	2	1003.500247	1003.508694	R	T	224	233
PSM	SVVLMSHLGRPDGVPMPDK	2929	sp|P09411|PGK1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2705.5	40.48168	4	2034.026494	2034.039052	K	Y	57	76
PSM	FSASQFWDDCRK	2930	sp|O35488|S27A2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	10-UNIMOD:4	ms_run[1]:scan=1.1.2683.4	39.86568	3	1545.655571	1545.667063	K	Y	292	304
PSM	ASAELALGENNEVLK	2931	sp|P05202|AATM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2731.4	41.21622	3	1556.790971	1556.804602	K	S	108	123
PSM	GENLSLVVHGPGDIR	2932	sp|Q64442|DHSO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2657.4	39.14393	3	1561.814471	1561.821255	K	L	7	22
PSM	GAEILADTFK	2933	sp|Q9CWS0|DDAH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2750.4	41.74638	2	1063.544447	1063.554976	R	D	150	160
PSM	NNIPFQMHTVELR	2934	sp|Q64471|GSTT1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2768.8	42.24733	3	1597.792871	1597.803496	K	K	24	37
PSM	LVLLGESAVGK	2935	sp|P35278|RAB5C_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2743.10	41.55805	2	1084.640447	1084.649211	K	S	24	35
PSM	LLADPTGAFGK	2936	sp|P99029|PRDX5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2738.6	41.41376	2	1088.576847	1088.586610	R	A	145	156
PSM	ITALDEFATK	2937	sp|P16546|SPTN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2731.7	41.21872	2	1107.571447	1107.581191	K	L	523	533
PSM	QSMWTSTISSHLATK	2938	sp|Q8BVI4|DHPR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2674.13	39.62117	3	1676.814671	1676.819206	K	H	107	122
PSM	IEAACFATIK	2939	sp|Q9D6R2|IDH3A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	5-UNIMOD:4	ms_run[1]:scan=1.1.2593.11	37.3719	2	1122.566647	1122.574331	K	D	327	337
PSM	MIAEAIPELK	2940	sp|P08249|MDHM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:35	ms_run[1]:scan=1.1.2685.8	39.9222	2	1129.596047	1129.605297	K	A	315	325
PSM	VLLLSQDYGK	2941	sp|Q62261|SPTB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2693.8	40.14163	2	1134.624047	1134.628475	K	H	549	559
PSM	HGYIGEFEIIDDHR	2942	sp|P62245|RS15A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2701.10	40.3715	3	1699.785071	1699.795434	K	A	44	58
PSM	LDIDSAPITAR	2943	sp|P52480|KPYM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2652.13	39.01485	2	1170.615847	1170.624452	R	N	33	44
PSM	FVGAVDPIMEK	2944	sp|Q91YI0|ARLY_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2753.8	41.82862	2	1204.608047	1204.616196	R	F	13	24
PSM	HLGLPVFNTVK	2945	sp|Q9WUM5|SUCA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2740.19	41.4812	2	1223.694447	1223.702643	K	E	95	106
PSM	LQESLMSVAPR	2946	sp|P61922|GABT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2633.16	38.47995	2	1229.636447	1229.643808	K	G	143	154
PSM	LTGSLSGWTSPK	2947	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2627.15	38.31167	2	1232.631047	1232.640102	K	D	234	246
PSM	VFVTGPLPAEGR	2948	sp|Q91Z53|GRHPR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2699.14	40.31752	2	1241.668447	1241.676822	K	A	9	21
PSM	FYDVALDTGDK	2949	sp|Q9DBE0|CSAD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2711.12	40.65863	2	1242.568047	1242.576833	K	V	342	353
PSM	YMACCLLYR	2950	sp|P05213|TBA1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	4-UNIMOD:4,5-UNIMOD:4	ms_run[1]:scan=1.1.2744.12	41.58745	2	1248.535647	1248.545356	K	G	312	321
PSM	GVLFYGPPGCGK	2951	sp|Q01853|TERA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	10-UNIMOD:4	ms_run[1]:scan=1.1.2738.12	41.41879	2	1250.608247	1250.611779	K	T	513	525
PSM	DYETATLSDIK	2952	sp|P57780|ACTN4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2712.16	40.69077	2	1254.588447	1254.597963	R	A	441	452
PSM	MAEDLILYGTK	2953	sp|Q91YI0|ARLY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:35	ms_run[1]:scan=1.1.2758.12	41.97066	2	1268.623047	1268.632240	R	E	256	267
PSM	GELASYDMQLR	2954	tr|Q91VA7|Q91VA7_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2686.10	39.95092	2	1281.593447	1281.602337	K	R	122	133
PSM	DHADVSNQLYACYAIGK	2955	sp|P62814|VATB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	12-UNIMOD:4	ms_run[1]:scan=1.1.2789.15	42.84792	3	1923.867071	1923.878512	K	D	414	431
PSM	LGVQVVITDPEK	2956	sp|P11983|TCPA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2773.17	42.39585	2	1296.719647	1296.728917	K	L	248	260
PSM	VGIPVVAVESDPK	2957	sp|Q9DBM2|ECHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2792.14	42.93162	2	1308.720447	1308.728917	R	Q	317	330
PSM	EAFQEALAAAGDK	2958	sp|P10639|THIO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2736.17	41.36578	2	1319.628447	1319.635745	K	L	9	22
PSM	HACVPVDFEEVHVSSNADEEDIR	2959	sp|P70404|IDHG1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	3-UNIMOD:4	ms_run[1]:scan=1.1.2741.12	41.50352	4	2653.170894	2653.171459	R	N	79	102
PSM	LNISFPATGCQK	2960	sp|P62754|RS6_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	10-UNIMOD:4	ms_run[1]:scan=1.1.2749.13	41.72435	2	1334.660047	1334.665272	K	L	3	15
PSM	NTNAGAPPGTAYQSPLSLSR	2961	sp|Q60597|ODO1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2759.16	42.00222	3	2000.991971	2000.991568	R	S	82	102
PSM	MLLQQDLSSYK	2962	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:35	ms_run[1]:scan=1.1.2607.16	37.7653	2	1340.652047	1340.664603	R	F	318	329
PSM	FHADFLLQHVK	2963	sp|Q8R164|BPHL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2597.4	37.47595	3	1353.707471	1353.719356	R	G	250	261
PSM	SLVANLAAANCYK	2964	sp|P55264|ADK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	11-UNIMOD:4	ms_run[1]:scan=1.1.2753.15	41.83445	2	1393.688647	1393.702385	R	K	149	162
PSM	SLVANLAAANCYK	2965	sp|P55264|ADK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	11-UNIMOD:4	ms_run[1]:scan=1.1.2746.18	41.64728	2	1393.688647	1393.702385	R	K	149	162
PSM	GNPTVEVDLYTAK	2966	sp|P17182|ENOA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2700.19	40.35042	2	1405.703047	1405.708910	R	G	16	29
PSM	SGLFVVGPESAGAHPGPACYR	2967	sp|Q8K010|OPLA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	19-UNIMOD:4	ms_run[1]:scan=1.1.2770.18	42.31192	3	2128.008671	2128.016009	R	K	364	385
PSM	TGTAEMSSILEER	2968	sp|Q03265|ATPA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2738.20	41.42545	2	1422.656647	1422.666059	K	I	46	59
PSM	MVNSNLASVEELK	2969	sp|P35486|ODPA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2697.16	40.26177	2	1432.714047	1432.723180	R	E	324	337
PSM	APQVSTPTLVEAAR	2970	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2598.7	37.50607	3	1438.769771	1438.777993	K	N	439	453
PSM	GDVTTQVALQPALK	2971	sp|P09671|SODM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2684.11	39.9027	2	1439.790447	1439.798394	K	F	76	90
PSM	FVIGGPQGDAGLTGR	2972	sp|Q3THS6|METK2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2779.19	42.56535	2	1443.737047	1443.747027	R	K	250	265
PSM	ENLQLNQEVGAIR	2973	sp|Q60866|PTER_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2706.17	40.52015	2	1482.771447	1482.779056	R	E	69	82
PSM	ESVGGDTEAMASALR	2974	sp|Q924M7|MPI_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2701.20	40.37983	2	1492.671047	1492.682772	K	N	181	196
PSM	FKLEAPDADELPR	2975	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2781.6	42.61145	3	1499.751671	1499.762009	K	S	522	535
PSM	VCIVGSGNWGSAVAK	2976	sp|Q3ULJ0|GPD1L_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	2-UNIMOD:4	ms_run[1]:scan=1.1.2769.18	42.28372	2	1503.744447	1503.750398	K	I	8	23
PSM	LINSLYPEGQAPVK	2977	sp|Q9WVA4|TAGL2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2715.18	40.7792	2	1527.821647	1527.829694	K	K	65	79
PSM	YYTSASGDEMVSLK	2978	sp|P07901|HS90A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2615.17	37.98207	2	1549.690847	1549.697025	R	D	466	480
PSM	IQPLPSYEDQNFR	2979	sp|Q5U5V2|HYKK_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2769.20	42.28539	2	1605.772447	1605.778721	K	V	37	50
PSM	MLLEYTDSSYDEK	2980	sp|P10649|GSTM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:35	ms_run[1]:scan=1.1.2595.19	37.43357	2	1608.679247	1608.686520	R	R	19	32
PSM	MDATANDVPSPYEVK	2981	sp|P27773|PDIA3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2624.19	38.2308	2	1635.742047	1635.745038	K	G	434	449
PSM	LSAEERDQLLPNLR	2982	sp|P61458|PHS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2668.10	39.44873	3	1652.877071	1652.884583	R	A	8	22
PSM	HWPFMVVNDAGRPK	2983	sp|P63017|HSP7C_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2627.9	38.30665	3	1652.816171	1652.824566	K	V	89	103
PSM	ADNFEYSDPVDGSISK	2984	sp|Q9D0F9|PGM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2761.21	42.06278	2	1742.756247	1742.763525	K	N	471	487
PSM	DIQDSLTVSNEVQTAK	2985	sp|P47754|CAZA2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2776.21	42.48273	2	1746.857247	1746.863573	K	E	211	227
PSM	FAREEIIPVAPEYDK	2986	sp|P45952|ACADM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2745.9	41.61253	3	1775.899871	1775.909401	K	S	55	70
PSM	KGESVMVVPTLSEEEAK	2987	sp|O08709|PRDX6_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2644.13	38.78997	3	1831.914071	1831.923731	K	Q	183	200
PSM	AIEQADLLQEEDESPR	2988	sp|P61967|AP1S1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2717.21	40.83933	2	1841.863247	1841.864301	K	S	134	150
PSM	IAQNFGLQHLSSGHLLR	2989	sp|Q9WUR9|KAD4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2664.17	39.34397	3	1890.012371	1890.022414	R	E	25	42
PSM	AQTLPTSVVTITSESSPGKR	2990	sp|Q62261|SPTB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2643.16	38.76394	3	2058.087071	2058.095698	R	E	2325	2345
PSM	WSSCNIFSTQDHAAAAIAK	2991	sp|P50247|SAHH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	4-UNIMOD:4	ms_run[1]:scan=1.1.2774.20	42.4263	3	2076.959471	2076.968724	R	A	76	95
PSM	SGYQQAASEHGLVVIAPDTSPR	2992	sp|Q9R0P3|ESTD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2682.17	39.84863	3	2282.124971	2282.129124	K	G	65	87
PSM	DSAFGLLR	2993	sp|Q921I1|TRFE_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2927.2	46.73752	2	877.457447	877.465767	K	V	316	324
PSM	KWDTCAPEVILHAVGGK	2994	sp|Q9Z0S1|BPNT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	5-UNIMOD:4	ms_run[1]:scan=1.1.2976.3	48.10209	4	1879.952094	1879.961454	K	L	245	262
PSM	ENPTTFMGHYLHEVAR	2995	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2842.4	44.33965	4	1900.880494	1900.889017	K	R	153	169
PSM	YNLGLDLR	2996	sp|P26443|DHE3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2859.8	44.82538	2	962.510447	962.518531	K	T	528	536
PSM	IGIGELITR	2997	sp|Q5SW19|CLU_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2925.2	46.68045	2	970.573247	970.581131	K	S	813	822
PSM	TSNHAIVLAQLITR	2998	sp|Q9R0H0|ACOX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2852.4	44.62128	3	1535.866571	1535.878376	K	G	183	197
PSM	LLCGLLSDR	2999	sp|P34884|MIF_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	3-UNIMOD:4	ms_run[1]:scan=1.1.2879.8	45.39398	2	1045.553047	1045.559016	K	L	79	88
PSM	YPQLLSGIR	3000	sp|P50247|SAHH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2837.6	44.20227	2	1045.581847	1045.592030	K	G	143	152
PSM	KPIGLCCIAPVLAAK	3001	sp|Q9D172|GAL3A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	6-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=1.1.2880.7	45.42083	3	1609.901471	1609.904791	K	V	169	184
PSM	YAEIYGISSAHTLLR	3002	sp|Q99K67|AASS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2883.7	45.50343	3	1692.876371	1692.883521	K	G	708	723
PSM	TGVAPIIDVVR	3003	sp|P14115|RL27A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2927.7	46.74168	2	1138.663647	1138.671009	K	S	95	106
PSM	FEDENFILK	3004	sp|P17742|PPIA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2882.4	45.47335	2	1153.558847	1153.565540	K	H	83	92
PSM	FLDGIYVSEK	3005	tr|A0A140T8T4|A0A140T8T4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2887.10	45.61765	2	1169.589247	1169.596841	K	G	175	185
PSM	LVLGDNSLAIR	3006	sp|P05201|AATC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2876.7	45.30973	2	1169.669447	1169.676822	R	E	87	98
PSM	GILLYGPPGTGK	3007	sp|Q01853|TERA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2800.9	43.15268	2	1171.651247	1171.660110	R	T	240	252
PSM	AVLFCLSEDK	3008	sp|P18760|COF1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	5-UNIMOD:4	ms_run[1]:scan=1.1.2858.10	44.79838	2	1180.571247	1180.579811	K	K	35	45
PSM	SPGASLLPVLTK	3009	sp|Q8VC30|TKFC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2995.10	48.6273	2	1181.692647	1181.701974	K	A	511	523
PSM	ALQYAFFAEK	3010	sp|Q9DBM2|ECHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2969.7	47.915	2	1186.602847	1186.602260	R	S	265	275
PSM	IAIDAGFHHFDSASVYNTEDHVGEAIR	3011	sp|Q91WR5|AK1CL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2916.11	46.43175	5	2970.396118	2970.389649	K	S	40	67
PSM	LLLNNDNLLR	3012	sp|P47753|CAZA1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2927.8	46.74252	2	1196.678847	1196.687721	R	E	38	48
PSM	IQLINNMLDK	3013	sp|P09411|PGK1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2914.6	46.3719	2	1200.647647	1200.653644	K	V	221	231
PSM	LSGFGQSGIFSK	3014	sp|O09174|AMACR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2814.11	43.54885	2	1226.623447	1226.629538	R	V	106	118
PSM	AAQLGFGGVYVR	3015	sp|Q9D7B6|ACAD8_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2883.12	45.50762	2	1236.651647	1236.661507	K	T	79	91
PSM	VGDAIPSVEVFEGEPGKK	3016	sp|P99029|PRDX5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2846.11	44.45677	3	1856.954171	1856.951994	K	V	54	72
PSM	VAGALAEEGMGLEEITKR	3017	sp|Q8VC30|TKFC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2888.7	45.64315	3	1872.953171	1872.961513	K	V	163	181
PSM	FASCFYGPFR	3018	sp|P10518|HEM2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	4-UNIMOD:4	ms_run[1]:scan=1.1.2991.9	48.51838	2	1250.543647	1250.554265	K	D	200	210
PSM	GLPDNISSVLNK	3019	sp|Q91ZJ5|UGPA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2956.11	47.54865	2	1255.670647	1255.677216	R	L	96	108
PSM	LGVSCEVIDLR	3020	sp|Q6P3A8|ODBB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	5-UNIMOD:4	ms_run[1]:scan=1.1.2911.13	46.29428	2	1259.647247	1259.654373	K	T	293	304
PSM	QQCLQFFYK	3021	sp|P28825|MEP1A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	3-UNIMOD:4	ms_run[1]:scan=1.1.2830.15	44.0099	2	1260.588047	1260.596129	K	M	340	349
PSM	EVGADFTIQVGK	3022	sp|Q64442|DHSO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2856.14	44.7444	2	1262.641247	1262.650667	K	E	215	227
PSM	AETFTFHSDICTLPEK	3023	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	11-UNIMOD:4	ms_run[1]:scan=1.1.2804.14	43.27027	3	1894.885271	1894.877115	K	E	528	544
PSM	LETDPDIIISR	3024	sp|Q8VDG5|PPCS_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2814.13	43.55052	2	1270.667247	1270.676882	K	A	232	243
PSM	EGMNIVEAMER	3025	sp|P17742|PPIA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2930.15	46.8342	2	1277.570247	1277.574407	K	F	134	145
PSM	PMFIVNTNVPR	3026	sp|P34884|MIF_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	18		ms_run[1]:scan=1.1.2876.16	45.31723	2	1286.6717	1286.6800	M	A	2	13
PSM	ASYGHSMVVDPWGTVVAR	3027	sp|Q8VDK1|NIT1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2959.10	47.63272	3	1930.933271	1930.935967	R	C	263	281
PSM	EVYELLDTPGR	3028	sp|Q9DCL9|PUR6_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2856.17	44.7469	2	1290.636647	1290.645582	K	V	20	31
PSM	DIFQEIYDKK	3029	sp|O88844|IDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2929.2	46.79462	3	1297.645271	1297.655418	K	Y	225	235
PSM	FNVNNTILHPEIVECR	3030	sp|Q11136|PEPD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	15-UNIMOD:4	ms_run[1]:scan=1.1.2929.11	46.80212	3	1953.966071	1953.973081	K	V	169	185
PSM	YALYDASFETK	3031	sp|Q9R0P5|DEST_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2806.12	43.32397	2	1306.600647	1306.608134	R	E	82	93
PSM	GPLPLLGQSEAVK	3032	sp|Q8BH86|GLUCM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2868.14	45.08853	2	1307.735047	1307.744902	R	T	59	72
PSM	SKVDQIQEIVTGNPTVIK	3033	sp|Q9JKF1|IQGA1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2890.11	45.70223	3	1968.077471	1968.089156	K	M	1036	1054
PSM	VEVRPMMYVALTYDHR	3034	sp|Q9D2G2|ODO2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2925.14	46.69047	3	1978.969871	1978.975723	K	L	411	427
PSM	QAEMLDDLMEK	3035	sp|Q9WTP6|KAD2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2924.18	46.66533	2	1321.582647	1321.589389	R	R	107	118
PSM	EGIECEVINLR	3036	sp|Q9D051|ODPB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	5-UNIMOD:4	ms_run[1]:scan=1.1.2906.17	46.15658	2	1330.649447	1330.655101	K	T	259	270
PSM	KFDEVLVNHFCEEFGK	3037	sp|Q61316|HSP74_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	11-UNIMOD:4	ms_run[1]:scan=1.1.2957.13	47.57847	3	1996.925771	1996.935299	R	K	235	251
PSM	GCDVVVIPAGVPR	3038	sp|P08249|MDHM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	2-UNIMOD:4	ms_run[1]:scan=1.1.2870.18	45.14937	2	1337.705647	1337.712556	K	K	92	105
PSM	GCDVVVIPAGVPR	3039	sp|P08249|MDHM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	2-UNIMOD:4	ms_run[1]:scan=1.1.2883.16	45.51095	2	1337.705647	1337.712556	K	K	92	105
PSM	TLTIVDTGIGMTK	3040	sp|P07901|HS90A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2967.13	47.86332	2	1348.717447	1348.727203	R	A	88	101
PSM	VPFPIPEPDGCK	3041	sp|Q9Z0J0|NPC2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	11-UNIMOD:4	ms_run[1]:scan=1.1.2934.15	46.9491	2	1354.653447	1354.659124	R	S	83	95
PSM	IYQLQVLANCR	3042	sp|P50431|GLYC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	10-UNIMOD:4	ms_run[1]:scan=1.1.2867.16	45.06145	2	1376.718047	1376.723455	K	A	320	331
PSM	GYISPYFINTSK	3043	sp|P63038|CH60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2925.15	46.6913	2	1388.691647	1388.697617	R	G	222	234
PSM	TLVLSNLSYSATK	3044	sp|P09405|NUCL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2847.18	44.49073	2	1395.752447	1395.760946	K	E	488	501
PSM	LDYDEDASAMLR	3045	sp|Q99L47|F10A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2864.18	44.97717	2	1397.604047	1397.613295	K	E	210	222
PSM	FTDEEVDELYR	3046	sp|Q3THE2|ML12B_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2814.17	43.55385	2	1414.622847	1414.625240	R	E	134	145
PSM	VECVGDDIAWMK	3047	sp|Q9Z2V4|PCKGC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	3-UNIMOD:4	ms_run[1]:scan=1.1.2971.11	47.97263	2	1421.629647	1421.631923	K	F	305	317
PSM	VNDTIQIDLETGK	3048	sp|P62702|RS4X_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2805.19	43.30219	2	1444.738447	1444.740939	K	I	156	169
PSM	VAQSLCGEDLIIK	3049	sp|Q921F2|TADBP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	6-UNIMOD:4	ms_run[1]:scan=1.1.2843.16	44.37722	2	1444.749447	1444.759566	K	G	239	252
PSM	VAGMDVELTVEER	3050	sp|P62259|1433E_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2877.17	45.34587	2	1446.690847	1446.702445	K	N	30	43
PSM	FVTVQTISGTGALR	3051	sp|P05202|AATM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2854.17	44.68952	2	1448.792047	1448.798728	R	V	126	140
PSM	ARFEELNADLFR	3052	sp|P17156|HSP72_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2898.5	45.9198	3	1479.738371	1479.747027	R	G	303	315
PSM	SFTSSCPVSAFVPK	3053	sp|Q8R0F8|FAHD1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	6-UNIMOD:4	ms_run[1]:scan=1.1.2956.19	47.55533	2	1512.719247	1512.728266	K	E	127	141
PSM	DTTVQSLTLQPTVK	3054	sp|Q8CC88|VWA8_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2832.20	44.07115	2	1529.824447	1529.830088	R	G	809	823
PSM	LGGVEFNIDLPNKK	3055	sp|O08997|ATOX1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2873.4	45.22362	3	1542.830471	1542.840593	K	V	26	40
PSM	NHQGLLLMDTTFR	3056	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2877.7	45.33752	3	1544.766971	1544.776947	R	D	559	572
PSM	VAEGIFETEAPGGYK	3057	sp|Q9CPV4|GLOD4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2795.18	43.01913	2	1566.749047	1566.756589	K	F	110	125
PSM	FVGINASDINYSAGR	3058	sp|Q8BGC4|PTGR3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2886.21	45.59873	2	1582.770847	1582.773970	R	Y	71	86
PSM	VYALPEDLVEVKPK	3059	sp|Q99K51|PLST_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2907.9	46.17803	3	1598.882771	1598.891960	R	M	600	614
PSM	GECYGLHAFVVPIR	3060	sp|Q9R0H0|ACOX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	3-UNIMOD:4	ms_run[1]:scan=1.1.2972.2	47.9923	3	1616.803571	1616.813333	R	E	197	211
PSM	DLEQGVVGAHGLLCR	3061	sp|Q91Z53|GRHPR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	14-UNIMOD:4	ms_run[1]:scan=1.1.2833.7	44.08897	3	1622.809571	1622.819875	K	L	44	59
PSM	VAVSADPNVPNVIVTR	3062	sp|Q99PT1|GDIR1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2871.20	45.17982	2	1649.907047	1649.910070	R	L	59	75
PSM	AVSIQTGYLIQSTGPK	3063	sp|Q9JMD3|STA10_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2861.20	44.89277	2	1661.895047	1661.898836	R	S	164	180
PSM	MGAVFMDAPVSGGVGAAR	3064	sp|Q99L13|3HIDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2990.13	48.49303	2	1691.804047	1691.812346	K	S	149	167
PSM	LFVEDSIHDQFVQK	3065	sp|Q8R0Y6|AL1L1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2808.6	43.3743	3	1703.843471	1703.851886	R	V	713	727
PSM	LYTVNAEECAAALER	3066	sp|Q78JN3|ECI3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	9-UNIMOD:4	ms_run[1]:scan=1.1.2844.18	44.4066	2	1708.800447	1708.809035	K	M	281	296
PSM	GPDGLTALEATDNQAIK	3067	sp|P62774|MTPN_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2853.21	44.66408	2	1712.851647	1712.858094	K	A	98	115
PSM	DYAVSTVPVADSLHLK	3068	sp|Q9CWS0|DDAH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2987.2	48.40392	3	1713.883571	1713.893751	K	S	160	176
PSM	SWCPDCVEAEPVIR	3069	sp|Q9CQM5|TXD17_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	3-UNIMOD:4,6-UNIMOD:4	ms_run[1]:scan=1.1.2912.20	46.32802	2	1716.756247	1716.759977	K	E	41	55
PSM	AGTQIENIDEDFRDGLK	3070	sp|P57780|ACTN4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2884.13	45.53617	3	1919.922071	1919.922485	K	L	68	85
PSM	SALFAQINQGESITHALK	3071	sp|P40124|CAP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2954.12	47.49377	3	1927.005371	1927.016326	R	H	254	272
PSM	AGAIAPCEVTVPAQNTGLGPEK	3072	sp|P14869|RLA0_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	7-UNIMOD:4	ms_run[1]:scan=1.1.2815.18	43.5834	3	2179.085471	2179.094319	R	T	113	135
PSM	TGLSIHEVYGQSETGISSATLR	3073	sp|Q91VA0|ACSM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2832.21	44.07198	3	2305.155371	2305.155004	R	E	355	377
PSM	RLVGQGATAVLLDVPDSEGEAQAK	3074	tr|A2AFQ2|A2AFQ2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2910.19	46.27139	3	2423.268671	2423.265617	K	K	29	53
PSM	HIDIHPENTHILDGNAADLQAECDAFEEK	3075	sp|O88958|GNPI1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	23-UNIMOD:4	ms_run[1]:scan=1.1.2949.17	47.36463	4	3301.504094	3301.494585	K	I	96	125
PSM	VNLAELFK	3076	sp|P99029|PRDX5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3177.2	53.7327	2	932.525647	932.533118	K	G	72	80
PSM	LSVLLLER	3077	sp|Q8VC30|TKFC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3001.2	48.79103	2	941.581847	941.590967	R	M	435	443
PSM	EGWPLDIR	3078	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3029.2	49.55408	2	984.494247	984.502881	K	V	371	379
PSM	EGWPLDIR	3079	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3035.4	49.7248	2	984.494247	984.502881	K	V	371	379
PSM	ISVNDFIIK	3080	sp|Q8BMF4|ODP2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3167.2	53.45296	2	1047.588647	1047.596447	K	A	469	478
PSM	LILPGLISSR	3081	sp|P17563|SBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3171.6	53.56718	2	1067.660447	1067.670280	K	I	94	104
PSM	AVAIDLPGLGR	3082	sp|Q8VCR7|ABHEB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3074.4	50.83358	2	1080.619647	1080.629144	R	S	64	75
PSM	GLAGAVSELLR	3083	sp|P26039|TLN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3173.5	53.6226	2	1084.615247	1084.624058	K	S	614	625
PSM	DLETPIIVVK	3084	sp|Q62468|VILI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3107.5	51.76365	2	1125.657647	1125.664526	R	Q	690	700
PSM	LAVNMVPFPR	3085	sp|A2AQ07|TBB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3076.6	50.89207	2	1142.618447	1142.627035	K	L	253	263
PSM	IHFPLATYAPVISAEK	3086	sp|P05213|TBA1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3148.6	52.92538	3	1755.949271	1755.955957	R	A	265	281
PSM	VFLTTAEVISQQVSDK	3087	sp|P06801|MAOX_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3135.7	52.55242	3	1763.917271	1763.930531	K	H	477	493
PSM	VEFDTFGELK	3088	sp|P97807|FUMH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3012.3	49.0969	2	1183.568647	1183.576105	R	V	49	59
PSM	RTGAIVDVPVGEELLGR	3089	sp|Q03265|ATPA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3039.7	49.84212	3	1779.979871	1779.984297	K	V	133	150
PSM	VTSLVVDIVPR	3090	sp|Q8R146|APEH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3064.7	50.55079	2	1196.701847	1196.712873	K	Q	340	351
PSM	QRVEAEVGESLFQEAHEVVLK	3091	sp|Q99L20|GSTT3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3125.11	52.27172	4	2396.230494	2396.233589	R	A	196	217
PSM	TLMNLGGLAVAR	3092	sp|Q9WVA4|TAGL2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3061.5	50.46217	2	1214.668647	1214.680527	R	D	128	140
PSM	LLDEVFFSEK	3093	sp|Q9R1P0|PSA4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3205.6	54.52258	2	1225.615247	1225.623055	K	I	55	65
PSM	GVVFSVTTVDLK	3094	sp|Q9QYB1|CLIC4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3101.6	51.5981	2	1263.698047	1263.707454	K	R	49	61
PSM	TENLLGSYFPK	3095	sp|P97371|PSME1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3091.13	51.3281	2	1267.636647	1267.644853	K	K	25	36
PSM	FPVGAALLTGDGR	3096	sp|P56389|CDD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3052.10	50.21475	2	1272.672447	1272.682636	R	I	36	49
PSM	IFNTWLGDPSK	3097	sp|P61922|GABT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3044.14	49.9916	2	1276.636847	1276.645188	R	N	378	389
PSM	FLSDVYPDGFK	3098	sp|Q91ZA3|PCCA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3029.14	49.5641	2	1286.608047	1286.618304	K	G	499	510
PSM	GEMMDLQHGSLFLQTPK	3099	sp|P16125|LDHB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3073.7	50.80797	3	1930.918871	1930.928104	K	I	61	78
PSM	VHLVGIDIFTGK	3100	sp|P63242|IF5A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3084.11	51.12688	2	1297.728847	1297.739423	K	K	56	68
PSM	AATFFGCIGIDK	3101	sp|P55264|ADK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	7-UNIMOD:4	ms_run[1]:scan=1.1.3139.7	52.66718	2	1298.623847	1298.632909	K	F	99	111
PSM	VLTPELYAELR	3102	sp|Q04447|KCRB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3059.11	50.40962	2	1302.712647	1302.718353	K	A	33	44
PSM	ILVTLLHTLER	3103	tr|Q80X81|Q80X81_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3022.11	49.37098	2	1306.784447	1306.797272	R	V	362	373
PSM	DVLSVAFSSDNR	3104	sp|P68040|RACK1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3038.13	49.8183	2	1308.622247	1308.630994	K	Q	107	119
PSM	TVTNAVVTVPAYFNDSQR	3105	sp|P63017|HSP7C_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3074.12	50.84027	3	1980.985271	1980.990505	K	Q	138	156
PSM	LAGQIFLGGSIVR	3106	sp|P17563|SBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3144.10	52.81332	2	1329.768447	1329.776871	R	G	345	358
PSM	IFNNGADLSGITEENAPLK	3107	sp|P07758|A1AT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3072.11	50.78316	3	2001.982271	2002.000735	R	L	329	348
PSM	KHISQISVADDDDESLLGHLMIVGK	3108	sp|P70349|HINT1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3107.12	51.76948	4	2719.377294	2719.385081	K	K	58	83
PSM	LLLDGAPLIAIHK	3109	sp|Q3UGR5|HDHD2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3142.2	52.74923	3	1372.835771	1372.844222	R	A	133	146
PSM	DVLDQWTNMEK	3110	sp|Q3UNX5|ACSM3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3195.10	54.23918	2	1377.618047	1377.623466	K	A	57	68
PSM	VTAVIPCFPYAR	3111	tr|G3UXL2|G3UXL2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	7-UNIMOD:4	ms_run[1]:scan=1.1.3133.11	52.49854	2	1392.710647	1392.722393	R	Q	85	97
PSM	ANDDIIVNWVNR	3112	sp|Q99K51|PLST_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3155.11	53.1327	2	1427.705247	1427.715727	K	T	519	531
PSM	VFEFQLASEDMK	3113	tr|Q91WT7|Q91WT7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3132.15	52.47355	2	1442.668647	1442.675167	K	V	283	295
PSM	NVGLDIEAEVPAVK	3114	sp|P42932|TCPQ_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3095.11	51.43725	2	1452.773847	1452.782410	K	D	477	491
PSM	LADTLQILAQEGAK	3115	sp|Q60928|GGT1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3048.16	50.1081	2	1469.797047	1469.808959	K	A	212	226
PSM	VLGPLIGVQVPQEK	3116	sp|Q61133|GSTT2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3083.12	51.09873	2	1475.862647	1475.871165	K	V	118	132
PSM	LGVEFDEITADDR	3117	sp|P04117|FABP4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3032.18	49.65118	2	1478.688847	1478.688903	K	K	67	80
PSM	DAILFPSFIHSQK	3118	sp|P24270|CATA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3169.2	53.50828	3	1501.784471	1501.792915	R	R	157	170
PSM	EILQSVYECIEK	3119	sp|Q64516|GLPK_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	9-UNIMOD:4	ms_run[1]:scan=1.1.3126.14	52.30285	2	1509.733847	1509.738496	K	T	59	71
PSM	GVVDSEDIPLNLSR	3120	sp|Q9CQN1|TRAP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3026.15	49.48257	2	1512.773447	1512.778387	R	E	391	405
PSM	DVGGIVLANACGPCIGQWDRK	3121	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	11-UNIMOD:4,14-UNIMOD:4	ms_run[1]:scan=1.1.3197.18	54.30325	3	2285.105171	2285.104506	R	D	438	459
PSM	VKPGYLGTAFAHYDVQVIDEQGNVLPPGK	3122	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3175.17	53.68943	4	3111.603294	3111.602936	K	E	379	408
PSM	FTVTPSTTQVVGILK	3123	sp|P47754|CAZA2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3172.20	53.60693	2	1589.896447	1589.902859	K	I	179	194
PSM	IIPGFMCQGGDFTR	3124	sp|P17742|PPIA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	7-UNIMOD:4	ms_run[1]:scan=1.1.3101.19	51.60895	2	1597.731647	1597.738119	R	H	56	70
PSM	TCAEAVVPSYVPIVK	3125	sp|P36552|HEM6_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	2-UNIMOD:4	ms_run[1]:scan=1.1.3040.18	49.87998	2	1631.844247	1631.859280	K	K	345	360
PSM	GFGFVTFDDHDPVDK	3126	sp|O88569|ROA2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3046.7	50.0432	3	1694.753171	1694.757651	R	I	154	169
PSM	VVDGAVGAQWLAEFKK	3127	sp|Q8BMF4|ODP2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3112.6	51.9016	3	1716.915371	1716.919906	R	Y	617	633
PSM	GYENGNFVGPTIISNVKPSMTCYK	3128	sp|Q9EQ20|MMSA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	22-UNIMOD:4	ms_run[1]:scan=1.1.3057.19	50.35987	3	2675.263571	2675.272359	K	E	392	416
PSM	VGINYQPPTVVPGGDLAK	3129	sp|P05213|TBA1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3034.19	49.70865	2	1823.974647	1823.978149	K	V	353	371
PSM	KVDFVSGLYTLCGAGDIK	3130	sp|O09173|HGD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	12-UNIMOD:4	ms_run[1]:scan=1.1.3201.9	54.41067	3	1941.980171	1941.987000	K	S	109	127
PSM	ATEIGGILVNTPEDPNLSK	3131	sp|P34914|HYES_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3132.21	52.47855	2	1967.013447	1967.021136	K	I	421	440
PSM	KIPIVSSMAEPLVAGPDEK	3132	sp|Q9JIL4|NHRF3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3001.13	48.80022	3	1980.055271	1980.060165	K	G	467	486
PSM	DVQIGDIVTVGECRPLSK	3133	sp|P62281|RS11_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	13-UNIMOD:4	ms_run[1]:scan=1.1.3066.14	50.61417	3	1985.009471	1985.025176	R	T	119	137
PSM	TFDLYANVRPCVSIEGYK	3134	sp|Q9D6R2|IDH3A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	11-UNIMOD:4	ms_run[1]:scan=1.1.3132.14	52.47272	3	2131.032071	2131.040826	K	T	117	135
PSM	EATSVLGEHQALCTITSFPR	3135	sp|P97494|GSH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	13-UNIMOD:4	ms_run[1]:scan=1.1.3063.18	50.53087	3	2216.079371	2216.089567	K	L	130	150
PSM	QDVSPFNVVAWHGNYTPYK	3136	sp|O09173|HGD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3180.12	53.82365	3	2221.053971	2221.059253	K	Y	258	277
PSM	QAPQTVHLPSGETLDVFDAAER	3137	sp|P28271|ACOC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3143.16	52.78947	3	2380.161071	2380.165903	K	Y	737	759
PSM	VVNAPIFHVNSDDPEAVMYVCK	3138	sp|Q60597|ODO1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	21-UNIMOD:4	ms_run[1]:scan=1.1.3159.18	53.24738	3	2503.187471	2503.187567	R	V	467	489
PSM	FAVELEGEQPISVPPSTNHTVYR	3139	sp|Q8CHT0|AL4A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3023.8	49.40375	3	2569.280171	2569.281267	K	G	175	198
PSM	LLSHCLLVTLASHHPADFTPAVHASLDK	3140	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	5-UNIMOD:4	ms_run[1]:scan=1.1.3005.4	48.90533	6	3049.584741	3049.580761	K	F	101	129
PSM	AVFVDLEPTVIDEVR	3141	sp|P05213|TBA1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3489.2	62.45285	3	1700.890871	1700.898502	R	T	65	80
PSM	ANWYFLLAR	3142	sp|P45952|ACADM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3466.2	61.8033	2	1152.601047	1152.608014	K	S	198	207
PSM	DRVTSAVEALLSADSASR	3143	sp|P56399|UBP5_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3465.2	61.77593	3	1846.946471	1846.938469	R	K	145	163
PSM	DLFQVIYNVK	3144	sp|P98078|DAB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3555.5	64.33588	2	1237.662247	1237.670674	K	K	164	174
PSM	FVSISDLFVPK	3145	sp|Q61598|GDIB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3566.3	64.64512	2	1250.684647	1250.691075	K	D	380	391
PSM	LYIGLAGLATDVQTVAQR	3146	sp|Q9R1P1|PSB3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3610.5	65.88071	3	1888.040171	1888.041812	R	L	49	67
PSM	GGELGLAMASFLK	3147	sp|O55137|ACOT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3504.2	62.88113	2	1292.672647	1292.679859	K	G	234	247
PSM	ALLAYAFALAGNK	3148	sp|Q61838|PZP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3467.5	61.83307	2	1321.730247	1321.739423	K	A	1160	1173
PSM	ILTDIVWPVIAK	3149	sp|Q9DBL7|COASY_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3612.6	65.93937	2	1366.816047	1366.822424	K	L	438	450
PSM	LLIQSEFPSLLK	3150	sp|P97816|S100G_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3450.8	61.36458	2	1386.807247	1386.812253	K	A	34	46
PSM	ELNDFISYLQR	3151	sp|P27773|PDIA3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3431.4	60.84447	2	1396.688247	1396.698680	R	E	472	483
PSM	WGEAGAEYVVESTGVFTTMEK	3152	tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3590.10	65.31623	3	2290.049471	2290.046365	K	A	85	106
PSM	ALQLGTLFSPAEALK	3153	sp|P42125|ECI1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3541.10	63.93962	2	1557.870247	1557.876644	R	V	192	207
PSM	TGALCWFLDEAAAR	3154	sp|Q9CQ60|6PGL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	5-UNIMOD:4	ms_run[1]:scan=1.1.3587.7	65.23309	2	1579.742247	1579.745313	R	L	232	246
PSM	LLGQFTLIGIPPAPR	3155	sp|P38647|GRP75_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3598.12	65.54183	2	1591.939847	1591.944999	K	G	499	514
PSM	LLGQFTLIGIPPAPR	3156	sp|P38647|GRP75_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3616.14	66.0618	2	1591.939847	1591.944999	K	G	499	514
PSM	VGVDPLIIPTDYWK	3157	sp|Q6P1B1|XPP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3634.15	66.58663	2	1614.859047	1614.865745	R	K	117	131
PSM	VLVLDFVTPTPLGTR	3158	sp|Q9JMH6|TRXR1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3649.12	67.00855	2	1626.928647	1626.934494	K	W	152	167
PSM	DFTATFGPLDSLNTR	3159	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3519.13	63.30737	2	1653.798847	1653.799851	K	L	1022	1037
PSM	ETVVEVPQVTWEDIGGLEDVKR	3160	sp|Q01853|TERA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3477.18	62.12253	3	2497.269671	2497.270034	R	E	466	488
PSM	FLPGAHVFPGGVLDAADSSPDWVR	3161	sp|P11930|NUD19_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3474.19	62.03772	3	2509.237871	2509.239009	R	L	40	64
PSM	EILVGDVGATITDPFK	3162	sp|Q9R0P5|DEST_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3523.17	63.42602	2	1673.884447	1673.887603	K	H	54	70
PSM	HLVDPIDDIFLAAQK	3163	sp|Q8BH86|GLUCM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3460.3	61.63955	3	1693.889471	1693.903922	K	I	456	471
PSM	GGLPSQAFEYILYNK	3164	sp|P49935|CATH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3510.13	63.05352	2	1698.854647	1698.861723	K	G	181	196
PSM	VGLLEALLPGQPEAVAR	3165	sp|P51855|GSHB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3619.5	66.14111	3	1731.981071	1731.988320	R	L	314	331
PSM	GLAPVQAYLHIPDIIK	3166	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3463.3	61.72178	3	1746.997271	1747.003242	R	V	89	105
PSM	TLASLSPETSLFIIASK	3167	sp|P06745|G6PI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3626.16	66.35405	2	1776.984647	1776.987317	K	T	195	212
PSM	QCIVAHPVNPPYYVPLVELVPHPETAPATMDR	3168	sp|Q99KP3|CRYL1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	2-UNIMOD:4	ms_run[1]:scan=1.1.3454.18	61.4883	4	3609.822094	3609.811231	K	T	140	172
PSM	FFNQLFSGLDPHALAGR	3169	sp|Q9DBE0|CSAD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3510.4	63.04433	3	1888.949171	1888.958417	R	I	89	106
PSM	APPSVFAQVPQAPPVLVFK	3170	sp|P05201|AATC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	18		ms_run[1]:scan=1.1.3644.5	66.86417	3	1991.1179	1991.1239	M	L	2	21
PSM	QFLSGELEVELTPQGTLAER	3171	sp|Q9D0K2|SCOT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3483.12	62.28959	3	2216.127371	2216.132478	R	I	125	145
PSM	HGLEVIYMIEPIDEYCVQQLK	3172	sp|P07901|HS90A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	16-UNIMOD:4	ms_run[1]:scan=1.1.3598.18	65.54684	3	2576.267171	2576.265483	K	E	515	536
PSM	HGLEVIYMIEPIDEYCVQQLK	3173	sp|P07901|HS90A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	16-UNIMOD:4	ms_run[1]:scan=1.1.3596.15	65.48705	3	2576.267171	2576.265483	K	E	515	536
PSM	GLQVVEHACSVTSLMLGETMPSITK	3174	sp|Q9EQ20|MMSA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	9-UNIMOD:4	ms_run[1]:scan=1.1.3497.18	62.69817	3	2687.334071	2687.333245	R	D	141	166
PSM	DIFQEIFDK	3175	sp|P54071|IDHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3712.2	68.77272	2	1153.559847	1153.565540	K	H	264	273
PSM	EEWDIIEGLIR	3176	sp|Q9CQ62|DECR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3762.8	70.18124	2	1371.699447	1371.703431	K	K	320	331
PSM	DICNDVLSLLEK	3177	sp|P63101|1433Z_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	3-UNIMOD:4	ms_run[1]:scan=1.1.3800.8	71.25172	2	1417.705047	1417.712281	R	F	92	104
PSM	TAFDDAIAELDTLNEDSYK	3178	sp|P61982|1433G_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3768.6	70.35392	3	2129.957171	2129.964075	K	D	199	218
PSM	IVSQLLTLMDGLK	3179	sp|Q01853|TERA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3737.4	69.46995	2	1429.818047	1429.821438	R	Q	324	337
PSM	CANLFEALVGTLK	3180	sp|Q4KML4|ABRAL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:4	ms_run[1]:scan=1.1.3781.6	70.72515	2	1434.768247	1434.754087	R	A	39	52
PSM	LISQIVSSITASLR	3181	sp|P05213|TBA1B_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3734.6	69.38403	2	1486.866247	1486.871893	R	F	230	244
PSM	FDVNTSAVQVLIEHIGNLDR	3182	sp|Q68FD5|CLH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3794.10	71.08483	3	2239.155671	2239.159696	K	A	1075	1095
PSM	SSEELPVDIILASVG	3183	sp|Q9QZE5|COPG1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3929.2	74.77192	2	1527.795647	1527.803205	R	-	860	875
PSM	DSIFSNLIGQLDYK	3184	sp|Q8BMS1|ECHA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3799.13	71.22781	2	1611.801447	1611.814438	R	G	423	437
PSM	PVILPPEVAIGALGAIK	3185	sp|P53395|ODB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3752.3	69.8892	3	1657.010471	1657.017829	K	A	411	428
PSM	IEQLSPFPFDLLLK	3186	sp|Q60597|ODO1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3855.5	72.7934	2	1658.928247	1658.928346	R	E	930	944
PSM	DLVDDVFTVTEDEIK	3187	sp|Q9QZX7|SRR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3825.18	71.9509	2	1736.837447	1736.835627	R	Y	254	269
PSM	CLGELICTLNAANVPAGTEVVCAPPTAYIDFAR	3188	sp|P17751|TPIS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:4,7-UNIMOD:4,22-UNIMOD:4	ms_run[1]:scan=1.1.3811.13	71.55708	4	3562.729294	3562.725847	K	Q	71	104
PSM	VLVCGAGPVGMVTLLVAK	3189	sp|Q64442|DHSO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	4-UNIMOD:4	ms_run[1]:scan=1.1.3718.14	68.95302	2	1783.006247	1783.009984	K	A	176	194
PSM	GTGELTQLLNSMLTAIK	3190	sp|P70695|F16P2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3880.6	73.48653	2	1788.957247	1788.965536	K	A	27	44
PSM	FVEFFGPGVAQLSIADR	3191	sp|P28271|ACOC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3650.15	67.04108	2	1851.945847	1851.951935	K	A	277	294
PSM	LTFVDFLTYDVLDQNR	3192	sp|P48774|GSTM5_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3890.2	73.74323	3	1957.971071	1957.978543	K	I	156	172
PSM	AEGLWNLFLPLETDPEK	3193	tr|D3Z7X0|D3Z7X0_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3861.6	72.96018	2	1970.996447	1970.998944	K	K	201	218
PSM	VNPTVFFDITADDEPLGR	3194	sp|P17742|PPIA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	18		ms_run[1]:scan=1.1.3700.19	68.45427	2	2004.9829	2004.9787	M	V	2	20
PSM	ELLTEFGYKGEETPVIVGSALCALEQR	3195	sp|Q8BFR5|EFTU_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	22-UNIMOD:4	ms_run[1]:scan=1.1.3747.20	69.76131	3	3008.519171	3008.516489	R	D	201	228
PSM	DLSLSCTAQFLQYFLEK	3196	sp|Q80W22|THNS2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	6-UNIMOD:4	ms_run[1]:scan=1.1.3935.3	74.94908	3	2062.002371	2062.008129	K	K	114	131
PSM	FYPEDVSEELIQDITQR	3197	sp|P26041|MOES_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3797.7	71.16658	3	2080.993571	2080.995316	K	L	84	101
PSM	SISTSLPVLDLIDAIAPNAVR	3198	sp|Q3V0K9|PLSI_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3905.3	74.15939	3	2164.207271	2164.210334	K	Q	547	568
PSM	APVVMGSSEDVQEFLEIYR	3199	sp|Q9QXD6|F16P1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3692.4	68.22359	3	2168.047571	2168.045971	K	K	315	334
PSM	ASVPEGFLSELTQQLAQATGK	3200	sp|P34884|MIF_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3831.5	72.108	3	2174.118071	2174.121913	R	P	13	34
PSM	IVVLGFAGGNIASVPSNLLLLK	3201	sp|Q3UNZ8|QORL2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3824.5	71.91206	3	2194.305971	2194.308926	R	N	259	281
PSM	ILQNIQVFDFTFSPEEMK	3202	sp|Q9JII6|AK1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	17-UNIMOD:35	ms_run[1]:scan=1.1.3730.7	69.27139	3	2201.071871	2201.071458	R	Q	270	288
PSM	ELEAVCQDVLSLLDNYLIK	3203	sp|P61982|1433G_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	6-UNIMOD:4	ms_run[1]:scan=1.1.3940.3	75.0673	3	2234.148671	2234.150436	K	N	92	111
PSM	SLSALGNVISALAEGSTYVPYR	3204	sp|Q61768|KINH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3834.4	72.19144	3	2267.172071	2267.179762	K	D	257	279
PSM	IVAPELYIAVGISGAIQHLAGMK	3205	sp|Q99LC5|ETFA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3875.9	73.34005	3	2350.301171	2350.308274	K	D	269	292
PSM	IVAPELYIAVGISGAIQHLAGMK	3206	sp|Q99LC5|ETFA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3878.4	73.4241	3	2350.301171	2350.308274	K	D	269	292
PSM	DLGTQLAPIIQEFFHSEQYR	3207	sp|Q78JT3|3HAO_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3870.5	73.20274	3	2391.184871	2391.185910	K	T	136	156
PSM	NSGMPPGAAAIAVLPVTLDTPMNR	3208	sp|Q8BVI4|DHPR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3694.8	68.27991	3	2392.223471	2392.224287	K	K	165	189
PSM	IELVVVGPEAPLAAGIVGDLTSAGVR	3209	sp|Q64737|PUR2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3848.11	72.59332	3	2502.405971	2502.405740	K	C	67	93
PSM	YCTFNDDIQGTASVAVAGLLAALR	3210	sp|P06801|MAOX_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	2-UNIMOD:4	ms_run[1]:scan=1.1.3909.5	74.28056	3	2525.262971	2525.258424	K	I	263	287
PSM	DVQTPFVVELEVLDGHEPDGGQR	3211	sp|O55137|ACOT1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3691.9	68.20182	3	2535.225071	2535.224147	R	L	97	120
PSM	TANVFEQICGLQQGDHLALILPR	3212	sp|Q91VA0|ACSM1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	9-UNIMOD:4	ms_run[1]:scan=1.1.3653.14	67.12534	3	2592.346271	2592.348242	R	V	94	117
PSM	DISVLQCHGDCDPLVPLMFGSLTVER	3213	sp|P97823|LYPA1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	7-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=1.1.3803.15	71.34417	3	2957.404871	2957.408536	R	L	163	189
PSM	CNEPAVWSQLAK	3214	sp|Q68FD5|CLH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:4	ms_run[1]:scan=1.1.2792.18	42.93495	2	1402.661647	1401.671085	R	A	1102	1114
PSM	CIPALDSLKPANEDQK	3215	sp|P63038|CH60_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:4	ms_run[1]:scan=1.1.2594.15	37.40282	3	1797.883871	1797.893099	R	I	447	463
PSM	ADFAQACQDAGVR	3216	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	7-UNIMOD:4	ms_run[1]:scan=1.1.2297.20	29.18387	2	1407.615447	1407.620112	R	F	125	138
PSM	MLLQQDLSSYK	3217	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2802.15	43.21482	2	1324.665047	1324.669688	R	F	318	329
PSM	EQGYDVIAYLANIGQKEDFEEAR	3218	sp|P16460|ASSY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3696.16	68.33898	3	2657.269871	2657.260926	K	K	26	49
PSM	DDDIAALVVDNGSGMCK	3219	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=1.1.3672.18	67.65463	2	1820.7933	1820.7915	M	A	2	19
PSM	FPGQLNADLR	3220	sp|A2AQ07|TBB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2636.14	38.56355	2	1129.579247	1129.588007	R	K	242	252
PSM	NFHFVHSSADVDSVVSGTLR	3221	sp|Q8CHT0|AL4A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2832.9	44.06197	4	2173.058894	2173.055231	K	S	318	338
PSM	FVTVQTISGTGALR	3222	sp|P05202|AATM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2838.17	44.23972	2	1448.792047	1448.798728	R	V	126	140
PSM	RTIQFVDWCPTGFK	3223	sp|P05214|TBA3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	9-UNIMOD:4	ms_run[1]:scan=1.1.3066.6	50.6075	3	1753.851971	1753.861011	K	V	339	353
PSM	HALIIYDDLSK	3224	sp|Q03265|ATPA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2617.11	38.03592	2	1286.678247	1286.687053	K	Q	306	317
PSM	HSQAVEELADQLEQTK	3225	sp|Q8VDD5|MYH9_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2766.12	42.19482	3	1824.875171	1824.885371	K	R	1194	1210
PSM	RINVLPLGSGAIAGNPLGVDR	3226	sp|Q91YI0|ARLY_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3178.7	53.76447	3	2088.177671	2088.180372	K	E	193	214
PSM	KNPDSLELIR	3227	sp|Q91YI0|ARLY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2299.5	29.22827	3	1184.651171	1183.656087	K	S	288	298
PSM	CGVIGEIGCSWPLTDSERK	3228	sp|Q60866|PTER_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:385,1-UNIMOD:4,9-UNIMOD:4	ms_run[1]:scan=1.1.3566.9	64.65013	3	2145.9916	2145.9818	K	I	164	183
PSM	VTIEYYSQLK	3229	sp|Q9JLJ2|AL9A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2693.9	40.14247	2	1242.648247	1242.649604	R	T	472	482
PSM	AAVHLEGK	3230	sp|Q64727|VINC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1685.16	12.18108	2	823.450247	823.455202	K	I	489	497
PSM	IAQFLSGIPETVPLSTVNR	3231	sp|Q8VCH0|THIKB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3508.7	62.99245	3	2041.126571	2041.120791	R	Q	103	122
PSM	QHELYVGVLGSK	3232	sp|Q9CWS0|DDAH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:28	ms_run[1]:scan=1.1.2870.17	45.14853	2	1311.6702	1311.6822	R	L	46	58
PSM	QVEAELLPCLR	3233	sp|Q8CG76|ARK72_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:28,9-UNIMOD:4	ms_run[1]:scan=1.1.3641.5	66.78177	2	1309.6623	1309.6695	R	H	214	225
PSM	AAYDAFNSWK	3234	sp|Q8BWF0|SSDH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2794.10	42.98438	2	1171.522247	1171.529824	R	G	92	102
PSM	DHGDVSNQLYACYAIGK	3235	tr|Q91YH6|Q91YH6_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	12-UNIMOD:4	ms_run[1]:scan=1.1.2768.17	42.25483	3	1909.856771	1909.862862	K	D	408	425
PSM	GPNGASAGVAAQHSQCFAAWYGHCPGLK	3236	sp|Q9D051|ODPB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	16-UNIMOD:4,24-UNIMOD:4	ms_run[1]:scan=1.1.2792.20	42.93661	4	2899.293294	2898.307851	R	V	146	174
PSM	QLSQSLLPAIVELAEDAK	3237	sp|Q76MZ3|2AAA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:28	ms_run[1]:scan=1.1.4027.3	76.5815	2	1907.0205	1907.0246	R	W	399	417
PSM	AFIVLSPAYASHDPEALTR	3238	sp|Q8BGA8|ACSM5_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3066.15	50.615	3	2057.040371	2057.058191	K	E	515	534
PSM	KEPGAYDWSSIVQHACELEGDR	3239	sp|P40936|INMT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	16-UNIMOD:4	ms_run[1]:scan=1.1.3196.20	54.27628	3	2546.149271	2546.149602	K	S	101	123
PSM	ASTVRPSFSLGNETLK	3240	sp|Q11136|PEPD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1	ms_run[1]:scan=1.1.2977.20	48.14392	2	1747.9021	1747.9099	M	V	2	18
PSM	TQGPYDVVVLPGGNLGAQNLSESPMVK	3241	sp|Q99LX0|PARK7_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3470.20	61.92764	3	2769.401771	2769.400731	K	E	63	90
PSM	VFEFQLASEDMK	3242	tr|Q91WT7|Q91WT7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3129.15	52.38913	2	1443.665647	1442.675167	K	V	283	295
PSM	AAQGEPQVQFK	3243	sp|P62827|RAN_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1	ms_run[1]:scan=1.1.2673.16	39.59515	2	1243.6109	1243.6192	M	L	2	13
PSM	QTYFLPVIGLVDAEK	3244	sp|O88685|PRS6A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:28	ms_run[1]:scan=1.1.3952.4	75.24288	2	1674.8824	1674.8864	R	L	133	148
PSM	LAVLITNSNVR	3245	sp|Q9R0N0|GALK1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2594.15	37.40282	2	1198.695247	1198.703371	K	H	218	229
PSM	ASVSELACIYSALILHDDEVTVTEDK	3246	sp|P47955|RLA1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1,8-UNIMOD:4	ms_run[1]:scan=1.1.3916.3	74.47708	3	2919.4084	2919.4054	M	I	2	28
PSM	MNVEHEVNLLVEEIHR	3247	sp|Q4KML4|ABRAL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1	ms_run[1]:scan=1.1.3687.5	68.07585	3	2001.9884	2001.9937	-	L	1	17
PSM	QLTEHAVEGDCDFHILK	3248	sp|P29699|FETUA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:28,11-UNIMOD:4	ms_run[1]:scan=1.1.2952.11	47.43798	3	1993.9145	1993.9199	R	Q	104	121
PSM	GGGHVAQIYAIR	3249	sp|P14131|RS16_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2178.6	25.88763	3	1240.657271	1240.667655	K	Q	74	86
PSM	AEEGIAAGGVMDVNTALQEVLK	3250	tr|F7AEH4|F7AEH4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1	ms_run[1]:scan=1.1.3904.4	74.12936	3	2256.1276	2256.1302	M	T	2	24
PSM	SYPYPALTPEQK	3251	tr|A6ZI47|A6ZI47_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1	ms_run[1]:scan=1.1.2303.11	29.34593	3	1434.6882	1434.7022	M	K	2	14
PSM	YLAPTILTDVDPNSK	3252	sp|P47740|AL3A2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3155.18	53.13853	2	1646.870847	1645.856303	R	V	312	327
PSM	ALQSVGQIVGEVLK	3253	sp|P62334|PRS10_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3444.7	61.19573	2	1439.821047	1439.834780	K	Q	49	63
PSM	GVLMYGPPGCGK	3254	sp|P54775|PRS6B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	18	4-UNIMOD:35,10-UNIMOD:4	ms_run[1]:scan=1.1.2738.12	41.41879	2	1251.5992	1250.5782	R	T	201	213
PSM	ATDCVGHDVATLLR	3255	sp|P17710|HXK1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	4-UNIMOD:4	ms_run[1]:scan=1.1.2681.6	39.81242	3	1526.752871	1526.751127	K	D	681	695
PSM	CYSCGEFGHIQK	3256	sp|P53996|CNBP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:385,1-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=1.1.2638.18	38.62392	2	1467.5869	1467.5906	K	D	120	132
PSM	TLQEEIDALESR	3257	tr|Q3UWL8|Q3UWL8_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3139.10	52.66968	2	1402.704247	1402.693989	K	V	93	105
PSM	VLTVINQTQK	3258	sp|Q6ZWV7|RL35_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2200.17	26.51715	2	1142.657447	1142.665923	R	E	57	67
PSM	VEEAYDLAR	3259	sp|O55234|PSB5_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2278.12	28.65613	2	1065.511647	1064.513839	K	R	208	217
PSM	AASGSALLWPR	3260	sp|Q9DB29|IAH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2761.10	42.0536	2	1126.601847	1127.608743	R	V	7	18
PSM	AASGSALLWPR	3261	sp|Q9DB29|IAH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2773.10	42.39	2	1128.604047	1127.608743	R	V	7	18
PSM	NCIVLIDSTPYR	3262	sp|P62242|RS8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	2-UNIMOD:4	ms_run[1]:scan=1.1.2911.20	46.30013	2	1448.720647	1449.728600	K	Q	99	111
PSM	HTGPGILSMANAGPNTNGSQFFICTAK	3263	sp|P17742|PPIA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	9-UNIMOD:35,24-UNIMOD:4	ms_run[1]:scan=1.1.3058.21	50.38958	3	2807.295971	2806.316684	K	T	92	119
PSM	SIVNNGHSFNVEFDDSQDNAVLK	3264	sp|P00920|CAH2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3111.20	51.886	3	2549.161871	2548.183010	K	G	58	81
PSM	YHDFGCALLANLFASEGQPGK	3265	sp|Q91V76|CK054_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	6-UNIMOD:4	ms_run[1]:scan=1.1.3652.10	67.09295	3	2296.063571	2294.079003	K	V	149	170
PSM	KHGVYNPNK	3266	sp|P08249|MDHM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1575.6	9.1219	3	1055.541671	1055.551228	K	I	157	166
PSM	KPPLDAK	3267	tr|E9Q6L7|E9Q6L7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1635.8	10.78723	2	767.446647	767.454139	R	Q	205	212
PSM	KPPLDAK	3268	tr|E9Q6L7|E9Q6L7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1628.9	10.60037	2	767.446647	767.454139	R	Q	205	212
PSM	THTTVSGVAHR	3269	sp|Q99MN9|PCCB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1619.5	10.34653	3	1164.588971	1164.599969	K	A	251	262
PSM	RPQPSGSKEDK	3270	sp|Q8CGK3|LONM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	17		ms_run[1]:scan=1.1.1561.7	8.743733	3	1227.6092	1227.6202	R	D	775	786
PSM	ACQIAHDHTDHVIR	3271	sp|Q64462|CP4B1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	2-UNIMOD:4	ms_run[1]:scan=1.1.1748.17	13.91907	4	1671.777294	1671.789972	R	Q	249	263
PSM	TEERAELAESR	3272	tr|D3Z2H9|D3Z2H9_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1756.14	14.1415	3	1289.613071	1289.621158	R	C	143	154
PSM	ETIEQEK	3273	tr|A2AEH9|A2AEH9_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1660.19	11.48827	2	875.415647	875.423627	K	E	67	74
PSM	RGYPVYSHTEK	3274	sp|Q91XE0|GLYAT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1727.16	13.33743	3	1335.646571	1335.657149	K	S	257	268
PSM	RTAEEEDEADPK	3275	sp|Q9D0J8|PTMS_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1631.14	10.6847	3	1388.596871	1388.605567	K	R	80	92
PSM	YAEEDRR	3276	sp|P38647|GRP75_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1576.16	9.158667	2	937.419447	937.425359	K	K	568	575
PSM	TRFQESEERPK	3277	sp|Q61316|HSP74_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	17		ms_run[1]:scan=1.1.1685.19	12.18358	3	1405.6842	1405.6942	K	L	688	699
PSM	AMQDAEVSK	3278	sp|P38647|GRP75_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1743.13	13.77832	2	977.440847	977.448796	K	S	369	378
PSM	HAYGDQYR	3279	sp|O88844|IDHC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1698.20	12.54968	2	1008.431647	1008.441343	R	A	133	141
PSM	SDRPELTGAK	3280	sp|Q99LC5|ETFA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1742.20	13.75705	2	1072.540847	1072.551287	K	V	207	217
PSM	EGQEDQGLTK	3281	sp|P17225|PTBP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1728.19	13.36718	2	1103.500447	1103.509482	R	D	416	426
PSM	LAGESESNLRK	3282	sp|Q01853|TERA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1740.21	13.7036	2	1202.616847	1202.625515	K	A	278	289
PSM	RPDQQLQGDGK	3283	sp|Q9CY58|PAIRB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1667.20	11.68315	2	1240.603647	1240.616013	R	L	112	123
PSM	EANQQQQFNR	3284	sp|P16546|SPTN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1747.21	13.89465	2	1261.573647	1261.579962	R	N	676	686
PSM	TGVIEHEHPVNK	3285	sp|P98078|DAB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1682.15	12.09548	3	1358.685071	1358.694263	K	I	109	121
PSM	EFCENLSADCR	3286	sp|Q76MZ3|2AAA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	3-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.2341.17	30.40353	2	1399.546247	1399.549650	K	E	308	319
PSM	LVAQLYK	3287	sp|Q9CZU6|CISY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2248.7	27.82257	2	833.492847	833.501090	K	I	376	383
PSM	LVAQLYK	3288	sp|Q9CZU6|CISY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2241.5	27.62543	2	833.492847	833.501090	K	I	376	383
PSM	LQNIQFK	3289	sp|Q07417|ACADS_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2258.5	28.0941	2	889.494447	889.502152	K	L	307	314
PSM	IVVVTAGVR	3290	sp|P16125|LDHB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2312.6	29.58802	2	912.567047	912.575652	K	Q	92	101
PSM	FEEDYVK	3291	sp|Q3UZZ6|ST1D1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2188.14	26.1769	2	928.409047	928.417814	K	K	276	283
PSM	SGEVLVNVK	3292	sp|Q9QZD9|EIF3I_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2194.10	26.34248	2	943.529647	943.533846	K	E	177	186
PSM	EELFVTSK	3293	sp|Q9JII6|AK1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2334.8	30.20495	2	951.482247	951.491313	R	L	73	81
PSM	LSQVAPVLK	3294	sp|Q9DBE0|CSAD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2317.15	29.73565	2	953.583047	953.590967	R	E	434	443
PSM	VINDFVEK	3295	sp|P07758|A1AT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2271.9	28.45693	2	962.503647	962.507297	K	G	174	182
PSM	NEFNLESK	3296	sp|P46638|RB11B_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2185.12	26.08952	2	979.452447	979.461075	R	S	34	42
PSM	NDLMEYAK	3297	sp|P16460|ASSY_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2375.11	31.32395	2	982.434047	982.442982	R	Q	158	166
PSM	LTAAVDELR	3298	sp|Q99MZ7|PECR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2366.11	31.07692	2	986.530247	986.539660	R	A	55	64
PSM	LTDIHGNALQYNK	3299	sp|Q9Z0S1|BPNT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2190.14	26.23347	3	1485.747071	1485.757592	K	E	262	275
PSM	SAGVKVETTEDLVAK	3300	sp|Q9DCW4|ETFB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2266.10	28.3193	3	1545.810371	1545.825003	R	L	234	249
PSM	NQDLEFER	3301	sp|P28271|ACOC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2236.15	27.49692	2	1049.469647	1049.477788	K	N	142	150
PSM	MREIVHIQAGQCGNQIGAK	3302	sp|P99024|TBB5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	12-UNIMOD:4	ms_run[1]:scan=1.1.2239.10	27.57465	4	2109.050894	2109.057162	-	F	1	20
PSM	HFVGMLPEK	3303	sp|Q9R0P5|DEST_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2258.12	28.09995	2	1056.532447	1056.542637	K	D	70	79
PSM	SGKYDLDFK	3304	sp|P17182|ENOA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2223.14	27.14237	2	1071.516047	1071.523676	R	S	254	263
PSM	HEVININLK	3305	sp|O09131|GSTO1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2320.15	29.81978	2	1078.606647	1078.613494	R	N	49	58
PSM	WLNENAVEK	3306	sp|P50247|SAHH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	17		ms_run[1]:scan=1.1.2275.13	28.57282	2	1101.5342	1101.5452	K	V	310	319
PSM	RQDLFIVSK	3307	sp|P45376|ALDR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2327.18	30.01892	2	1104.620647	1104.629144	K	L	70	79
PSM	EGAVTSVNLTK	3308	sp|Q99JW2|ACY1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2197.17	26.43302	2	1117.588447	1117.597903	K	L	245	256
PSM	FVVQNVSAQK	3309	sp|Q61699|HS105_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2179.18	25.92527	2	1118.600447	1118.608408	R	D	462	472
PSM	LQNLQLQPGK	3310	sp|P32020|NLTP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2312.14	29.5947	2	1137.640647	1137.650607	K	A	535	545
PSM	ECCHGDLLECADDR	3311	sp|P07724|ALBU_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	2-UNIMOD:4,3-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.2217.18	26.9793	3	1748.644871	1748.655254	K	A	268	282
PSM	GEFITTVQQR	3312	sp|P14152|MDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2343.18	30.45517	2	1177.600447	1177.609137	K	G	221	231
PSM	VIATFACSGEK	3313	sp|Q9JLJ2|AL9A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	7-UNIMOD:4	ms_run[1]:scan=1.1.2241.17	27.63545	2	1181.568047	1181.575060	R	E	39	50
PSM	NMEEEVAITR	3314	sp|Q60597|ODO1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2366.15	31.08027	2	1190.553847	1190.560138	R	I	920	930
PSM	NMEEEVAITR	3315	sp|Q60597|ODO1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2373.16	31.27305	2	1190.553847	1190.560138	R	I	920	930
PSM	DLSSSDLSTASK	3316	sp|Q61838|PZP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2226.17	27.22827	2	1209.564847	1209.572476	R	I	1240	1252
PSM	DLSSSDLSTASK	3317	sp|Q61838|PZP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2219.19	27.03612	2	1209.564847	1209.572476	R	I	1240	1252
PSM	AVENSSTAIGIR	3318	sp|O70435|PSA3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2192.20	26.29462	2	1216.631047	1216.641165	K	C	30	42
PSM	ILQDSLGGNCR	3319	sp|P28738|KIF5C_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	10-UNIMOD:4	ms_run[1]:scan=1.1.2196.21	26.40807	2	1231.588047	1231.597920	R	T	287	298
PSM	VVSPWNSEDAK	3320	sp|Q9D051|ODPB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2310.19	29.54347	2	1230.578647	1230.588067	K	G	174	185
PSM	DQVANSAFVER	3321	sp|P07901|HS90A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2315.20	29.6836	2	1234.583647	1234.594215	K	L	501	512
PSM	GFGNIATNEDAK	3322	sp|Q8K0E8|FIBB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2223.20	27.14737	2	1235.569447	1235.578230	K	K	292	304
PSM	EQVANSAFVER	3323	sp|P11499|HS90B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2216.19	26.95217	2	1248.600647	1248.609865	K	V	492	503
PSM	EVNVSPCPTDPCQLHK	3324	sp|Q9Z0J0|NPC2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	7-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.2295.20	29.127	3	1879.850471	1879.855668	K	G	36	52
PSM	GQHMSEQFSQVNCLNK	3325	sp|Q61133|GSTT2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	13-UNIMOD:4	ms_run[1]:scan=1.1.2297.19	29.18303	3	1905.839171	1905.846166	K	V	38	54
PSM	VYIASSSGSTAIK	3326	sp|Q9JJU8|SH3L1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2183.21	26.0399	2	1282.668247	1282.676882	R	K	5	18
PSM	ISVYYNEATGGK	3327	sp|P99024|TBB5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2344.19	30.4834	2	1300.618847	1300.629932	R	Y	47	59
PSM	AIVAGDQNVEYK	3328	sp|P97447|FHL1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2235.12	27.47147	2	1305.644847	1305.656481	K	G	107	119
PSM	NDIGATVHELSR	3329	sp|P16331|PH4H_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2319.17	29.79352	2	1310.648447	1310.657878	R	D	100	112
PSM	VASVAHSAPSEAPSCSPFGK	3330	sp|P70290|EM55_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	15-UNIMOD:4	ms_run[1]:scan=1.1.2289.18	28.95928	3	1984.926971	1984.931276	R	K	228	248
PSM	LGTVADCGVPEAR	3331	sp|Q8BWF0|SSDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	7-UNIMOD:4	ms_run[1]:scan=1.1.2326.21	29.99325	2	1343.641047	1343.650350	K	A	75	88
PSM	ALGQNPTNAEVLK	3332	sp|Q60605|MYL6_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2329.19	30.07625	2	1353.717247	1353.725229	R	V	38	51
PSM	AVPREELFVTSK	3333	sp|Q9JII6|AK1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2357.6	30.82762	3	1374.742271	1374.750716	K	L	69	81
PSM	TCSCLDENYYK	3334	sp|O09173|HGD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	2-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=1.1.2275.20	28.57865	2	1451.562847	1451.569717	K	C	415	426
PSM	TCSCLDENYYK	3335	sp|O09173|HGD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	2-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=1.1.2269.20	28.41038	2	1451.562847	1451.569717	K	C	415	426
PSM	QTANVLSGACGLHR	3336	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	10-UNIMOD:4	ms_run[1]:scan=1.1.2239.21	27.58383	2	1482.728247	1482.736145	K	G	92	106
PSM	DSPGETDAFGNSEGK	3337	sp|D3Z7P3|GLSK_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2190.21	26.23932	2	1509.613647	1509.621946	K	E	112	127
PSM	HFGYTSYSVSNSVK	3338	sp|P10605|CATB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2312.10	29.59135	3	1574.726471	1574.736522	K	E	224	238
PSM	HSENILYVSSETIKK	3339	sp|Q91XE0|GLYAT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2302.15	29.3219	3	1746.906371	1746.915215	K	L	128	143
PSM	KVNLAELFK	3340	sp|P99029|PRDX5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2743.2	41.55138	3	1060.618271	1060.628081	K	G	71	80
PSM	RTPFGAYGGLLK	3341	sp|Q8BWT1|THIM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2668.4	39.44373	3	1278.701471	1278.708457	K	D	14	26
PSM	FDLMYAK	3342	sp|P05213|TBA1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2704.2	40.45077	2	886.417447	886.425876	K	R	395	402
PSM	WIGLDLVHGKPR	3343	sp|P11983|TCPA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2646.7	38.8421	3	1389.777371	1389.788104	K	D	485	497
PSM	VDFNVPMK	3344	sp|P09041|PGK2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2641.6	38.69885	2	948.465847	948.473889	R	N	23	31
PSM	LYSEFLGK	3345	sp|O35660|GSTM6_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2647.6	38.86962	2	955.494647	955.501484	K	Q	137	145
PSM	LVPGWTKPITIGR	3346	sp|P54071|IDHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2774.3	42.41212	3	1436.842871	1436.850370	R	H	160	173
PSM	EQLHVSAVEMFAK	3347	sp|A3KMP2|TTC38_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2767.6	42.2177	3	1487.731571	1487.744250	R	G	105	118
PSM	MVEGFFDR	3348	sp|P26443|DHE3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2738.3	41.41127	2	999.439247	999.448402	K	G	69	77
PSM	AEAERDVLFPGYTHLQR	3349	sp|Q91YI0|ARLY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2602.8	37.61767	4	2000.999694	2001.006824	R	A	147	164
PSM	IRAEELLDGIQDK	3350	sp|Q9DCJ9|NPL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2791.7	42.8977	3	1498.791671	1498.799122	K	I	153	166
PSM	YGLAAAVFTK	3351	sp|P47738|ALDH2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2789.6	42.8404	2	1039.563647	1039.570232	K	D	444	454
PSM	KVAGMDVELTVEER	3352	sp|P62259|1433E_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2606.11	37.73269	3	1574.787671	1574.797408	K	N	29	43
PSM	ELEEDFIR	3353	sp|Q9CQI6|COTL1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2686.4	39.94592	2	1049.494647	1049.502940	K	S	119	127
PSM	RIPQSTLSEFYPR	3354	sp|P62814|VATB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2709.7	40.59692	3	1592.822471	1592.831091	K	D	494	507
PSM	AKLDNNTELSFFAK	3355	sp|O88844|IDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2768.7	42.2465	3	1596.799271	1596.814772	R	A	344	358
PSM	DIPEEILNK	3356	sp|Q3UZZ6|ST1D1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2793.8	42.9546	2	1069.559247	1069.565540	K	I	214	223
PSM	AVASAAAALVLK	3357	sp|P26039|TLN1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2774.8	42.41628	2	1083.657247	1083.665195	K	A	674	686
PSM	LVLLGESAVGK	3358	sp|P35278|RAB5C_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2737.12	41.39012	2	1084.640447	1084.649211	K	S	24	35
PSM	LSQYQEPIHLPGVR	3359	sp|Q91ZA3|PCCA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2733.5	41.27192	3	1635.863471	1635.873290	R	V	413	427
PSM	PAQVTPLTALK	3360	sp|Q8K009|AL1L2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2593.12	37.37275	2	1137.667447	1137.675760	K	F	619	630
PSM	TVVTEAGNLLK	3361	sp|Q61207|SAP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2702.12	40.40187	2	1143.640447	1143.649939	K	D	68	79
PSM	HFTEFVPLR	3362	sp|P50516|VATA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2606.16	37.73685	2	1144.592847	1144.602929	K	T	468	477
PSM	YPVNSVNILK	3363	sp|P11983|TCPA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2664.14	39.34146	2	1145.637847	1145.644459	R	A	190	200
PSM	LDIDSAPITAR	3364	sp|P52480|KPYM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2646.14	38.84795	2	1170.615847	1170.624452	R	N	33	44
PSM	RCCLGWDFSTQQVK	3365	sp|Q3TNA1|XYLB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	2-UNIMOD:4,3-UNIMOD:4	ms_run[1]:scan=1.1.2708.14	40.57438	3	1783.806371	1783.813410	R	V	23	37
PSM	LSILYPATTGR	3366	sp|O08709|PRDX6_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2789.12	42.84542	2	1190.655447	1190.665923	K	N	145	156
PSM	ISFTGSVPTGVK	3367	sp|Q9JLJ2|AL9A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2656.2	39.1161	2	1191.640847	1191.649939	K	I	228	240
PSM	HLEINPDHSIIETLR	3368	sp|P07901|HS90A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2733.10	41.2761	3	1785.930371	1785.937347	K	Q	634	649
PSM	WGVISASVDDR	3369	sp|P97494|GSH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2730.11	41.1948	2	1203.577447	1203.588401	R	T	297	308
PSM	AIEMLGGELGSK	3370	sp|P97807|FUMH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2767.13	42.22353	2	1203.606447	1203.616924	R	K	158	170
PSM	ARVDEYLAWQHTGLR	3371	sp|Q64471|GSTT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2669.11	39.4775	3	1813.924271	1813.922366	R	R	93	108
PSM	LPDLPGNYVTK	3372	sp|Q61838|PZP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2754.12	41.85925	2	1215.640247	1215.649939	R	G	1323	1334
PSM	IYVVDVGSEPR	3373	sp|P17563|SBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2601.15	37.59577	2	1232.631047	1232.640102	R	A	104	115
PSM	RAPFDLFENK	3374	sp|P11499|HS90B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2781.12	42.61647	2	1235.620247	1235.629872	R	K	338	348
PSM	LCEGFNEVLR	3375	tr|B2RPU8|B2RPU8_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	2-UNIMOD:4	ms_run[1]:scan=1.1.2732.11	41.24937	2	1235.590247	1235.596858	K	Q	135	145
PSM	EVDIGIPDATGR	3376	sp|Q01853|TERA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2773.14	42.39335	2	1241.616247	1241.625181	R	L	366	378
PSM	WLHGLESQIQSDDYGK	3377	sp|Q62261|SPTB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2712.15	40.68993	3	1874.870771	1874.879892	K	D	1395	1411
PSM	ENIIDLSNANR	3378	sp|A2BIM8|MUP18_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2620.15	38.11593	2	1257.621847	1257.631329	R	C	165	176
PSM	VTHAVVTVPAYFNDAQR	3379	sp|P20029|BIP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2710.14	40.63142	3	1886.971871	1886.963896	K	Q	166	183
PSM	QFADIAYNYR	3380	sp|P16331|PH4H_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2738.13	41.41962	2	1259.594647	1259.593487	K	H	160	170
PSM	TVLVSEGIVTPR	3381	sp|A2ARV4|LRP2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2710.15	40.63225	2	1269.718447	1269.729252	R	G	2227	2239
PSM	RPSANCDPYAVTEAIVR	3382	sp|P15105|GLNA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	6-UNIMOD:4	ms_run[1]:scan=1.1.2686.9	39.95008	3	1917.927971	1917.936696	R	T	341	358
PSM	MTGLVDEAIDTK	3383	sp|Q64727|VINC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2680.17	39.79435	2	1291.625047	1291.632968	K	S	709	721
PSM	AINYLISGYQR	3384	sp|Q61838|PZP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2793.13	42.95878	2	1296.672847	1296.682636	K	Q	1016	1027
PSM	IMNTFSVVPSPK	3385	sp|P68372|TBB4B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	2-UNIMOD:35	ms_run[1]:scan=1.1.2654.19	39.07547	2	1334.689447	1334.690424	R	V	163	175
PSM	YLILNATQAESK	3386	sp|Q9CQV8|1433B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2609.19	37.82208	2	1349.710247	1349.719081	K	V	106	118
PSM	TDFAPQLQSLNK	3387	sp|Q8R164|BPHL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2765.19	42.17277	2	1360.690447	1360.698680	K	K	75	87
PSM	EMSEDLPYEVR	3388	sp|Q8R3P0|ACY2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2711.16	40.66197	2	1366.594447	1366.607482	K	R	80	91
PSM	SLVESVPTPSMNK	3389	sp|Q91VM9|IPYR2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2637.16	38.59377	2	1387.690847	1387.701716	R	E	304	317
PSM	VLAVNQENEHLMEDYER	3390	sp|P57780|ACTN4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2650.16	38.96187	3	2087.955371	2087.958219	K	L	285	302
PSM	GNPTVEVDLYTAK	3391	sp|P17182|ENOA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2689.3	40.02663	3	1405.709471	1405.708910	R	G	16	29
PSM	QLFHPEQLITGK	3392	sp|P05213|TBA1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2759.6	41.99387	3	1409.755871	1409.766700	R	E	85	97
PSM	NAVEECVYEFR	3393	sp|Q61699|HS105_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	6-UNIMOD:4	ms_run[1]:scan=1.1.2736.19	41.36745	2	1414.611447	1414.618715	K	D	637	648
PSM	ETTIQGLDGLSER	3394	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2641.20	38.71053	2	1417.698847	1417.704888	K	C	122	135
PSM	TPSCCYLWCGK	3395	sp|Q62468|VILI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	4-UNIMOD:4,5-UNIMOD:4,9-UNIMOD:4	ms_run[1]:scan=1.1.2631.18	38.42553	2	1430.570047	1430.578113	K	G	550	561
PSM	LVPGWTKPITIGR	3396	sp|P54071|IDHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2762.6	42.0782	3	1436.842871	1436.850370	R	H	160	173
PSM	TTPSYVAFTDTER	3397	sp|P16627|HS71L_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2647.20	38.8813	2	1486.687047	1486.693989	R	L	39	52
PSM	IFVGGLSPDTPEEK	3398	sp|Q60668|HNRPD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2761.19	42.06112	2	1487.741647	1487.750775	K	I	184	198
PSM	GATTNICYNVLDR	3399	sp|Q9QXG4|ACSA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	7-UNIMOD:4	ms_run[1]:scan=1.1.2710.21	40.63725	2	1495.703647	1495.708927	K	N	98	111
PSM	VWCTSLHPELVR	3400	sp|Q91WR5|AK1CL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	3-UNIMOD:4	ms_run[1]:scan=1.1.2659.19	39.21185	2	1495.752247	1495.760569	K	A	85	97
PSM	GLPWSCSADEVQR	3401	sp|O35737|HNRH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	6-UNIMOD:4	ms_run[1]:scan=1.1.2703.20	40.4373	2	1503.668647	1503.677627	R	F	17	30
PSM	EAVAVAPPPSPSLPAK	3402	sp|A2ARV4|LRP2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2675.19	39.65491	2	1529.838447	1529.845344	K	A	4615	4631
PSM	SLTNDWEEHLAVK	3403	sp|P07901|HS90A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2750.3	41.74472	3	1540.743971	1540.752172	K	H	316	329
PSM	NAVTQEFGPVPDTAR	3404	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2692.21	40.12458	2	1600.778047	1600.784535	R	Y	634	649
PSM	ESAAIYFTSGTSGPPK	3405	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2693.20	40.15165	2	1611.772847	1611.778053	R	M	214	230
PSM	GGHVNLTMLGAMQVSK	3406	sp|Q9D0K2|SCOT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2777.7	42.49897	3	1641.822371	1641.833082	R	Y	391	407
PSM	QLEVEPEGLEPEAEK	3407	sp|Q8CGK3|LONM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2715.21	40.7817	2	1695.813447	1695.820311	R	Q	207	222
PSM	YIAIASTTVETAEPEK	3408	sp|P50396|GDIA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2674.21	39.62783	2	1721.866647	1721.872347	K	E	349	365
PSM	LIGPNCPGVINPGECK	3409	sp|Q9WUM5|SUCA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	6-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=1.1.2654.10	39.06797	3	1723.832771	1723.838562	R	I	167	183
PSM	EAVCIVLSDDTCSDEK	3410	sp|Q01853|TERA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	4-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.2746.21	41.64978	2	1839.786447	1839.786645	R	I	66	82
PSM	DQTNDQVTIDSALATQK	3411	sp|P54071|IDHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2778.21	42.53867	2	1846.887447	1846.890851	R	Y	90	107
PSM	SVVLMSHLGRPDGVPMPDK	3412	sp|P09411|PGK1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2706.16	40.51932	3	2034.028571	2034.039052	K	Y	57	76
PSM	WSSCNIFSTQDHAAAAIAK	3413	sp|P50247|SAHH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	4-UNIMOD:4	ms_run[1]:scan=1.1.2780.18	42.59303	3	2076.959471	2076.968724	R	A	76	95
PSM	EGRPSGEAFVELESEDEVK	3414	sp|O35737|HNRH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2714.19	40.7511	3	2105.973071	2105.975309	R	L	50	69
PSM	GHQAALGLMEDEQEQAQQLR	3415	sp|Q8VCA8|SCRN2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2706.18	40.52098	3	2251.057871	2251.065143	R	K	361	381
PSM	IGGIFAFK	3416	sp|P32020|NLTP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2952.2	47.43048	2	851.483647	851.490525	K	V	455	463
PSM	EGWLNFK	3417	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2904.3	46.0887	2	892.436847	892.444303	R	A	189	196
PSM	ASLQNLLSASQAR	3418	sp|P35505|FAAA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2856.3	44.73522	3	1357.721171	1357.731377	R	L	83	96
PSM	GLFIIDDK	3419	sp|O08807|PRDX4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2946.2	47.26778	2	919.492847	919.501484	R	G	204	212
PSM	HVGMAVAGLLADAR	3420	sp|O70435|PSA3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2823.3	43.8	3	1379.725271	1379.734354	R	S	73	87
PSM	VLDPFTIK	3421	sp|P40142|TKT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2929.4	46.79628	2	931.530047	931.537869	R	P	531	539
PSM	GLVLGIYAK	3422	sp|Q9CPY7|AMPL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2817.4	43.62898	2	932.561847	932.569504	K	D	35	44
PSM	ELSLDDFK	3423	sp|P20108|PRDX3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2877.3	45.33418	2	965.462247	965.470577	K	G	85	93
PSM	LSVQCLLH	3424	sp|Q99L20|GSTT3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	5-UNIMOD:4	ms_run[1]:scan=1.1.2849.4	44.5356	2	968.502447	968.511337	K	-	234	242
PSM	IQFGVPLAR	3425	sp|Q60759|GCDH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2885.4	45.55648	2	999.578247	999.586551	R	N	320	329
PSM	DVTLGSVLGR	3426	sp|Q9R0H0|ACOX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2986.2	48.37685	2	1015.558247	1015.566209	K	Y	614	624
PSM	YPQLLSGIR	3427	sp|P50247|SAHH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	17		ms_run[1]:scan=1.1.2849.7	44.5381	2	1045.5812	1045.5912	K	G	143	152
PSM	LSALLPEPLK	3428	sp|Q3UEG6|AGT2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2963.7	47.74407	2	1079.649447	1079.659047	K	V	152	162
PSM	LLQDFFNGK	3429	sp|P17156|HSP72_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2996.4	48.65033	2	1080.552047	1080.560395	K	E	352	361
PSM	VYSILASTLK	3430	sp|O88342|WDR1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2870.8	45.14102	2	1093.631647	1093.638311	R	D	471	481
PSM	VYNEAGVTFT	3431	sp|P26443|DHE3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2816.8	43.60368	2	1099.510447	1099.518590	K	-	549	559
PSM	KFANILTEACSLQR	3432	sp|Q3UNX5|ACSM3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	10-UNIMOD:4	ms_run[1]:scan=1.1.2795.10	43.01247	3	1649.848571	1649.855926	R	G	100	114
PSM	FFGNLMDASK	3433	sp|Q9D0F9|PGM1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2905.9	46.12177	2	1128.522447	1128.527381	K	L	361	371
PSM	FSVLLLHGIR	3434	sp|Q8VCR7|ABHEB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2947.2	47.29555	3	1153.688171	1153.697164	R	F	33	43
PSM	DHINLPGFCGQNPLR	3435	sp|P23492|PNPH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	9-UNIMOD:4	ms_run[1]:scan=1.1.2984.4	48.32805	3	1736.838371	1736.841673	R	G	134	149
PSM	LVPFDHAESTYGLYR	3436	sp|Q9CQ60|6PGL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2876.8	45.31057	3	1766.855471	1766.862785	R	T	82	97
PSM	DSPSVWAAVPGK	3437	sp|P62962|PROF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2814.10	43.54802	2	1212.606647	1212.613888	K	T	27	39
PSM	YSLEPVAAELK	3438	sp|P09411|PGK1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2854.11	44.6845	2	1218.641647	1218.649604	K	S	76	87
PSM	IVPNILLEQGK	3439	sp|Q9CZU6|CISY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2900.11	45.98174	2	1222.719647	1222.728524	K	A	383	394
PSM	LNFGLAMEQAK	3440	sp|Q8VC30|TKFC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2906.12	46.15242	2	1220.610647	1220.622344	R	A	116	127
PSM	ELVPIAAQLDR	3441	sp|Q07417|ACADS_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2950.8	47.38085	2	1223.678647	1223.687387	K	E	52	63
PSM	SMALAWASSGVR	3442	sp|Q99MZ7|PECR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2837.9	44.20477	2	1234.605047	1234.612842	K	I	184	196
PSM	AFSDPFVEAEK	3443	sp|Q61316|HSP74_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2827.12	43.92188	2	1238.574447	1238.581919	R	S	74	85
PSM	EVGADFTIQVGK	3444	sp|Q64442|DHSO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2846.14	44.45927	2	1262.641247	1262.650667	K	E	215	227
PSM	LIEEVMIGEDK	3445	sp|P80314|TCPB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2804.15	43.2711	2	1274.643847	1274.642805	K	L	348	359
PSM	KYTPEQVAMATVTALHR	3446	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2912.8	46.31802	3	1914.999671	1914.998567	K	T	243	260
PSM	TLAFASVDLTNK	3447	sp|Q9CQR4|ACO13_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2949.9	47.35463	2	1278.670647	1278.681967	K	T	112	124
PSM	DVEDEETWIR	3448	sp|P16546|SPTN1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2833.17	44.09732	2	1290.571047	1290.572811	R	E	792	802
PSM	LKLPAVVTADLR	3449	sp|Q9DCW4|ETFB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2884.2	45.52699	3	1294.786271	1294.797272	R	L	175	187
PSM	DIFQEIYDKK	3450	sp|O88844|IDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2923.13	46.6327	2	1297.647047	1297.655418	K	Y	225	235
PSM	EMNLSETAFIR	3451	sp|Q9DCG6|PBLD1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2961.13	47.6922	2	1309.628247	1309.633637	R	K	41	52
PSM	GPLPLLGQSEAVK	3452	sp|Q8BH86|GLUCM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2874.15	45.2608	2	1307.735047	1307.744902	R	T	59	72
PSM	SIDPSEIVPEPK	3453	sp|A2ARV4|LRP2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2808.13	43.38013	2	1309.665047	1309.676548	R	P	4563	4575
PSM	NATTDALTSVLTK	3454	sp|G5E8K5|ANK3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2995.13	48.6298	2	1333.700047	1333.708910	K	I	1536	1549
PSM	VCIDSEHSSDTLLATLNK	3455	sp|O08997|ATOX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	2-UNIMOD:4	ms_run[1]:scan=1.1.2844.12	44.40158	3	2001.959171	2001.967721	K	T	40	58
PSM	EVNKGDILVVATGQPEMVK	3456	sp|Q922D8|C1TC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2825.18	43.86975	3	2026.068971	2026.076877	K	G	205	224
PSM	IMNVIGEPIDER	3457	sp|P56480|ATPB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2823.19	43.81335	2	1384.692447	1384.702051	R	G	144	156
PSM	EEIIPVAPEYDK	3458	sp|P45952|ACADM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2829.19	43.98475	2	1401.696447	1401.702762	R	S	58	70
PSM	FAVYLPPQAESGK	3459	sp|Q9R0P3|ESTD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2851.16	44.60252	2	1405.716247	1405.724166	R	C	32	45
PSM	ETTDDPVEYVLK	3460	sp|Q5U5V2|HYKK_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2985.4	48.35078	2	1407.667647	1407.676942	K	I	57	69
PSM	DQLLLGPTYATPK	3461	sp|Q99JY0|ECHB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2966.16	47.83718	2	1415.755047	1415.766031	K	V	350	363
PSM	EYATEVDVDFVR	3462	sp|O35643|AP1B1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2970.11	47.9455	2	1441.663247	1441.672525	K	K	360	372
PSM	VLYPNDNFFEGK	3463	sp|Q8CI94|PYGB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2993.13	48.5744	2	1441.683047	1441.687781	R	E	279	291
PSM	KGIVDQSQQAYQEAFEISK	3464	sp|P63101|1433Z_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2921.17	46.57892	3	2168.074871	2168.074963	K	K	139	158
PSM	EQFLDGDAWTNR	3465	sp|P14211|CALR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2905.18	46.12926	2	1450.637247	1450.647707	K	W	25	37
PSM	YTINIPEDLKPR	3466	sp|P28271|ACOC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2823.5	43.80167	3	1457.777171	1457.787829	R	M	835	847
PSM	LSSLDVVHAALVNK	3467	sp|Q91XE0|GLYAT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2899.17	45.95852	2	1464.821047	1464.830029	K	F	170	184
PSM	GLAITFVSDENDAK	3468	sp|Q9Z1N5|DX39B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2918.17	46.49318	2	1478.721247	1478.725289	K	I	385	399
PSM	VCENIPIVLCGNK	3469	sp|P62827|RAN_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	2-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.2863.17	44.94765	2	1514.752247	1514.758520	R	V	111	124
PSM	VCIVGSGNWGSAIAK	3470	sp|P13707|GPDA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	2-UNIMOD:4	ms_run[1]:scan=1.1.2887.20	45.626	2	1517.756247	1517.766048	K	I	6	21
PSM	FAPPQPAEPWSSVK	3471	sp|Q64176|EST1E_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2880.20	45.43167	2	1539.763847	1539.772179	R	N	66	80
PSM	NHQGLLLMDTTFR	3472	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2884.5	45.5295	3	1544.766971	1544.776947	R	D	559	572
PSM	GLEVTAYSPLGSSDR	3473	sp|Q9JII6|AK1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2899.20	45.96103	2	1550.751247	1550.757651	R	A	204	219
PSM	VCYEGQPVGEFIR	3474	sp|P13707|GPDA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	2-UNIMOD:4	ms_run[1]:scan=1.1.2855.19	44.71993	2	1552.726847	1552.734414	K	C	328	341
PSM	VPTPNVSVVDLTCR	3475	sp|P16858|G3P_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	13-UNIMOD:4	ms_run[1]:scan=1.1.2963.18	47.75325	2	1555.798447	1555.802828	R	L	233	247
PSM	GGVCIADEVQTGFGR	3476	sp|Q3UEG6|AGT2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	4-UNIMOD:4	ms_run[1]:scan=1.1.2902.20	46.04608	2	1564.720647	1564.730391	R	L	313	328
PSM	VFANAPDSACVIGLR	3477	sp|P12382|PFKAL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	10-UNIMOD:4	ms_run[1]:scan=1.1.2948.14	47.33258	2	1588.793447	1588.803162	R	K	699	714
PSM	VYALPEDLVEVKPK	3478	sp|Q99K51|PLST_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2913.9	46.34663	3	1598.882771	1598.891960	R	M	600	614
PSM	GTFCSFDTPDEAIR	3479	sp|P61922|GABT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	4-UNIMOD:4	ms_run[1]:scan=1.1.2865.20	45.00743	2	1614.697047	1614.698422	R	N	437	451
PSM	FNALFAQGNYSEAAK	3480	sp|Q68FD5|CLH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2824.21	43.84358	2	1629.772247	1629.778721	K	V	368	383
PSM	VIGLSSDLQQVGGASAR	3481	sp|Q9DCH4|EIF3F_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2823.21	43.81503	2	1656.871647	1656.879498	R	I	266	283
PSM	NLDYVATSIHEAVTK	3482	sp|P05201|AATC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2799.20	43.13342	2	1659.841247	1659.846801	K	I	397	412
PSM	NIAFFSTNCVEGTAR	3483	sp|Q8VDN2|AT1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	9-UNIMOD:4	ms_run[1]:scan=1.1.2973.15	48.03522	2	1685.775647	1685.783155	R	G	241	256
PSM	DVDPDVAYSSIPYEK	3484	sp|P24527|LKHA4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2978.18	48.1701	2	1696.775447	1696.783198	K	G	372	387
PSM	EFGASECISPQDFSK	3485	sp|P28474|ADHX_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	7-UNIMOD:4	ms_run[1]:scan=1.1.2849.19	44.54811	2	1700.728447	1700.735202	K	S	234	249
PSM	LYTVNAEECAAALER	3486	sp|Q78JN3|ECI3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	9-UNIMOD:4	ms_run[1]:scan=1.1.2850.20	44.57735	2	1708.800447	1708.809035	K	M	281	296
PSM	AVLGPLVGAVDQGTSSTR	3487	sp|Q64516|GLPK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2997.18	48.69033	2	1726.909247	1726.921363	K	F	7	25
PSM	TITLEVEPSDTIENVK	3488	tr|A0A0A6YW67|A0A0A6YW67_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2997.19	48.69117	2	1786.912647	1786.920025	K	A	12	28
PSM	MLDAEDIVNTARPDEK	3489	sp|P57780|ACTN4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2809.11	43.40627	3	1815.861071	1815.867278	K	A	241	257
PSM	VGDAIPSVEVFEGEPGKK	3490	sp|P99029|PRDX5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2852.13	44.62878	3	1856.954171	1856.951994	K	V	54	72
PSM	QSLIYHVASQQIQTLEK	3491	sp|Q9DCY0|KEG1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2905.21	46.13178	2	1985.048247	1985.058191	R	L	239	256
PSM	ALPGHLKPFETLLSQNQGGK	3492	sp|P19157|GSTP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2822.18	43.78382	3	2134.145771	2134.153488	K	A	122	142
PSM	SSNAGHQGVWVFEIGSPATAK	3493	sp|P10493|NID1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2969.13	47.92	3	2142.041171	2142.049417	K	G	252	273
PSM	TVGIVGNQPNVASGCLDINSSVK	3494	sp|Q99MN9|PCCB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	15-UNIMOD:4	ms_run[1]:scan=1.1.2986.8	48.38939	3	2328.162971	2328.174360	R	G	353	376
PSM	FAVELEGEQPISVPPSTNHTVYR	3495	sp|Q8CHT0|AL4A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2999.21	48.74985	3	2569.276871	2569.281267	K	G	175	198
PSM	FAVELEGEQPISVPPSTNHTVYR	3496	sp|Q8CHT0|AL4A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2992.21	48.55382	3	2569.278671	2569.281267	K	G	175	198
PSM	IIWELIK	3497	sp|O88844|IDHC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3192.2	54.14648	2	913.555847	913.563690	R	E	21	28
PSM	IIWQFIK	3498	sp|P54071|IDHP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3164.3	53.37123	2	946.557647	946.564024	R	E	61	68
PSM	GLLNAIVIR	3499	sp|P29758|OAT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3095.2	51.42975	2	967.611047	967.617851	K	E	375	384
PSM	VLGLTLLQK	3500	sp|Q9CPU0|LGUL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3047.2	50.0677	2	983.630047	983.637918	R	L	52	61
PSM	YLTVAAVFR	3501	sp|P68372|TBB4B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3029.4	49.55575	2	1038.576847	1038.586216	R	G	310	319
PSM	ENFIWNLK	3502	sp|Q5U5V2|HYKK_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3087.3	51.20587	2	1062.542247	1062.549831	R	N	175	183
PSM	GPILSIYFR	3503	sp|Q9D8I3|GLOD5_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3187.3	54.00838	2	1064.593447	1064.601866	K	D	125	134
PSM	TCLLIVFSK	3504	sp|P62746|RHOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	2-UNIMOD:4	ms_run[1]:scan=1.1.3173.4	53.62177	2	1079.595847	1079.604903	K	D	19	28
PSM	HLLGLLLIAK	3505	sp|Q9DC50|OCTC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3163.2	53.34293	2	1089.719647	1089.727401	R	E	506	516
PSM	YFDLGLPNR	3506	sp|P54071|IDHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3003.4	48.84933	2	1093.546047	1093.555644	K	D	81	90
PSM	LQLLEPFDK	3507	sp|Q99KI0|ACON_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3099.4	51.54138	2	1101.598847	1101.607011	R	W	565	574
PSM	ALSFLSPSLSR	3508	sp|Q64462|CP4B1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	17		ms_run[1]:scan=1.1.3037.7	49.78467	2	1176.6421	1176.6497	M	L	2	13
PSM	VEFDTFGELK	3509	sp|P97807|FUMH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3005.10	48.91033	2	1183.568647	1183.576105	R	V	49	59
PSM	GGIVGMTLPIAR	3510	tr|A2AFQ2|A2AFQ2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3110.4	51.84537	2	1183.664847	1183.674714	K	D	183	195
PSM	DAGTIAGLNVLR	3511	sp|P63017|HSP7C_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3081.10	51.03925	2	1198.659847	1198.666986	K	I	160	172
PSM	LTPLDQQLFK	3512	sp|Q9DCY0|KEG1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3034.7	49.69864	2	1201.664647	1201.670674	K	F	159	169
PSM	LKEEEVTFWTQSLAK	3513	sp|Q91WU0|CES1F_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3032.10	49.64452	3	1807.924871	1807.935616	R	K	537	552
PSM	QALFLLVCSR	3514	sp|Q5U5V2|HYKK_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	8-UNIMOD:4	ms_run[1]:scan=1.1.3206.6	54.55135	2	1205.651247	1205.659064	R	F	306	316
PSM	IPFLLSGTSYK	3515	sp|Q99JY0|ECHB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3107.8	51.76615	2	1224.670647	1224.675425	R	D	63	74
PSM	YIVPMITVDGK	3516	sp|Q9JII6|AK1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3116.10	52.01582	2	1234.654847	1234.663146	R	R	298	309
PSM	PLPGITVGDIGPK	3517	sp|Q9R0H0|ACOX1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3003.7	48.85183	2	1262.713047	1262.723438	K	F	217	230
PSM	MAENLGFLGSLK	3518	sp|Q9Z2I8|SUCB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	1-UNIMOD:35	ms_run[1]:scan=1.1.3061.6	50.463	2	1294.651047	1294.659124	R	N	208	220
PSM	VHLVGIDIFTGK	3519	sp|P63242|IF5A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3090.2	51.29047	3	1297.729871	1297.739423	K	K	56	68
PSM	TQEILSQLPFK	3520	sp|Q9QUH0|GLRX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3120.9	52.12802	2	1302.709847	1302.718353	K	Q	29	40
PSM	TQEILSQLPFK	3521	sp|Q9QUH0|GLRX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3114.9	51.95917	2	1302.709847	1302.718353	K	Q	29	40
PSM	DIGNIISDAMKK	3522	sp|P63038|CH60_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3020.2	49.30952	3	1303.671971	1303.680587	K	V	181	193
PSM	YVRPGGGFEPNFTLFEK	3523	sp|P11352|GPX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3138.8	52.63937	3	1956.969671	1956.973398	K	C	96	113
PSM	KVEDLFLTFAK	3524	sp|P16546|SPTN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3132.11	52.4702	2	1309.715247	1309.728189	R	K	2088	2099
PSM	LCNPPVNAISPTVITEVR	3525	sp|Q9DBM2|ECHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	2-UNIMOD:4	ms_run[1]:scan=1.1.3162.9	53.32148	3	1979.047271	1979.050997	R	N	16	34
PSM	TVTNAVVTVPAYFNDSQR	3526	sp|P63017|HSP7C_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3066.13	50.61333	3	1980.985271	1980.990505	K	Q	138	156
PSM	LGQLNIDISNIK	3527	sp|Q64516|GLPK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3063.13	50.5267	2	1326.741647	1326.750716	K	A	75	87
PSM	IHKPDPWLSEFLSQYR	3528	sp|Q9DBM2|ECHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3182.8	53.87528	3	2015.023271	2015.026497	R	E	584	600
PSM	DTLYFMDDAEK	3529	sp|O35488|S27A2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3019.9	49.29512	2	1346.557647	1346.570034	K	T	590	601
PSM	FIDTSQFILNR	3530	sp|Q4FZG7|TI8AB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3167.11	53.46047	2	1352.699247	1352.708851	R	L	70	81
PSM	NFLASQVPFPSR	3531	sp|O08756|HCD2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3052.15	50.21892	2	1361.703047	1361.709185	R	L	215	227
PSM	LFEAEEQDLFK	3532	sp|Q9WVK4|EHD1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3146.13	52.87343	2	1367.649447	1367.660897	K	D	270	281
PSM	ALQGASQIIAEIR	3533	sp|Q8K1M6|DNM1L_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3057.14	50.3557	2	1368.761247	1368.772514	K	E	725	738
PSM	GGLIVYEDSPLVK	3534	sp|Q8CC88|VWA8_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3024.12	49.42573	2	1388.767847	1388.755132	K	A	823	836
PSM	ALAGCDFLTISPK	3535	sp|Q93092|TALDO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	5-UNIMOD:4	ms_run[1]:scan=1.1.3071.10	50.75414	2	1391.704047	1391.711887	K	L	246	259
PSM	ALVVTVDAPVLGNR	3536	sp|Q9NYQ2|HAOX2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3066.19	50.61835	2	1422.807647	1422.819464	K	R	152	166
PSM	GNWGYLDQAAALR	3537	sp|Q91WG0|EST2C_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3069.13	50.69965	2	1433.695447	1433.705162	R	W	196	209
PSM	DVTDEDLNSYFK	3538	sp|Q8QZS1|HIBCH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3091.17	51.33143	2	1444.637247	1444.635805	K	S	365	377
PSM	VNLLSFTGSTQVGK	3539	sp|Q9DBF1|AL7A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3075.17	50.87267	2	1449.773247	1449.782744	R	E	267	281
PSM	TLGSVGEPINHEAWEWLHK	3540	sp|Q99NB1|ACS2L_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3020.9	49.31536	3	2202.076271	2202.085802	R	V	405	424
PSM	NFNTVPYIVGINK	3541	tr|D3Z298|D3Z298_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3127.12	52.3298	2	1477.784447	1477.792915	K	Q	340	353
PSM	LGEYGFQNAILVR	3542	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3150.17	52.99257	2	1478.783847	1478.788164	K	Y	422	435
PSM	TGENVEDAFLEAAK	3543	sp|Q91V41|RAB14_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3054.13	50.27203	2	1492.692047	1492.704553	K	K	157	171
PSM	LVWIETPTNPTLK	3544	sp|Q8VCN5|CGL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3127.14	52.33147	2	1510.828047	1510.839531	K	L	152	165
PSM	LLSHCLLVTLASHHPADFTPAVHASLDK	3545	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	5-UNIMOD:4	ms_run[1]:scan=1.1.3032.19	49.65202	4	3049.580094	3049.580761	K	F	101	129
PSM	LANQAADYFGDAFK	3546	sp|Q9WU78|PDC6I_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3082.16	51.07315	2	1529.712447	1529.715058	K	Q	216	230
PSM	DLGATWVVLGHSER	3547	sp|P17751|TPIS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3014.2	49.14818	3	1538.775671	1538.784141	K	R	136	150
PSM	ITSEALLVTQQLVK	3548	sp|Q6ZQ38|CAND1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3182.15	53.88113	2	1541.898247	1541.902859	K	V	535	549
PSM	HPSAVTACNLDLENLVTDSNR	3549	sp|Q9QZE5|COPG1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	8-UNIMOD:4	ms_run[1]:scan=1.1.3024.16	49.43158	3	2325.097271	2325.101923	K	S	318	339
PSM	YCLVVLNQPLDAR	3550	sp|Q9R0M5|TPK1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	2-UNIMOD:4	ms_run[1]:scan=1.1.3153.15	53.07812	2	1559.804247	1559.812999	K	F	19	32
PSM	AAEEAFVNDIDESSPGTEWER	3551	tr|B1AWE0|B1AWE0_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3170.14	53.54603	3	2351.027471	2351.018964	R	V	161	182
PSM	AVFQANQENLPILK	3552	sp|Q8VDN2|AT1A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3033.19	49.6803	2	1583.860847	1583.867142	R	R	431	445
PSM	AVLVDLEPGTMDSVR	3553	sp|P68372|TBB4B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3113.19	51.93988	2	1600.805847	1600.813058	R	S	63	78
PSM	FGIQAQMVTTDFQK	3554	sp|Q9R1P1|PSB3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3038.20	49.82415	2	1612.790247	1612.791928	R	I	28	42
PSM	DNISDENMVVNELK	3555	sp|Q99NB1|ACS2L_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3001.18	48.80438	2	1618.756847	1618.750852	K	L	593	607
PSM	APAVATVGSICDLNLK	3556	sp|Q80X90|FLNB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	11-UNIMOD:4	ms_run[1]:scan=1.1.3030.21	49.59768	2	1627.869647	1627.860343	R	I	2105	2121
PSM	LTVEDPVTVEYITR	3557	sp|Q9CWH6|PSMA8_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3119.18	52.10727	2	1633.847247	1633.856303	K	F	98	112
PSM	GDNTISLISIDSGSGVK	3558	sp|Q5U5V2|HYKK_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3049.20	50.13985	2	1661.838047	1661.847195	K	S	106	123
PSM	LSQTFPNADFAEITK	3559	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3113.20	51.94073	2	1680.829047	1680.835902	R	L	243	258
PSM	HSGNITFDEIVNIAR	3560	sp|P35979|RL12_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3121.7	52.1547	3	1684.842671	1684.853283	K	Q	100	115
PSM	APSSSSVGISEWLDQK	3561	sp|Q99LC5|ETFA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3067.14	50.64302	2	1689.813647	1689.820980	K	L	188	204
PSM	LFIGGLNVQTSESGLR	3562	sp|Q9CX86|ROA0_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3199.18	54.3609	2	1689.897247	1689.904984	K	G	9	25
PSM	DDNPSLPPFERPEAEAMCTSFK	3563	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	18-UNIMOD:4	ms_run[1]:scan=1.1.3135.19	52.56244	3	2537.118371	2537.120275	K	E	131	153
PSM	NVVTIFSAPNYCYR	3564	sp|P62715|PP2AB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	12-UNIMOD:4	ms_run[1]:scan=1.1.3142.20	52.76425	2	1702.809847	1702.813727	R	C	255	269
PSM	SSGPTSLFAVTVAPPGAR	3565	sp|Q8VEK3|HNRPU_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3204.19	54.50488	2	1713.899847	1713.904984	K	Q	182	200
PSM	VTGTQFPEAPLPVPCNPNDVSHGYVTVKPGIR	3566	sp|P34914|HYES_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	15-UNIMOD:4	ms_run[1]:scan=1.1.3078.20	50.96098	4	3445.748094	3445.745260	K	L	216	248
PSM	LEDTLWAGLTDQHVK	3567	sp|Q8BWT1|THIM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3019.4	49.28679	3	1724.863571	1724.873350	K	L	144	159
PSM	RSIQFVDWCPTGFK	3568	sp|P05213|TBA1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	9-UNIMOD:4	ms_run[1]:scan=1.1.3038.8	49.81413	3	1739.836571	1739.845361	K	V	339	353
PSM	GQNILDGGAPFYTTYK	3569	sp|O09174|AMACR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3123.20	52.22233	2	1743.836647	1743.846801	R	T	208	224
PSM	FDTGNLCMVTGGANLGR	3570	sp|P62702|RS4X_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	7-UNIMOD:4	ms_run[1]:scan=1.1.3094.21	51.41818	2	1781.805247	1781.818889	K	I	175	192
PSM	SYELPDGQVITIGNER	3571	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3079.19	50.98897	2	1789.874647	1789.884643	K	F	239	255
PSM	LGPNYLQIPVNCPYR	3572	sp|P24270|CATA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	12-UNIMOD:4	ms_run[1]:scan=1.1.3174.20	53.66348	2	1802.907647	1802.913775	R	A	366	381
PSM	AYHEQLSVAEITNACFEPANQMVK	3573	sp|P05213|TBA1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	15-UNIMOD:4	ms_run[1]:scan=1.1.3128.19	52.36412	3	2749.278371	2749.283987	K	C	281	305
PSM	ESSIYLIGGSIPEEDAGK	3574	sp|Q9JHW2|NIT2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3137.20	52.62068	2	1863.903447	1863.910189	K	L	75	93
PSM	SYQANSLVITAGPWTNR	3575	sp|Q9D826|SOX_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3153.20	53.08228	2	1876.936047	1876.943161	K	L	192	209
PSM	TGIGSGLSLSGIVHPELSR	3576	sp|P50544|ACADV_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3113.9	51.93155	3	1879.002671	1879.016326	R	S	514	533
PSM	SVPMSTVFYPSDGVATEK	3577	sp|P40142|TKT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3028.21	49.54225	2	1913.901047	1913.908081	R	A	439	457
PSM	AGDTVIPLYIPQCGECK	3578	sp|P28474|ADHX_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	13-UNIMOD:4,16-UNIMOD:4	ms_run[1]:scan=1.1.3199.20	54.36257	2	1919.906447	1919.912121	K	F	85	102
PSM	AGDTVIPLYIPQCGECK	3579	sp|P28474|ADHX_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	13-UNIMOD:4,16-UNIMOD:4	ms_run[1]:scan=1.1.3205.20	54.53427	2	1919.906447	1919.912121	K	F	85	102
PSM	TVTNAVVTVPAYFNDSQR	3580	sp|P63017|HSP7C_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3076.21	50.90458	2	1980.983447	1980.990505	K	Q	138	156
PSM	YESSALPAGQLTSLPDYASR	3581	sp|Q9CQN1|TRAP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3157.8	53.18722	3	2125.021871	2125.032764	R	M	472	492
PSM	DAEVVLCGGTESMSQSPYCVR	3582	sp|Q8BWT1|THIM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	7-UNIMOD:4,19-UNIMOD:4	ms_run[1]:scan=1.1.3039.20	49.85295	3	2344.004471	2344.013368	K	N	110	131
PSM	FAVELEGEQPISVPPSTNHTVYR	3583	sp|Q8CHT0|AL4A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3016.8	49.2153	3	2569.280171	2569.281267	K	G	175	198
PSM	EDILSFLEK	3584	sp|P53395|ODB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3537.3	63.8174	2	1092.562847	1092.570292	K	Q	203	212
PSM	LLLPWLEAR	3585	sp|Q68FD5|CLH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3559.3	64.4489	2	1109.652847	1109.659716	K	I	857	866
PSM	DFQLFSSPLGK	3586	sp|Q921I1|TRFE_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3436.3	60.97852	2	1237.626047	1237.634289	K	D	300	311
PSM	FASLDVTHAALVNSLWHFGGNEK	3587	sp|Q9DCY0|KEG1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3449.5	61.33344	4	2512.243694	2512.249908	K	S	169	192
PSM	LLVPYLIEAVR	3588	sp|Q61425|HCDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3574.5	64.87338	2	1284.776247	1284.780559	R	L	222	233
PSM	LYDIEQQQITDALENIR	3589	sp|Q99KP3|CRYL1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3598.5	65.53598	3	2061.035771	2061.037849	K	K	34	51
PSM	AWNIWADIPAPK	3590	sp|Q9DBF1|AL7A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3509.4	63.01702	2	1380.706847	1380.719021	K	R	98	110
PSM	TVCVEMGDVESAF	3591	sp|Q9JLJ2|AL9A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	3-UNIMOD:4	ms_run[1]:scan=1.1.3441.4	61.11442	2	1442.596247	1442.605767	K	-	482	495
PSM	TLNDELEIIEGMK	3592	sp|P63038|CH60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3441.5	61.11609	2	1503.742447	1503.749061	K	F	206	219
PSM	NFSAIINPPQACILAIGASEDK	3593	sp|Q8BMF4|ODP2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	12-UNIMOD:4	ms_run[1]:scan=1.1.3575.14	64.90916	3	2328.175271	2328.178383	K	L	570	592
PSM	SVNESLNNLFITEEDYQALR	3594	sp|Q68FD5|CLH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3542.11	63.96958	3	2354.139971	2354.139020	K	T	1462	1482
PSM	TCGFDFSGALEDISK	3595	sp|P05202|AATM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	2-UNIMOD:4	ms_run[1]:scan=1.1.3472.15	61.97857	2	1645.724247	1645.729388	K	I	186	201
PSM	DIPSDAFTGLDPLGDK	3596	sp|P98078|DAB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3529.15	63.59743	2	1659.793847	1659.799182	K	E	629	645
PSM	SPTGLTLGSLVDEIQR	3597	sp|Q9DBM2|ECHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3495.18	62.64022	2	1684.894047	1684.899565	K	Y	68	84
PSM	AVFVDLEPTVIDEVR	3598	sp|P05213|TBA1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3490.19	62.49577	2	1700.894647	1700.898502	R	T	65	80
PSM	SHPDVAGVFVLSGFLNK	3599	sp|Q3UFF7|LYPL1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3468.2	61.85795	3	1785.929471	1785.941370	R	A	138	155
PSM	ILGTLALIDQSETDWK	3600	sp|Q91VM9|IPYR2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3524.18	63.45565	2	1801.943647	1801.946181	K	I	183	199
PSM	ILGTLALIDQSETDWK	3601	sp|Q91VM9|IPYR2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3518.16	63.28095	2	1801.943647	1801.946181	K	I	183	199
PSM	SLRPGVAIADFVIFPPR	3602	sp|O09173|HGD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3489.6	62.45618	3	1854.041471	1854.051589	K	W	305	322
PSM	SLRPGVAIADFVIFPPR	3603	sp|O09173|HGD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3495.4	62.62853	3	1854.041471	1854.051589	K	W	305	322
PSM	ITGEAFVQFASQELAEK	3604	sp|Q9Z2X1|HNRPF_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3563.16	64.572	2	1866.933447	1866.936344	K	A	151	168
PSM	FDGGEEVFLSGEFNSLK	3605	sp|Q9CQ62|DECR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3491.21	62.5265	2	1873.870847	1873.873410	R	K	299	316
PSM	LAMQEFMILPVGASSFR	3606	sp|P17182|ENOA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	3-UNIMOD:35	ms_run[1]:scan=1.1.3563.19	64.5745	2	1911.956847	1911.958677	K	E	163	180
PSM	EGDSPQLMAIMNHVLGPR	3607	sp|Q62468|VILI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3467.4	61.83223	3	1963.953371	1963.960802	K	K	216	234
PSM	IPNIYAIGDVVAGPMLAHK	3608	sp|O08749|DLDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3535.4	63.76058	3	1978.070171	1978.071004	K	A	347	366
PSM	SLPADILYEDQQCLVFR	3609	sp|Q9D0S9|HINT2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	13-UNIMOD:4	ms_run[1]:scan=1.1.3607.10	65.79874	3	2066.011271	2066.014277	R	D	63	80
PSM	IAVIGQSLFGQEVYCQLR	3610	sp|Q8R0Y6|AL1L1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	15-UNIMOD:4	ms_run[1]:scan=1.1.3536.8	63.79265	3	2080.075571	2080.077546	K	K	3	21
PSM	LFLYEPAGTETFSVESISK	3611	sp|Q91XE4|ACY3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3509.5	63.01785	3	2117.053571	2117.056853	R	N	153	172
PSM	KAQGTGELTQLLNSLCTAIK	3612	sp|Q9QXD6|F16P1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	16-UNIMOD:4	ms_run[1]:scan=1.1.3605.7	65.7389	3	2145.145871	2145.146354	R	A	24	44
PSM	ARNDEYENLFNMVVEIPR	3613	sp|Q91VM9|IPYR2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3632.7	66.52133	3	2208.059171	2208.063352	K	W	78	96
PSM	YHDFGCALLANLFASEGQPGK	3614	sp|Q91V76|CK054_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	6-UNIMOD:4	ms_run[1]:scan=1.1.3640.9	66.75816	3	2294.076371	2294.079003	K	V	149	170
PSM	EEFASTCPDDEEIELAYEQVAR	3615	sp|Q9Z1Q5|CLIC1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	7-UNIMOD:4	ms_run[1]:scan=1.1.3477.19	62.12337	3	2600.121671	2600.122443	R	A	217	239
PSM	ITFHGEGDQEPGLEPGDIIIVLDQK	3616	sp|P63037|DNJA1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3550.19	64.20412	3	2719.370171	2719.370476	K	D	222	247
PSM	LTFFNSTLNTSGLVAQGEALPIPGAHRPGLVTK	3617	sp|Q8R0Y6|AL1L1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3436.8	60.98687	4	3405.837294	3405.840875	K	A	242	275
PSM	DINQEVYNFLATAGAK	3618	sp|Q99KI0|ACON_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3801.5	71.27747	3	1752.866171	1752.868265	K	Y	145	161
PSM	SLDGIPFTVDACGLIHCIEDFHK	3619	sp|Q8BFW7|LPP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	12-UNIMOD:4,17-UNIMOD:4	ms_run[1]:scan=1.1.3757.6	70.03522	4	2643.251294	2643.246145	R	K	509	532
PSM	VLSPELLFALAR	3620	sp|Q8R2K1|FUCM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3758.4	70.06229	2	1327.779847	1327.786373	K	M	10	22
PSM	VPSTETEALASNLMGMFEK	3621	sp|P50396|GDIA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3775.3	70.5507	3	2053.972271	2053.970029	K	R	119	138
PSM	LMLLLEVISGER	3622	sp|O88990|ACTN3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3795.6	71.10982	2	1371.766847	1371.779573	K	L	78	90
PSM	TTPDVIFVFGFR	3623	sp|P62849|RS24_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3742.5	69.61087	2	1397.733047	1397.734337	K	T	50	62
PSM	AVIGDHGDEIFSVFGSPFLK	3624	sp|Q8VCT4|CES1D_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3711.6	68.74795	3	2134.068671	2134.073506	K	D	461	481
PSM	TFCQLILDPIFK	3625	sp|P58252|EF2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	3-UNIMOD:4	ms_run[1]:scan=1.1.3695.8	68.3049	2	1493.787447	1493.795223	R	V	288	300
PSM	SINPDEAVAYGAAVQAAILSGDK	3626	sp|P63017|HSP7C_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3759.11	70.09668	3	2259.136871	2259.138292	K	S	362	385
PSM	GELVPLDTVLDMLR	3627	sp|Q9R0Y5|KAD1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3869.5	73.17583	2	1569.835447	1569.843630	K	D	64	78
PSM	FALGLSGGSLVSMLAR	3628	sp|Q9CQ60|6PGL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3744.10	69.67001	2	1577.853247	1577.859948	R	D	41	57
PSM	IITMLPSSMNAVEVYSGANGILK	3629	sp|Q99L13|3HIDH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3709.9	68.69617	3	2407.243571	2407.249104	R	K	98	121
PSM	IGVAIGDQILDLSVIK	3630	sp|P35505|FAAA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3749.9	69.8083	2	1652.968647	1652.971273	R	H	32	48
PSM	AAGVSVEPFWPGLFAK	3631	sp|P47955|RLA1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3723.6	69.08546	2	1674.872047	1674.876979	K	A	34	50
PSM	TLFSNIVLSGGSTLFK	3632	sp|P61164|ACTZ_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3735.15	69.42055	2	1682.923847	1682.924323	R	G	293	309
PSM	ILLANFLAQTEALMK	3633	sp|P06745|G6PI_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	14-UNIMOD:35	ms_run[1]:scan=1.1.3679.12	67.85828	2	1690.931047	1690.932779	K	G	424	439
PSM	GMTLVTPLQLLLFASK	3634	sp|O70133|DHX9_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3902.5	74.07693	2	1730.992847	1731.000465	K	K	1060	1076
PSM	VLVCGAGPVGMVTLLVAK	3635	sp|Q64442|DHSO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	4-UNIMOD:4	ms_run[1]:scan=1.1.3717.3	68.91634	3	1783.001471	1783.009984	K	A	176	194
PSM	GLLPEELTPLILETQK	3636	sp|Q99LC5|ETFA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3758.14	70.07062	2	1793.019247	1793.018617	K	Q	86	102
PSM	DNTIEHLLPLFLAQLK	3637	sp|Q76MZ3|2AAA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3857.2	72.84213	3	1864.033271	1864.045835	K	D	359	375
PSM	ITVVGVGQVGMACAISILGK	3638	sp|P16125|LDHB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	13-UNIMOD:4	ms_run[1]:scan=1.1.3762.6	70.17957	3	1972.081271	1972.084940	K	S	24	44
PSM	EFFNFLPLSSQDPAPIR	3639	sp|Q99MN9|PCCB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3760.6	70.12115	3	1976.997371	1976.999613	R	E	275	292
PSM	EEIFGPVLTVYVYPDDK	3640	sp|Q8CHT0|AL4A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3718.21	68.95887	2	1982.985447	1982.987711	K	Y	445	462
PSM	TGPAATTLSDTAAAESLVDSSEVTVIGFFK	3641	sp|P09103|PDIA1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3853.17	72.74323	3	2984.492471	2984.486629	R	D	135	165
PSM	ELCEFFGIPMEILPNVR	3642	sp|Q64516|GLPK_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	3-UNIMOD:4	ms_run[1]:scan=1.1.3860.3	72.92475	3	2063.013971	2063.022005	K	S	218	235
PSM	DGADIHSDLFISIAQAILGGTAK	3643	sp|Q99M87|DNJA3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3931.2	74.82796	3	2312.189171	2312.201226	R	A	342	365
PSM	KFDVNTSAVQVLIEHIGNLDR	3644	sp|Q68FD5|CLH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3651.14	67.06727	3	2367.247271	2367.254659	R	A	1074	1095
PSM	ENLQLNQEVGAIREELLYFK	3645	sp|Q60866|PTER_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3679.9	67.85329	3	2405.257571	2405.259075	R	A	69	89
PSM	SVVEFLQGYIGIPHGGFPEPFR	3646	sp|Q05920|PYC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3770.9	70.41413	3	2445.245471	2445.248117	R	S	943	965
PSM	VNAEGTVDTVFSEVCTYLDSLK	3647	sp|Q9R0Y5|KAD1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	15-UNIMOD:4	ms_run[1]:scan=1.1.3904.7	74.13438	3	2446.154771	2446.157372	K	-	173	195
PSM	GVAALTSDPAVQAIVLDTASDVLDK	3648	sp|P26039|TLN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3828.10	72.02797	3	2468.302271	2468.301000	R	A	1137	1162
PSM	SYAVVGVPPDVMGIGPAYAIPAALQK	3649	sp|Q8VCH0|THIKB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3771.12	70.4452	3	2583.371771	2583.377082	R	A	306	332
PSM	WLPAGDALLQMITIHLPSPVTAQK	3650	sp|P58252|EF2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3840.14	72.36618	3	2599.416971	2599.419616	R	Y	343	367
PSM	AAQINPLFPGQALLDTVPEIQALVR	3651	sp|A2ATU0|DHTK1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3904.10	74.14105	3	2673.491471	2673.485387	K	T	71	96
PSM	LAASEAATAISHQAIQILGGMGYVTEMPAER	3652	sp|Q07417|ACADS_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3779.14	70.67574	4	3185.576494	3185.584920	K	Y	350	381
PSM	KLDALTTGFGFPVGAATLADEVGVDVAQHVAEDLGK	3653	sp|Q8BMS1|ECHA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3854.6	72.76462	4	3610.861694	3610.851893	K	A	570	606
PSM	KPLVIIAEDVDGEALSTLVLNR	3654	sp|P63038|CH60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3646.11	66.92425	3	2366.321771	2364.326427	R	L	269	291
PSM	GQGLTGPSLPPGTPTRK	3655	sp|Q9DBM2|ECHP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2303.16	29.35012	3	1663.901171	1662.905319	K	R	531	548
PSM	SINPDEAVAYGAAVQAAILSGDK	3656	sp|P63017|HSP7C_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3754.11	69.95357	3	2259.136871	2259.138292	K	S	362	385
PSM	QHGIPIPVTPK	3657	sp|P16460|ASSY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:28	ms_run[1]:scan=1.1.2709.10	40.59941	2	1168.6513	1168.6599	K	S	166	177
PSM	TTSLELFMYLNEVAGK	3658	sp|P16460|ASSY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3787.10	70.89993	2	1814.907847	1814.912438	R	H	245	261
PSM	ILAQATSDLVNAIK	3659	sp|P26039|TLN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3109.16	51.82787	2	1455.819247	1455.829694	R	A	828	842
PSM	LVLEVAQHLGESTVR	3660	sp|P56480|ATPB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2832.10	44.0628	3	1649.901671	1649.910070	R	T	95	110
PSM	VPTPNVSVVDLTCRLEK	3661	sp|P16858|G3P_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	13-UNIMOD:4	ms_run[1]:scan=1.1.3035.10	49.7298	3	1926.018671	1926.024448	R	P	233	250
PSM	CDENILWLDYK	3662	sp|P52480|KPYM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.3801.9	71.28082	2	1450.6375	1450.6433	K	N	152	163
PSM	AHRFPALTPEQK	3663	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1	ms_run[1]:scan=1.1.2297.7	29.17302	3	1435.7442	1435.7562	M	K	2	14
PSM	KYTPEQVAMATVTALHR	3664	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	17		ms_run[1]:scan=1.1.2894.3	45.80733	4	1916.9982	1914.9982	K	T	243	260
PSM	CPLPRPWK	3665	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.2849.6	44.53727	2	1035.5231	1035.5319	R	L	290	298
PSM	FEPQINAEESEIR	3666	sp|Q64516|GLPK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	17		ms_run[1]:scan=1.1.2658.8	39.18497	2	1560.7302	1560.7412	R	Y	493	506
PSM	EAICEVALDYK	3667	sp|Q62261|SPTB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	4-UNIMOD:4	ms_run[1]:scan=1.1.2768.18	42.25566	2	1309.617447	1309.622404	K	K	2258	2269
PSM	IAATILTSPDLR	3668	sp|P05202|AATM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2888.10	45.64565	2	1269.719447	1269.729252	R	K	326	338
PSM	VITAFNDGLNHLDSLK	3669	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3068.7	50.66603	3	1755.907571	1755.915549	K	G	68	84
PSM	MPLIGLGTWK	3670	sp|Q9JII6|AK1A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	1-UNIMOD:35	ms_run[1]:scan=1.1.3029.7	49.55825	2	1131.607847	1130.615802	K	S	14	24
PSM	QAFTDVATGSLGQGLGAACGMAYTGK	3671	sp|P40142|TKT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:28,19-UNIMOD:4	ms_run[1]:scan=1.1.3737.10	69.47497	3	2514.1526	2514.1514	K	Y	115	141
PSM	LDNLVAIFDINR	3672	sp|P40142|TKT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	17		ms_run[1]:scan=1.1.3644.7	66.86584	2	1401.7472	1401.7612	K	L	175	187
PSM	NSTFSELFK	3673	sp|P40142|TKT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2888.3	45.6398	2	1071.516047	1071.523676	K	K	344	353
PSM	SPYLYPLYGLGELPQGFAR	3674	sp|P50396|GDIA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3768.7	70.35475	3	2140.103471	2140.099327	K	L	222	241
PSM	RIFSSEHDIFR	3675	sp|P51174|ACADL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2319.11	29.78852	3	1405.700171	1405.710248	R	E	51	62
PSM	MDKNELVQK	3676	sp|P63101|1433Z_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1	ms_run[1]:scan=1.1.2212.15	26.83918	2	1145.5757	1145.5745	-	A	1	10
PSM	QGGLGPMNIPLISDPK	3677	sp|P35700|PRDX1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:28	ms_run[1]:scan=1.1.3790.12	70.97417	2	1618.8322	1618.8384	K	R	94	110
PSM	QCFLYMVCQTAK	3678	sp|Q9DCY0|KEG1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:28,2-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.3663.10	67.4012	2	1530.6552	1530.6662	K	K	129	141
PSM	TPILLGSLAHQIYR	3679	sp|Q99L13|3HIDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3079.4	50.97645	3	1580.890571	1580.903862	K	M	297	311
PSM	GLEISGTFTR	3680	sp|O35643|AP1B1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2646.12	38.84628	2	1080.562647	1079.561124	K	Q	728	738
PSM	QIHNFISTSTFSQYTVVDDIAVAK	3681	sp|P00329|ADH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:28	ms_run[1]:scan=1.1.3732.16	69.3348	3	2666.3372	2666.3222	K	I	137	161
PSM	IINEPTAAAIAYGLDKR	3682	sp|P20029|BIP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2904.11	46.09538	3	1814.981171	1814.989048	R	E	199	216
PSM	QEATLVVGGDGR	3683	sp|Q9D0F9|PGM1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2214.21	26.89873	2	1201.622047	1200.609865	R	F	53	65
PSM	EFFVGLSK	3684	sp|Q99LD8|DDAH2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2836.4	44.17222	2	925.482047	925.490919	R	W	135	143
PSM	DHLLIPVSNSEMEK	3685	sp|Q9CWS0|DDAH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2681.7	39.81325	3	1610.793971	1610.797408	K	V	254	268
PSM	QGLEYYHALK	3686	sp|Q8R146|APEH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:28	ms_run[1]:scan=1.1.2717.11	40.83098	2	1203.5859	1203.5919	K	A	682	692
PSM	KVDGQQTIIACIESHQFQAK	3687	sp|P47754|CAZA2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	11-UNIMOD:4	ms_run[1]:scan=1.1.2835.21	44.15792	3	2300.154971	2300.158316	K	N	147	167
PSM	RVPFMELIIPGITNGVEMLNNMPSPR	3688	sp|Q3UZZ6|ST1D1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3822.21	71.86972	3	2925.502271	2924.507461	K	I	78	104
PSM	FMAGQVSFGPWYDHVK	3689	sp|Q3UZZ6|ST1D1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3104.7	51.68207	3	1867.868471	1867.871576	K	S	162	178
PSM	EPGAYDWSSIVQHACELEGDR	3690	sp|P40936|INMT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	15-UNIMOD:4	ms_run[1]:scan=1.1.3461.13	61.68017	3	2418.048371	2418.054639	K	S	102	123
PSM	TFESLVDFCK	3691	sp|Q61425|HCDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	9-UNIMOD:4	ms_run[1]:scan=1.1.3111.6	51.87432	2	1245.569247	1244.574725	K	T	193	203
PSM	PFVELETNLPASR	3692	sp|O35215|DOPD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1	ms_run[1]:scan=1.1.3807.8	71.44302	2	1513.7771	1513.7771	M	I	2	15
PSM	IDVAVNCAGIAVAIK	3693	sp|O08756|HCD2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	7-UNIMOD:4	ms_run[1]:scan=1.1.3144.16	52.81832	2	1512.823247	1512.833400	R	T	85	100
PSM	YCTDTSIIFR	3694	sp|Q11136|PEPD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	2-UNIMOD:4	ms_run[1]:scan=1.1.2824.16	43.83942	2	1274.604247	1274.596523	R	Q	57	67
PSM	MNPQSAFFQGK	3695	sp|P32020|NLTP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2591.14	37.31892	2	1253.574447	1253.586293	K	L	512	523
PSM	SSALQWLTPEQTSGK	3696	sp|P24527|LKHA4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3006.20	48.94673	2	1631.808847	1631.815501	K	Q	113	128
PSM	SSMTQNLR	3697	sp|Q9CQR4|ACO13_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1	ms_run[1]:scan=1.1.2364.10	31.02055	2	977.4505	977.4595	M	E	2	10
PSM	SDQQLDCALDLMR	3698	sp|P47757|CAPZB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1,7-UNIMOD:4	ms_run[1]:scan=1.1.3715.8	68.86332	2	1605.7082	1605.7122	M	R	2	15
PSM	LSEGFSIHTR	3699	sp|O09061|PSB1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2192.3	26.28042	3	1145.571671	1145.582922	R	D	56	66
PSM	MEPAAEILVDSPDVVYSPETIEAR	3700	sp|Q9JHU9|INO1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1	ms_run[1]:scan=1.1.3878.7	73.43327	3	2672.2913	2672.2886	-	Y	1	25
PSM	FSSSTFEQVNQLVK	3701	sp|P21614|VTDB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3023.7	49.40125	2	1613.813247	1612.809687	K	E	52	66
PSM	LSNIFVIGK	3702	sp|P62702|RS4X_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2925.3	46.68128	2	989.584647	989.590967	R	G	222	231
PSM	NVFDEAILAALEPPEPK	3703	sp|P60766|CDC42_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3816.17	71.69932	2	1851.958447	1851.961831	K	K	167	184
PSM	VKPFMTGAAEQIK	3704	sp|P63028|TCTP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2310.11	29.53678	3	1418.748971	1418.759172	R	H	111	124
PSM	RPPSAFFLFCSEYRPK	3705	sp|P63158|HMGB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	17	10-UNIMOD:4	ms_run[1]:scan=1.1.2928.10	46.77268	3	2001.9952	2000.9922	K	I	97	113
PSM	AEEGIAAGGVMDVNTALQEVLK	3706	tr|F7AEH4|F7AEH4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1	ms_run[1]:scan=1.1.3910.4	74.29912	3	2256.1276	2256.1302	M	T	2	24
PSM	AFVEFLTDEIKEEK	3707	sp|O35658|C1QBP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3196.20	54.27628	2	1696.848047	1696.855969	K	K	78	92
PSM	AVLDLVDQCPK	3708	sp|Q3U5Q7|CMPK2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	9-UNIMOD:4	ms_run[1]:scan=1.1.2776.16	42.47855	2	1256.632447	1256.643474	R	E	235	246
PSM	AAVVESHK	3709	sp|P47791|GSHR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1574.12	9.098866	2	838.444047	839.450117	R	L	68	76
PSM	AENYDISPADR	3710	sp|Q02053|UBA1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2209.17	26.75962	2	1250.548647	1249.557495	R	H	870	881
PSM	ALDEYYDK	3711	sp|P50516|VATA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2214.17	26.8954	2	1016.447047	1015.449842	R	H	460	468
PSM	EGLELPEDEEEKK	3712	sp|P07901|HS90A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2285.12	28.85388	2	1542.728647	1543.725348	K	K	548	561
PSM	VPLVAMHHAYVVTER	3713	sp|Q99LB7|SARDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2361.7	30.93615	4	1720.892894	1720.908296	K	I	287	302
PSM	EIGTHKPLPGITVGDIGPK	3714	sp|Q9R0H0|ACOX1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2617.11	38.03592	3	1927.052771	1928.073112	R	F	211	230
PSM	AELFTQSCADLDK	3715	sp|Q62261|SPTB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	8-UNIMOD:4	ms_run[1]:scan=1.1.2642.20	38.73897	2	1497.674847	1496.681710	K	W	1382	1395
PSM	LETPSAK	3716	sp|P51174|ACADL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1748.9	13.91238	2	744.401647	744.401770	R	K	36	43
PSM	IQSTPVK	3717	sp|P62821|RAB1A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1708.11	12.81782	2	771.443847	771.449054	K	Q	192	199
PSM	HIYIDK	3718	sp|Q9WUM5|SUCA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1762.8	14.30555	2	787.415047	787.422839	K	N	49	55
PSM	HQGVMVGMGQK	3719	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	8-UNIMOD:35	ms_run[1]:scan=1.1.1696.11	12.4876	3	1186.548671	1186.558698	R	D	40	51
PSM	LDHLAEK	3720	sp|P57780|ACTN4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1675.10	11.89503	2	824.431447	824.439218	R	F	412	419
PSM	AVPTDEAR	3721	sp|P46638|RB11B_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1710.13	12.87522	2	857.422447	857.424296	R	A	133	141
PSM	KGPTEPLK	3722	sp|Q9Z2Y8|PLPHP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1667.12	11.67648	2	868.493247	868.501818	K	V	133	141
PSM	KTQDNIR	3723	sp|Q8K0L3|ACSM2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1571.16	9.019567	2	873.462447	873.466829	K	G	433	440
PSM	VVSSIEQK	3724	sp|P63101|1433Z_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1768.13	14.47767	2	888.482847	888.491647	R	T	61	69
PSM	VVSSIEQK	3725	sp|P63101|1433Z_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1762.12	14.3089	2	888.482847	888.491647	R	T	61	69
PSM	GTNESLER	3726	sp|P03995|GFAP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1696.16	12.49177	2	904.420247	904.425024	R	Q	298	306
PSM	GRIPVNNR	3727	sp|O08749|DLDH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1676.15	11.92708	2	924.516247	924.525347	K	F	335	343
PSM	TEELGHPR	3728	sp|Q91VM9|IPYR2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1652.18	11.26678	2	937.452847	937.461744	R	S	32	40
PSM	SAEAAAEATK	3729	sp|Q8VC30|TKFC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1649.13	11.17882	2	947.446647	947.455990	K	N	526	536
PSM	HLKPLQSK	3730	sp|Q9R0H0|ACOX1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1620.14	10.38178	2	949.561447	949.570901	K	L	653	661
PSM	VLEQGQHR	3731	sp|Q78JT3|3HAO_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1578.16	9.215234	2	965.494847	965.504278	R	D	66	74
PSM	RNPQTHLK	3732	sp|P24270|CATA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1572.18	9.04865	2	992.541647	992.551562	K	D	170	178
PSM	KHNLCGETEEER	3733	sp|O35660|GSTM6_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	5-UNIMOD:4	ms_run[1]:scan=1.1.1641.18	10.95922	3	1500.653171	1500.662705	R	I	83	95
PSM	LITEEASKR	3734	sp|Q9D6R2|IDH3A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1742.19	13.75622	2	1045.566647	1045.576774	K	I	170	179
PSM	ILATGGASHNK	3735	sp|Q3TNA1|XYLB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1634.21	10.77113	2	1067.562447	1067.572357	K	D	451	462
PSM	HESQVDSVVK	3736	sp|Q60870|REEP5_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1753.21	14.06297	2	1126.552247	1126.561852	R	D	144	154
PSM	AEMDAAVESCK	3737	sp|Q9EQ20|MMSA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	3-UNIMOD:35,10-UNIMOD:4	ms_run[1]:scan=1.1.1735.21	13.56347	2	1225.486247	1225.495489	K	R	77	88
PSM	RGYPVYSHTEK	3738	sp|Q91XE0|GLYAT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1720.20	13.14913	2	1335.645647	1335.657149	K	S	257	268
PSM	AQPSQAAEEPAEK	3739	sp|Q9R1P4|PSA1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1757.19	14.17402	2	1354.627847	1354.636474	K	A	244	257
PSM	HHPEDVEPALRK	3740	sp|Q9JII6|AK1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1755.16	14.11498	3	1426.720571	1426.731711	K	T	86	98
PSM	NQTAEKEEFEHQQK	3741	sp|P63017|HSP7C_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1689.20	12.29733	3	1744.789271	1744.801642	K	E	584	598
PSM	GVTHNIPLLR	3742	sp|Q91ZA3|PCCA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2365.6	31.04495	3	1118.646071	1118.656027	R	E	473	483
PSM	VDPVNFK	3743	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2211.7	26.80537	2	817.425447	817.433404	R	L	94	101
PSM	FPGQLNADLRK	3744	sp|A2AQ07|TBB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2317.13	29.73398	3	1257.673571	1257.682970	R	L	242	253
PSM	FYGDLEK	3745	sp|P14211|CALR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2243.6	27.68142	2	870.404047	870.412334	K	D	56	63
PSM	TIAPALVSK	3746	sp|P17182|ENOA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2253.6	27.95923	2	898.540847	898.548768	K	K	72	81
PSM	LYRPGSVAYVSR	3747	sp|Q91V92|ACLY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2218.8	26.99905	3	1366.728371	1366.735734	K	S	641	653
PSM	AHSSMVGVNLPQK	3748	sp|P09411|PGK1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2192.9	26.28543	3	1366.691171	1366.702719	R	A	172	185
PSM	IVVVTAGVR	3749	sp|P16125|LDHB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2318.5	29.7554	2	912.567047	912.575652	K	Q	92	101
PSM	IVVVTAGVR	3750	sp|P16125|LDHB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2302.6	29.31438	2	912.567047	912.575652	K	Q	92	101
PSM	VYYDLTR	3751	sp|Q60597|ODO1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2358.6	30.85533	2	928.457447	928.465432	K	E	908	915
PSM	QWLQEVK	3752	sp|P05202|AATM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2378.12	31.40865	2	929.490847	929.497067	K	G	339	346
PSM	IFVGGIKEDTEEHHLR	3753	sp|P49312|ROA1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2239.8	27.57298	4	1878.953294	1878.958811	K	D	107	123
PSM	FYEQFSK	3754	sp|P07901|HS90A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2253.10	27.96257	2	947.432447	947.438883	K	N	438	445
PSM	VNLGVGAYR	3755	sp|P05201|AATC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2369.11	31.15947	2	947.509447	947.518865	K	T	34	43
PSM	EELFVTSK	3756	sp|Q9JII6|AK1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2341.4	30.38935	2	951.482247	951.491313	R	L	73	81
PSM	MPEFYNR	3757	sp|P16460|ASSY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2358.7	30.857	2	955.413047	955.422187	R	F	147	154
PSM	MPEFYNR	3758	sp|P16460|ASSY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2355.10	30.77727	2	955.413047	955.422187	R	F	147	154
PSM	MPEFYNR	3759	sp|P16460|ASSY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2362.11	30.96665	2	955.413047	955.422187	R	F	147	154
PSM	VINDFVEK	3760	sp|P07758|A1AT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2264.10	28.26387	2	962.503647	962.507297	K	G	174	182
PSM	LQIQVDEK	3761	sp|Q9D7P6|ISCU_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2225.11	27.1953	2	971.522647	971.528761	K	G	76	84
PSM	LSNRPAFMPSEGR	3762	sp|P57780|ACTN4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2231.13	27.36037	3	1460.707571	1460.719432	R	M	367	380
PSM	ETTVVWDK	3763	sp|Q64516|GLPK_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2267.13	28.34937	2	976.478047	976.486562	R	V	95	103
PSM	QTANVLSGACGLHR	3764	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	10-UNIMOD:4	ms_run[1]:scan=1.1.2241.14	27.63295	3	1482.725171	1482.736145	K	G	92	106
PSM	IQSILSSGGK	3765	sp|Q60648|SAP3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2183.17	26.03657	2	988.545647	988.555310	R	R	170	180
PSM	LFGAAEVQR	3766	sp|P16546|SPTN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2340.10	30.36985	2	989.522647	989.529430	K	F	251	260
PSM	NIMALSDGGK	3767	sp|P12658|CALB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2318.7	29.75707	2	1004.486847	1004.496081	K	L	237	247
PSM	IWHHTFYNELR	3768	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2344.10	30.47588	3	1514.734571	1514.741882	K	V	85	96
PSM	GQALPEVVAK	3769	sp|Q8R0Y6|AL1L1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2297.8	29.17385	2	1010.566847	1010.576046	R	Y	63	73
PSM	VTLVSAAPEK	3770	sp|Q9CQR4|ACO13_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2185.14	26.0912	2	1013.568047	1013.575711	K	L	28	38
PSM	GHLLDSFAR	3771	sp|Q6P1B1|XPP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2327.14	30.01558	2	1014.530247	1014.524679	K	S	465	474
PSM	SLHTLFGDK	3772	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2262.2	28.20162	3	1016.520971	1016.529095	K	L	89	98
PSM	IGGHGAEYGAEALER	3773	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2237.14	27.52328	3	1528.718771	1528.727020	K	M	18	33
PSM	ENFSCLTR	3774	sp|P14152|MDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	5-UNIMOD:4	ms_run[1]:scan=1.1.2250.16	27.8856	2	1025.452447	1025.460030	K	L	150	158
PSM	HCLTGGEALNPDVR	3775	sp|Q8BGA8|ACSM5_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	2-UNIMOD:4	ms_run[1]:scan=1.1.2217.12	26.9743	3	1537.724171	1537.730725	R	D	341	355
PSM	LEQVLSSMK	3776	tr|Q91VA7|Q91VA7_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2346.13	30.53397	2	1033.538247	1033.547782	K	E	96	105
PSM	KHGCAFLVDEVQTGGGCTGK	3777	sp|P61922|GABT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	4-UNIMOD:4,17-UNIMOD:4	ms_run[1]:scan=1.1.2295.11	29.11948	4	2119.979294	2119.977909	R	F	318	338
PSM	SLQQLAEER	3778	sp|P16546|SPTN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2290.17	28.9857	2	1072.543647	1072.551287	R	S	1217	1226
PSM	YAIGSLNEGR	3779	sp|Q9DBL1|ACDSB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2358.10	30.862	2	1078.534047	1078.540723	K	I	285	295
PSM	TAAYVNAIEK	3780	sp|P26443|DHE3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2212.13	26.8375	2	1078.557247	1078.565875	R	V	536	546
PSM	ACALSIAESCRPGDK	3781	sp|Q8K2B3|SDHA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	2-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.2265.16	28.29665	3	1633.746971	1633.755226	R	V	466	481
PSM	CGDLEEELK	3782	sp|P58774|TPM2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:4	ms_run[1]:scan=1.1.2319.14	29.79102	2	1091.472847	1091.480490	K	I	190	199
PSM	GSDFDCELR	3783	sp|P61979|HNRPK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	6-UNIMOD:4	ms_run[1]:scan=1.1.2296.13	29.14952	2	1097.436447	1097.444774	K	L	140	149
PSM	VEFMDDTSR	3784	sp|P62858|RS28_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2329.16	30.07375	2	1098.460247	1098.465174	R	S	32	41
PSM	SFVDQYGQR	3785	sp|P12658|CALB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2287.13	28.901	2	1098.502247	1098.509423	K	D	60	69
PSM	YDDMAACMK	3786	sp|P63101|1433Z_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	7-UNIMOD:4	ms_run[1]:scan=1.1.2177.19	25.8711	2	1103.402447	1103.408588	R	S	19	28
PSM	SSDEAVILCK	3787	sp|Q9WVJ2|PSD13_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	9-UNIMOD:4	ms_run[1]:scan=1.1.2265.18	28.29832	2	1120.539247	1120.543425	K	T	106	116
PSM	QVEYLVNEK	3788	sp|P05201|AATC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2253.18	27.96925	2	1120.568247	1120.576440	K	H	370	379
PSM	LHVDPENFR	3789	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2295.4	29.11365	3	1125.547571	1125.556707	K	L	97	106
PSM	TGAEGAVLDEAK	3790	sp|P28738|KIF5C_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2172.18	25.73097	2	1159.562047	1159.572082	K	N	242	254
PSM	ATAVMPDGQFK	3791	sp|P35700|PRDX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2367.18	31.11052	2	1163.556647	1163.564495	K	D	17	28
PSM	HYFIEVNSR	3792	sp|Q05920|PYC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2266.16	28.32432	2	1163.561047	1163.572357	K	L	320	329
PSM	VVGDVAYDEAK	3793	sp|Q922D8|C1TC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2172.19	25.7318	2	1164.557647	1164.566269	K	E	252	263
PSM	LAAIQESGVER	3794	sp|Q60692|PSB6_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2192.17	26.2921	2	1171.612247	1171.619701	R	Q	209	220
PSM	GEFITTVQQR	3795	sp|P14152|MDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2357.10	30.83097	2	1177.600447	1177.609137	K	G	221	231
PSM	RLPEAIEEVK	3796	sp|Q91Z53|GRHPR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2258.15	28.10245	2	1182.653847	1182.660838	R	N	125	135
PSM	QHGIPIPVTPK	3797	sp|P16460|ASSY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2303.6	29.34177	3	1185.676271	1185.686993	K	S	166	177
PSM	SNFEEALAAHK	3798	sp|P09103|PDIA1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2239.4	27.56965	3	1215.581171	1215.588401	K	Y	34	45
PSM	AVENSSTAIGIR	3799	sp|O70435|PSA3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2198.21	26.46472	2	1216.631047	1216.641165	K	C	30	42
PSM	MEEFKDQLPADECNK	3800	sp|P38647|GRP75_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	13-UNIMOD:4	ms_run[1]:scan=1.1.2346.18	30.53813	3	1852.794671	1852.797150	K	L	596	611
PSM	VACIGAWHPAR	3801	tr|E9PWZ3|E9PWZ3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	3-UNIMOD:4	ms_run[1]:scan=1.1.2234.2	27.43197	3	1236.609971	1236.618596	K	V	251	262
PSM	LLGSPGSEDGAPR	3802	sp|P50171|DHB8_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2181.19	25.98172	2	1254.616647	1254.620430	R	G	52	65
PSM	LVKPGNQNTQVTEAWNK	3803	sp|P50580|PA2G4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2252.20	27.94378	3	1925.979371	1925.995925	R	V	156	173
PSM	VNADEVGGEALGR	3804	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2365.21	31.05747	2	1285.622047	1285.626243	K	L	19	32
PSM	ISVYYNEATGGK	3805	sp|P99024|TBB5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2351.18	30.67607	2	1300.618847	1300.629932	R	Y	47	59
PSM	VPGAWTEACGQK	3806	sp|Q8R0Y6|AL1L1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	9-UNIMOD:4	ms_run[1]:scan=1.1.2242.18	27.6638	2	1302.597047	1302.602671	K	L	230	242
PSM	VPLEVQEADEAK	3807	sp|Q9Z1Q9|SYVC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2313.17	29.62505	2	1326.660647	1326.666711	K	L	1230	1242
PSM	GPATVEELPSEAK	3808	sp|Q9Z2H7|GIPC2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2319.18	29.79435	2	1326.661047	1326.666711	K	A	231	244
PSM	GGGGNFGPGPGSNFR	3809	sp|O88569|ROA2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2336.14	30.26882	2	1376.612247	1376.622161	R	G	214	229
PSM	AVDPDSPAEASGLR	3810	sp|P70441|NHRF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2304.19	29.37988	2	1383.659847	1383.663023	R	A	176	190
PSM	ENPSANYTTMMK	3811	sp|Q3UZZ6|ST1D1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2380.20	31.47203	2	1385.585847	1385.595537	K	E	234	246
PSM	INVYYNEATGNK	3812	sp|Q9CWF2|TBB2B_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2318.19	29.76708	2	1384.657647	1384.662294	R	Y	47	59
PSM	VSAQGITLTDNQR	3813	tr|E9Q0S6|E9Q0S6_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2345.21	30.51277	2	1401.713847	1401.721206	K	K	1794	1807
PSM	NSSVGLIQLNRPK	3814	sp|Q8BH95|ECHM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2372.21	31.24983	2	1424.803047	1424.809962	K	A	44	57
PSM	SQGGEPTYNVAVGR	3815	sp|Q9JJV2|PROF2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2281.14	28.7446	2	1433.677647	1433.689906	K	A	92	106
PSM	FAQTVIGKPIEPR	3816	sp|Q9DBM2|ECHP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2377.10	31.37887	3	1454.814071	1454.824549	K	R	182	195
PSM	QTANVLSGACGLHR	3817	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	10-UNIMOD:4	ms_run[1]:scan=1.1.2227.10	27.25013	3	1482.725171	1482.736145	K	G	92	106
PSM	ASNSEDPPSVVEVR	3818	sp|Q9ET22|DPP2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2331.20	30.13302	2	1484.701047	1484.710701	R	K	459	473
PSM	LTDCVVMRDPASK	3819	sp|O88569|ROA2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	4-UNIMOD:4	ms_run[1]:scan=1.1.2210.12	26.78998	2	1490.714647	1490.722135	K	R	47	60
PSM	SALEHSVQCAVDVK	3820	sp|P24270|CATA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	9-UNIMOD:4	ms_run[1]:scan=1.1.2333.8	30.18805	2	1541.742847	1541.750792	R	R	417	431
PSM	IVAPISDSPKPPPQR	3821	sp|Q9CQ60|6PGL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2237.16	27.52495	3	1600.882571	1600.893691	K	V	171	186
PSM	VTVAGLAGKDPVQCSR	3822	sp|Q99LX0|PARK7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	14-UNIMOD:4	ms_run[1]:scan=1.1.2348.21	30.5963	2	1656.854047	1656.861740	K	D	33	49
PSM	VEKPVVEMDGDEMTR	3823	sp|P54071|IDHP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2368.18	31.13798	3	1733.788571	1733.796422	K	I	46	61
PSM	RLFLHESIHNEVVDR	3824	sp|Q9DBF1|AL7A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2239.7	27.57215	4	1862.966094	1862.975130	R	L	335	350
PSM	ALEHFTDLYDIKR	3825	sp|Q68FD5|CLH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2671.2	39.52635	4	1619.821294	1619.830757	R	A	626	639
PSM	LIDLHSPSEIVK	3826	sp|P60867|RS20_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2637.3	38.58292	3	1349.745071	1349.755467	R	Q	88	100
PSM	LFEMAYK	3827	sp|P38647|GRP75_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2613.5	37.91813	2	900.433647	900.441526	K	K	647	654
PSM	ARVDEYLAWQHTGLR	3828	sp|Q64471|GSTT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2670.6	39.5014	4	1813.910094	1813.922366	R	R	93	108
PSM	YIPAAIFK	3829	sp|Q91WR5|AK1CL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2783.5	42.66798	2	921.524047	921.532390	R	G	305	313
PSM	YIVPMITVDGKR	3830	sp|Q9JII6|AK1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2779.5	42.55367	3	1390.752671	1390.764257	R	V	298	310
PSM	FAFDYATK	3831	tr|Q91VA7|Q91VA7_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2638.6	38.6139	2	961.448047	961.454533	K	K	199	207
PSM	GNVGFVFTK	3832	sp|P14869|RLA0_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2629.7	38.36072	2	967.504047	967.512717	R	E	84	93
PSM	AALQELLSK	3833	sp|P62852|RS25_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2708.8	40.56937	2	971.555847	971.565147	R	G	86	95
PSM	FGVVVVGVGR	3834	sp|Q9CY64|BIEA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2793.5	42.9521	2	987.579647	987.586551	K	A	9	19
PSM	HEMLPANLIQAQR	3835	sp|Q9DCD0|6PGD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2601.6	37.58825	3	1519.780871	1519.792931	R	D	435	448
PSM	NCVILPHIGSATYK	3836	sp|Q91Z53|GRHPR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	2-UNIMOD:4	ms_run[1]:scan=1.1.2603.11	37.64798	3	1571.799671	1571.812999	K	T	287	301
PSM	EAFPAWSSR	3837	sp|Q8BH00|AL8A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2614.5	37.94512	2	1049.485047	1049.493044	R	S	56	65
PSM	EIIDPVLDR	3838	sp|P68368|TBA4A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2764.8	42.13563	2	1068.572647	1068.581525	K	I	113	122
PSM	CLDAFPNLK	3839	sp|P15626|GSTM2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:4	ms_run[1]:scan=1.1.2780.8	42.58468	2	1076.523447	1076.532466	K	D	174	183
PSM	ALEHFTDLYDIKR	3840	sp|Q68FD5|CLH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2666.9	39.39235	3	1619.823671	1619.830757	R	A	626	639
PSM	QPYFGAVVGR	3841	sp|Q8K157|GALM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2608.9	37.78665	2	1092.561647	1092.571629	K	V	69	79
PSM	LLDEAIQAVK	3842	sp|Q9EQH3|VPS35_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2712.11	40.6866	2	1098.618847	1098.628475	K	V	15	25
PSM	IEAACFATIK	3843	sp|Q9D6R2|IDH3A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	5-UNIMOD:4	ms_run[1]:scan=1.1.2600.12	37.5656	2	1122.566647	1122.574331	K	D	327	337
PSM	ALTGGIAHLFK	3844	sp|O08749|DLDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2682.7	39.84028	2	1126.638847	1126.649879	K	Q	133	144
PSM	CLDEFPNLK	3845	sp|P48774|GSTM5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:4	ms_run[1]:scan=1.1.2761.11	42.05443	2	1134.527647	1134.537946	K	A	177	186
PSM	KWLPELVDR	3846	sp|Q9EQ20|MMSA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2660.12	39.23207	2	1154.634847	1154.644794	K	A	331	340
PSM	HFCPNVPIILVGNKK	3847	sp|Q62159|RHOC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	3-UNIMOD:4	ms_run[1]:scan=1.1.2669.10	39.47667	3	1734.948971	1734.960331	K	D	105	120
PSM	NPITSVDAAFR	3848	sp|Q91X72|HEMO_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2780.13	42.58885	2	1189.597447	1189.609137	K	G	92	103
PSM	RVIISAPSADAPMFVMGVNHEK	3849	tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	13-UNIMOD:35	ms_run[1]:scan=1.1.2757.13	41.94335	4	2384.188094	2384.198072	K	Y	116	138
PSM	SGAQATWTEVSWPHEK	3850	sp|Q91X72|HEMO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2706.11	40.51513	3	1812.830471	1812.843112	K	V	385	401
PSM	AASDIAMTELPPTHPIR	3851	sp|P62259|1433E_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2705.12	40.48752	3	1818.917771	1818.929819	K	L	154	171
PSM	AASDIAMTELPPTHPIR	3852	sp|P62259|1433E_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2699.13	40.31668	3	1818.917771	1818.929819	K	L	154	171
PSM	AASDIAMTELPPTHPIR	3853	sp|P62259|1433E_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2692.14	40.11875	3	1818.917771	1818.929819	K	L	154	171
PSM	CAVVDVPFGGAK	3854	sp|P26443|DHE3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:4	ms_run[1]:scan=1.1.2719.14	40.89072	2	1218.601047	1218.606694	K	A	172	184
PSM	HLGLPVFNTVK	3855	sp|Q9WUM5|SUCA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2739.3	41.43963	3	1223.693171	1223.702643	K	E	95	106
PSM	ENVLIGEGAGFK	3856	sp|P45952|ACADM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2722.12	40.97547	2	1232.632047	1232.640102	K	I	260	272
PSM	LSLCGEESFGTGSDHIR	3857	sp|Q9D0F9|PGM1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	4-UNIMOD:4	ms_run[1]:scan=1.1.2618.18	38.06382	3	1863.839771	1863.842126	K	E	371	388
PSM	VTIEYYSQLK	3858	sp|Q9JLJ2|AL9A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2688.13	40.00775	2	1242.648247	1242.649604	R	T	472	482
PSM	EQDLQLEELK	3859	sp|Q9Z1Z0|USO1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2637.13	38.59127	2	1243.620247	1243.629597	R	Q	661	671
PSM	EKLEASITEYA	3860	sp|P10639|THIO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2690.14	40.06325	2	1252.611847	1252.618698	K	-	95	106
PSM	KVITAFNDGLNHLDSLK	3861	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2762.16	42.08653	3	1884.008471	1884.010512	K	G	67	84
PSM	IVEIPFNSTNK	3862	sp|Q8VDN2|AT1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2703.12	40.43062	2	1260.659847	1260.671403	K	Y	477	488
PSM	NIYYLCAPNR	3863	sp|Q9CQN1|TRAP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	6-UNIMOD:4	ms_run[1]:scan=1.1.2625.16	38.25627	2	1282.604647	1282.612842	R	H	498	508
PSM	HALIIYDDLSK	3864	sp|Q03265|ATPA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2619.19	38.09187	2	1286.678247	1286.687053	K	Q	306	317
PSM	KYTPEQVAMATVTALHR	3865	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	9-UNIMOD:35	ms_run[1]:scan=1.1.2690.17	40.06577	3	1930.985171	1930.993482	K	T	243	260
PSM	DFTPAAQAAFQK	3866	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2668.18	39.45542	2	1293.628647	1293.635351	K	V	122	134
PSM	KAPDFVFYAPR	3867	sp|P26040|EZRI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2737.4	41.38345	3	1309.670771	1309.681908	K	L	263	274
PSM	HTTIFEVLPEK	3868	sp|Q921I1|TRFE_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2673.18	39.59682	2	1312.694247	1312.702703	K	A	226	237
PSM	LVTADIITVENK	3869	sp|Q91WU5|AS3MT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2791.17	42.90605	2	1314.729647	1314.739482	R	E	231	243
PSM	FLIPNASQPESK	3870	sp|P63101|1433Z_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2605.15	37.7076	2	1329.683647	1329.692866	K	V	104	116
PSM	IGAFGYMECSAK	3871	sp|Q9QUI0|RHOA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	9-UNIMOD:4	ms_run[1]:scan=1.1.2685.14	39.92722	2	1332.576447	1332.584244	R	T	151	163
PSM	AEAERDVLFPGYTHLQR	3872	sp|Q91YI0|ARLY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2598.18	37.51523	3	2000.999771	2001.006824	R	A	147	164
PSM	VVGAMQLYSVDR	3873	sp|Q68FD5|CLH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2773.18	42.39668	2	1336.668647	1336.680921	R	K	177	189
PSM	GAISCVNVHICDSPFHCTMEEAR	3874	sp|Q91VM9|IPYR2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	5-UNIMOD:4,11-UNIMOD:4,17-UNIMOD:4	ms_run[1]:scan=1.1.2789.16	42.84875	4	2689.154894	2689.150547	K	S	281	304
PSM	GSTDNLMDDIER	3875	sp|P42932|TCPQ_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2772.14	42.36535	2	1364.576647	1364.587809	R	A	379	391
PSM	TSEGSWEPFASGK	3876	sp|P07309|TTHY_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2667.19	39.42838	2	1381.609447	1381.615010	K	T	56	69
PSM	KLDLFANVVHVK	3877	tr|Q91VA7|Q91VA7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2719.7	40.88488	3	1381.799171	1381.808171	R	S	134	146
PSM	AVLEALGSCLNNK	3878	sp|P50431|GLYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	9-UNIMOD:4	ms_run[1]:scan=1.1.2793.16	42.96128	2	1387.719847	1387.712950	R	Y	54	67
PSM	ETSIIGVSLSSSTK	3879	sp|P47199|QOR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2780.19	42.59387	2	1407.738047	1407.745690	K	E	265	279
PSM	EACDTSFNVNLR	3880	sp|Q91X52|DCXR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	3-UNIMOD:4	ms_run[1]:scan=1.1.2626.19	38.28687	2	1424.627847	1424.635428	K	A	98	110
PSM	EACDTSFNVNLR	3881	sp|Q91X52|DCXR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	3-UNIMOD:4	ms_run[1]:scan=1.1.2632.17	38.45252	2	1424.627847	1424.635428	K	A	98	110
PSM	APQVSTPTLVEAAR	3882	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2605.18	37.71012	2	1438.772247	1438.777993	K	N	439	453
PSM	DNPGVVTCLDEAR	3883	sp|Q02053|UBA1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	8-UNIMOD:4	ms_run[1]:scan=1.1.2623.20	38.20367	2	1444.656647	1444.661643	K	H	227	240
PSM	AGVSISVVHGNLSEEAANQMR	3884	sp|P36552|HEM6_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2735.18	41.33845	3	2168.056271	2168.064415	K	G	192	213
PSM	THLPGFVEQAGALK	3885	sp|P99029|PRDX5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2648.19	38.90862	2	1466.783047	1466.788164	K	A	99	113
PSM	LREMLNISGPPLK	3886	sp|Q9CPY7|AMPL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2711.3	40.65112	3	1466.817671	1466.827920	K	A	67	80
PSM	LEAPDADELPRSDFDPGQDTYQHPPK	3887	sp|Q99KI0|ACON_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2770.20	42.3136	4	2937.340894	2937.341696	K	D	524	550
PSM	VILSSSSSCLLPSK	3888	sp|Q99KP3|CRYL1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	9-UNIMOD:4	ms_run[1]:scan=1.1.2733.19	41.2836	2	1476.777847	1476.785781	R	L	117	131
PSM	GILAADESVGTMGNR	3889	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2641.21	38.71137	2	1489.714247	1489.719492	K	L	29	44
PSM	FKLEAPDADELPR	3890	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2780.20	42.5947	2	1499.751847	1499.762009	K	S	522	535
PSM	EVSFQATGDSEWR	3891	sp|O35658|C1QBP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2697.18	40.26345	2	1510.661047	1510.668836	K	D	204	217
PSM	NSCPPTAELLGSPGR	3892	sp|P46412|GPX3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	3-UNIMOD:4	ms_run[1]:scan=1.1.2607.19	37.7678	2	1554.735047	1554.746041	K	L	154	169
PSM	VVEIAPATHLDPQLR	3893	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2698.9	40.28462	3	1657.906871	1657.915155	K	S	274	289
PSM	VASSVPVENFTIHGGLSR	3894	sp|Q60597|ODO1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2759.20	42.00555	2	1868.967447	1868.974461	K	I	620	638
PSM	IFVGGIKEDTEEYNLR	3895	sp|Q8BG05|ROA3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2769.11	42.27787	3	1881.936671	1881.947243	K	D	128	144
PSM	NVMLLPVGSADDGAHSQNEK	3896	sp|Q9D1A2|CNDP2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2623.19	38.20284	3	2080.986971	2080.984768	K	L	431	451
PSM	RAATVMLAAGWTHSSPAGFR	3897	sp|P11930|NUD19_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2703.17	40.43478	3	2086.039571	2086.053062	R	L	9	29
PSM	DIFAMDDKSENEPIENEAAR	3898	sp|Q9Z2I8|SUCB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	5-UNIMOD:35	ms_run[1]:scan=1.1.2629.19	38.37074	3	2309.005271	2309.011771	K	Y	273	293
PSM	GVEVTVGHEQEEGGKWPYAGTAEAIK	3899	sp|Q9D172|GAL3A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2659.15	39.20683	4	2741.336894	2741.329674	K	A	187	213
PSM	ASLQNLLSASQAR	3900	sp|P35505|FAAA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2855.3	44.70658	3	1357.721171	1357.731377	R	L	83	96
PSM	LYNLFLK	3901	sp|Q9Z2I9|SUCB1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2993.2	48.56522	2	909.524247	909.532390	K	Y	243	250
PSM	NLFWIQK	3902	sp|Q60866|PTER_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2988.2	48.43002	2	947.514047	947.522888	K	N	56	63
PSM	EAFSLFDK	3903	sp|P0DP26|CALM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2908.2	46.20063	2	955.458447	955.465098	K	D	15	23
PSM	EAFSLFDK	3904	sp|P0DP26|CALM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2902.3	46.0319	2	955.458447	955.465098	K	D	15	23
PSM	AAEMLLFGK	3905	sp|Q78JN3|ECI3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2907.3	46.17302	2	978.514447	978.520839	K	K	217	226
PSM	EPFTFPVR	3906	sp|Q91V76|CK054_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2877.4	45.33502	2	991.504447	991.512717	K	G	44	52
PSM	LVEDHLAVQSLIR	3907	tr|E9Q7L0|E9Q7L0_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2817.7	43.63148	3	1491.831371	1491.840928	K	A	110	123
PSM	LACGVIGIAQ	3908	sp|P08228|SODC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	3-UNIMOD:4	ms_run[1]:scan=1.1.2947.3	47.29722	2	1000.527647	1000.537552	R	-	145	155
PSM	ITISDCGQL	3909	sp|P17742|PPIA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	6-UNIMOD:4	ms_run[1]:scan=1.1.2813.7	43.5166	2	1005.473447	1005.480097	K	-	156	165
PSM	EAVLIDPVLETAHR	3910	sp|Q9DCM0|ETHE1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2864.8	44.96881	3	1561.839671	1561.846407	R	D	47	61
PSM	GHTVVGVEISEIGIR	3911	sp|O55060|TPMT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2843.5	44.36803	3	1564.845071	1564.857306	R	E	78	93
PSM	NSTFSELFK	3912	sp|P40142|TKT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2881.3	45.44505	2	1071.516047	1071.523676	K	K	344	353
PSM	GECYGLHAFVVPIR	3913	sp|Q9R0H0|ACOX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	3-UNIMOD:4	ms_run[1]:scan=1.1.2966.7	47.82969	3	1616.803571	1616.813333	R	E	197	211
PSM	EGNSFGFSLK	3914	sp|Q9JIL4|NHRF3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2802.6	43.2073	2	1084.511247	1084.518925	K	T	141	151
PSM	RSSGPALWWMNGSGK	3915	sp|Q8K0L3|ACSM2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2795.9	43.01163	3	1632.776771	1632.783095	K	E	63	78
PSM	YFDLGLPNR	3916	sp|P54071|IDHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2997.4	48.67865	2	1093.546047	1093.555644	K	D	81	90
PSM	TDVNYTQLVDLHAR	3917	sp|O70325|GPX4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2824.9	43.83357	3	1643.817971	1643.826734	K	Y	76	90
PSM	MIPCDFLIPVQTQHPIRK	3918	sp|P06745|G6PI_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	4-UNIMOD:4	ms_run[1]:scan=1.1.2938.4	47.05382	4	2192.151694	2192.159836	K	G	401	419
PSM	ELLTEFGYK	3919	sp|Q8BFR5|EFTU_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2918.6	46.484	2	1098.550447	1098.559727	R	G	201	210
PSM	NLDYVATSIHEAVTK	3920	sp|P05201|AATC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2803.7	43.23645	3	1659.841271	1659.846801	K	I	397	412
PSM	TDVAAPFGGFK	3921	sp|Q8R0Y6|AL1L1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2817.10	43.63398	2	1108.547647	1108.555310	K	Q	866	877
PSM	IFEAQIAGLR	3922	sp|Q9DCV7|K2C7_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2884.10	45.53367	2	1116.618847	1116.629144	R	Q	134	144
PSM	FSSVLWEEK	3923	sp|Q99LB2|DHRS4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2800.8	43.15185	2	1123.547047	1123.554976	R	A	220	229
PSM	GQFSTDELVAEVEKR	3924	sp|Q68FD5|CLH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2959.5	47.62855	3	1706.837171	1706.847529	R	N	838	853
PSM	ALLTPVAIAAGR	3925	sp|P47791|GSHR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2934.8	46.94327	2	1151.693647	1151.702643	K	K	358	370
PSM	SIPAVLEIPSK	3926	sp|Q9D1K2|VATF_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2959.7	47.63022	2	1152.667047	1152.675425	R	E	84	95
PSM	EKVDLLFLGK	3927	sp|Q9DCW4|ETFB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2910.8	46.2622	2	1160.673247	1160.680511	K	Q	115	125
PSM	FLYECPWR	3928	sp|Q05920|PYC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	5-UNIMOD:4	ms_run[1]:scan=1.1.2939.3	47.0801	2	1169.521647	1169.532801	R	R	618	626
PSM	SILFVPTSAPR	3929	sp|P08113|ENPL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2932.12	46.88913	2	1186.661447	1186.671009	K	G	385	396
PSM	VEGGTPLFTLR	3930	sp|Q9D2G2|ODO2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2923.10	46.6302	2	1188.642247	1188.650273	K	K	135	146
PSM	LNFGLAMEQAK	3931	sp|Q8VC30|TKFC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2900.10	45.9809	2	1220.610647	1220.622344	R	A	116	127
PSM	IVPNILLEQGK	3932	sp|Q9CZU6|CISY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2894.12	45.81483	2	1222.719647	1222.728524	K	A	383	394
PSM	QITINDLPVGR	3933	sp|P35700|PRDX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2869.12	45.11562	2	1224.673847	1224.682636	R	S	141	152
PSM	LWTLVSEQTR	3934	sp|P14115|RL27A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2834.11	44.121	2	1231.646847	1231.656087	K	V	78	88
PSM	NQVLTLEDWK	3935	sp|O55060|TPMT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2942.4	47.1692	2	1244.629647	1244.640102	K	E	16	26
PSM	VNTIPGFDGVVK	3936	sp|Q91ZA3|PCCA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2871.11	45.1723	2	1244.671047	1244.676488	K	D	185	197
PSM	TPALCEVFCR	3937	sp|Q60928|GGT1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	5-UNIMOD:4,9-UNIMOD:4	ms_run[1]:scan=1.1.2839.13	44.26433	2	1251.569647	1251.574014	K	Q	187	197
PSM	MVVDSAYEVIK	3938	sp|P16125|LDHB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2800.11	43.15435	2	1252.632247	1252.637325	K	L	234	245
PSM	LGVSCEVIDLR	3939	sp|Q6P3A8|ODBB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	5-UNIMOD:4	ms_run[1]:scan=1.1.2917.16	46.46408	2	1259.647247	1259.654373	K	T	293	304
PSM	EVGADFTIQVGK	3940	sp|Q64442|DHSO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2848.12	44.51402	2	1262.641247	1262.650667	K	E	215	227
PSM	GTVTDFPGFDGR	3941	sp|P48036|ANXA5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2852.17	44.63213	2	1267.573047	1267.583316	R	A	5	17
PSM	LELTPVAIQAGR	3942	sp|Q9JMH6|TRXR1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2878.13	45.37032	2	1266.721447	1266.729586	K	L	454	466
PSM	GTVTDFPGFDGR	3943	sp|P48036|ANXA5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2846.15	44.4601	2	1267.573047	1267.583316	R	A	5	17
PSM	EFSPFGTITSAK	3944	sp|P29341|PABP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2965.11	47.8045	2	1283.632847	1283.639768	K	V	313	325
PSM	SPGQDPIPIVLR	3945	sp|Q5FWK3|RHG01_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2994.11	48.60032	2	1290.720647	1290.729586	K	E	253	265
PSM	GVIDMGNSLIER	3946	sp|P16546|SPTN1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2987.7	48.41225	2	1302.652447	1302.660186	R	G	1608	1620
PSM	LVGSQEELASWGHEYVR	3947	sp|Q8VDM4|PSMD2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2862.15	44.91727	3	1958.937971	1958.948640	R	H	144	161
PSM	TAGYPNVNIHNFTTSWR	3948	sp|Q62261|SPTB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2979.10	48.19158	3	1976.936471	1976.949309	K	D	187	204
PSM	SALALVTGAGSGIGR	3949	sp|P50171|DHB8_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2883.15	45.51012	2	1328.731447	1328.741213	R	A	9	24
PSM	LVIPSELGYGER	3950	sp|P45878|FKBP2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2950.11	47.38335	2	1331.700047	1331.708516	K	G	102	114
PSM	SIQADGLVWGSSK	3951	sp|O70251|EF1B_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2812.18	43.49708	2	1346.676647	1346.683030	R	L	164	177
PSM	FEIWDTAGQER	3952	sp|P35278|RAB5C_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2904.15	46.09872	2	1350.616847	1350.620430	K	Y	72	83
PSM	SLETSLVPLSDPK	3953	sp|Q9R0N0|GALK1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2954.15	47.49627	2	1384.738047	1384.744961	R	L	205	218
PSM	TPYTDVNIVTIR	3954	sp|Q9D6R2|IDH3A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2904.17	46.10038	2	1390.740047	1390.745630	K	E	135	147
PSM	FAVYLPPQAESGK	3955	sp|Q9R0P3|ESTD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2857.14	44.7731	2	1405.716247	1405.724166	R	C	32	45
PSM	LTAIPVSAFCDSK	3956	sp|Q71RI9|KAT3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	10-UNIMOD:4	ms_run[1]:scan=1.1.2924.20	46.667	2	1407.695447	1407.706802	K	S	408	421
PSM	LIIQWNGPESNR	3957	sp|Q62468|VILI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2908.15	46.21148	2	1425.730247	1425.736462	K	M	173	185
PSM	LPCIFICENNR	3958	sp|P35486|ODPA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	3-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=1.1.2988.10	48.4392	2	1434.668647	1434.674791	K	Y	216	227
PSM	LPCIFICENNR	3959	sp|P35486|ODPA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	3-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=1.1.2975.14	48.08383	2	1434.668647	1434.674791	K	Y	216	227
PSM	PFESIDQGHVTHNWDEVGPDPNQLR	3960	sp|O09173|HGD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2858.20	44.80673	4	2886.324494	2886.332134	K	W	72	97
PSM	EQFLDGDAWTNR	3961	sp|P14211|CALR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2899.16	45.95768	2	1450.637247	1450.647707	K	W	25	37
PSM	LSSLDVVHAALVNK	3962	sp|Q91XE0|GLYAT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2904.5	46.09037	3	1464.822071	1464.830029	K	F	170	184
PSM	AVLITYGPYAVNGK	3963	sp|Q9DCS2|MTL26_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2912.16	46.32468	2	1464.790647	1464.797666	K	I	134	148
PSM	ENLLEEQGSIALR	3964	sp|P16546|SPTN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2954.16	47.49712	2	1470.759647	1470.767822	R	Q	1033	1046
PSM	SGALLACGIVNSGVR	3965	sp|Q8VDM4|PSMD2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	7-UNIMOD:4	ms_run[1]:scan=1.1.2812.20	43.49875	2	1472.768447	1472.776947	K	N	442	457
PSM	SVEVSDPVPAGDLVK	3966	sp|P21981|TGM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2797.16	43.0736	2	1510.777647	1510.787889	K	A	634	649
PSM	NNREEQIISLFR	3967	sp|Q99KR3|LACB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2938.2	47.05215	3	1517.787671	1517.795040	R	D	218	230
PSM	NVEGQDMLYQSLK	3968	sp|O35643|AP1B1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2818.18	43.6693	2	1523.724647	1523.728994	R	L	886	899
PSM	STGTFVVSQPLNYR	3969	sp|Q9JLJ2|AL9A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	16		ms_run[1]:scan=1.1.2822.20	43.78548	2	1567.7923	1567.7989	M	G	2	16
PSM	MSLQPNEICVIQR	3970	sp|O09173|HGD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	9-UNIMOD:4	ms_run[1]:scan=1.1.2914.20	46.38358	2	1586.789447	1586.790883	K	G	172	185
PSM	VVAFSGDNPASLAGMR	3971	sp|Q3TNA1|XYLB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2965.19	47.81118	2	1590.775647	1590.782426	K	L	289	305
PSM	LRDYIWNTLNSGR	3972	sp|Q9CZU6|CISY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2822.4	43.77213	3	1606.810271	1606.821589	K	V	328	341
PSM	KPIGLCCIAPVLAAK	3973	sp|Q9D172|GAL3A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	6-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=1.1.2878.6	45.36447	3	1609.901471	1609.904791	K	V	169	184
PSM	CCLGWDFSTQQVK	3974	sp|Q3TNA1|XYLB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:4,2-UNIMOD:4	ms_run[1]:scan=1.1.3000.20	48.77755	2	1627.704847	1627.712298	R	V	24	37
PSM	FNALFAQGNYSEAAK	3975	sp|Q68FD5|CLH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2818.20	43.67097	2	1629.772247	1629.778721	K	V	368	383
PSM	YDGQVAVFGSDFQEK	3976	sp|Q02053|UBA1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2965.21	47.81285	2	1688.760847	1688.768216	R	L	451	466
PSM	EAVTEILGIEPDREK	3977	sp|Q62348|TSN_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2882.3	45.47252	3	1697.879171	1697.883580	R	G	117	132
PSM	RIPGGPQMIQLSLDGK	3978	sp|P17563|SBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2897.6	45.89285	3	1708.920971	1708.929425	K	R	382	398
PSM	NYTDDAIETDDLTIK	3979	sp|Q9Z2U0|PSA7_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2922.21	46.61083	2	1725.787647	1725.794491	K	L	175	190
PSM	MLDAEDIVNTARPDEK	3980	sp|P57780|ACTN4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2803.12	43.24063	3	1815.861071	1815.867278	K	A	241	257
PSM	MTDSFTEQADQVTADVGK	3981	sp|Q8BVI4|DHPR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2900.21	45.99008	2	1941.857247	1941.862587	K	L	53	71
PSM	YPLEEFTTDNQQEEAR	3982	sp|P61922|GABT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2805.15	43.29885	3	1968.876371	1968.870115	K	C	253	269
PSM	GAYHGCSPYTLGLTNVGIYK	3983	sp|Q3UEG6|AGT2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	6-UNIMOD:4	ms_run[1]:scan=1.1.2955.16	47.52487	3	2170.041371	2170.051725	R	M	194	214
PSM	RVIISAPSADAPMFVMGVNHEK	3984	tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2906.11	46.15157	4	2368.204494	2368.203157	K	Y	116	138
PSM	LCAIPNLRENYGELADCCTK	3985	sp|P07724|ALBU_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	2-UNIMOD:4,17-UNIMOD:4,18-UNIMOD:4	ms_run[1]:scan=1.1.2895.19	45.84843	3	2396.082671	2396.092287	K	Q	98	118
PSM	QYLVFHDGDSVVFAGPAGNSVETR	3986	sp|Q8R146|APEH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3109.20	51.8312	3	2564.226071	2564.229566	R	G	66	90
PSM	VNLAELFK	3987	sp|P99029|PRDX5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3184.2	53.92535	2	932.525647	932.533118	K	G	72	80
PSM	FIIPNIVK	3988	sp|P06151|LDHA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3085.3	51.14892	2	942.583247	942.590239	K	Y	119	127
PSM	DLTDYLMK	3989	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3183.2	53.89788	2	997.473647	997.479034	R	I	184	192
PSM	VISSILAFR	3990	sp|Q99JW2|ACY1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3021.2	49.33647	2	1004.593847	1004.601866	K	E	222	231
PSM	VVINVPIFK	3991	sp|P97494|GSH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3152.4	53.03985	2	1027.633847	1027.643003	K	D	201	210
PSM	VSFELFADK	3992	sp|P17742|PPIA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3077.2	50.91727	2	1054.531447	1054.533512	R	V	20	29
PSM	ADVLLEPFR	3993	sp|O09174|AMACR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3038.5	49.81163	2	1058.569647	1058.576046	R	C	72	81
PSM	GWPLYLSTK	3994	sp|O88844|IDHC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3004.3	48.87655	2	1063.561447	1063.570232	K	N	204	213
PSM	EAEILEVLR	3995	sp|P36552|HEM6_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3088.5	51.23587	2	1070.587047	1070.597175	K	H	428	437
PSM	INEAFDLLR	3996	sp|P00329|ADH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3044.6	49.98493	2	1089.573647	1089.581859	K	S	356	365
PSM	INEAFDLLR	3997	sp|P00329|ADH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3032.6	49.64117	2	1089.573647	1089.581859	K	S	356	365
PSM	MPTLGLGTWK	3998	sp|P45376|ALDR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3072.4	50.77733	2	1102.576447	1102.584502	K	S	13	23
PSM	FTLVAWDPR	3999	sp|Q8R164|BPHL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3202.4	54.43508	2	1103.568447	1103.576380	R	G	89	98
PSM	MLLFTEVTR	4000	sp|Q61598|GDIB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3063.7	50.5217	2	1108.585447	1108.595066	K	Y	90	99
PSM	LVALLDTLDR	4001	sp|P58389|PTPA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3187.6	54.01088	2	1127.649447	1127.655024	K	W	77	87
PSM	GVPTGFVLPIR	4002	sp|Q922D8|C1TC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3203.5	54.46452	2	1154.674447	1154.681179	K	D	879	890
PSM	GHIASVLNAWPEDVVK	4003	sp|P06801|MAOX_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3011.4	49.07173	3	1733.908271	1733.910070	K	A	131	147
PSM	AIVAIENPADVSVISSR	4004	sp|P14206|RSSA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3125.10	52.27088	3	1739.930471	1739.941764	R	N	64	81
PSM	TMEEILEGLK	4005	sp|P07759|SPA3K_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3179.8	53.79278	2	1161.586847	1161.595126	K	F	94	104
PSM	TMEEILEGLK	4006	sp|P07759|SPA3K_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3173.8	53.6251	2	1161.586847	1161.595126	K	F	94	104
PSM	APDFVFYAPR	4007	sp|P26040|EZRI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3073.5	50.8063	2	1181.580247	1181.586945	K	L	264	274
PSM	VMVTNVTSLLK	4008	sp|P26039|TLN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3041.6	49.89865	2	1203.680847	1203.689695	K	T	2120	2131
PSM	GIYMWDVEGR	4009	sp|P29758|OAT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3048.12	50.10477	2	1224.553847	1224.559744	K	Q	67	77
PSM	ADVDLIVQDLK	4010	sp|Q9JLI6|SCLY_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3135.9	52.55408	2	1227.663847	1227.671068	R	Q	412	423
PSM	DVVVDLVCYR	4011	tr|E9Q7L0|E9Q7L0_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	8-UNIMOD:4	ms_run[1]:scan=1.1.3147.10	52.89978	2	1236.615647	1236.617259	K	R	506	516
PSM	LSTIALALGVER	4012	sp|Q76MZ3|2AAA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3143.7	52.78195	2	1241.727647	1241.734337	K	T	35	47
PSM	LSTIALALGVER	4013	sp|Q76MZ3|2AAA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3149.5	52.95355	2	1241.727647	1241.734337	K	T	35	47
PSM	YWEAFLPEAK	4014	sp|Q9CWK8|SNX2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3197.13	54.29908	2	1252.608047	1252.612825	K	A	507	517
PSM	AITGASLADIMAK	4015	sp|Q8BP67|RL24_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3045.11	50.01785	2	1260.665447	1260.674773	R	R	81	94
PSM	GVVFSVTTVDLK	4016	sp|Q9QYB1|CLIC4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3094.8	51.40733	2	1263.698047	1263.707454	K	R	49	61
PSM	ELLLQPVTISR	4017	sp|P59999|ARPC4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3056.9	50.32375	2	1267.739047	1267.749987	K	N	45	56
PSM	VGEIEFEGLMR	4018	sp|Q9QYB5|ADDG_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3151.9	53.01502	2	1278.621647	1278.627823	K	T	366	377
PSM	ALSDALTELGYK	4019	sp|P50431|GLYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3163.6	53.34627	2	1279.656447	1279.665983	R	I	331	343
PSM	AATFFGCIGIDK	4020	sp|P55264|ADK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	7-UNIMOD:4	ms_run[1]:scan=1.1.3133.8	52.49603	2	1298.623847	1298.632909	K	F	99	111
PSM	YVRPGGGFEPNFTLFEK	4021	sp|P11352|GPX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3124.12	52.24415	3	1956.969671	1956.973398	K	C	96	113
PSM	HLLPLVQCPTLIVHGEKDPLVPR	4022	sp|Q8R164|BPHL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	8-UNIMOD:4	ms_run[1]:scan=1.1.3036.13	49.76098	4	2630.469694	2630.473048	R	F	227	250
PSM	AVAALLTIPEAEK	4023	sp|Q6ZQ38|CAND1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3021.10	49.34313	2	1324.747447	1324.760218	R	S	1179	1192
PSM	YQIPALAQAGFR	4024	sp|P34914|HYES_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3106.11	51.74098	2	1333.702847	1333.714270	R	V	274	286
PSM	QVFFELNGQLR	4025	sp|Q05920|PYC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3114.10	51.96002	2	1349.696847	1349.709185	R	S	1075	1086
PSM	FTASAGIQVVGDDLTVTNPK	4026	sp|P17182|ENOA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3150.14	52.99007	3	2032.042871	2032.047686	K	R	307	327
PSM	PEFLEDPSVLTK	4027	sp|Q61033|LAP2A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	16		ms_run[1]:scan=1.1.3038.15	49.81998	2	1373.6975	1373.7073	M	D	2	14
PSM	ELEEIVQPIISK	4028	sp|P20029|BIP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3077.11	50.92477	2	1396.769247	1396.781347	K	L	623	635
PSM	CQPPDAVVWPQNVDQVSR	4029	sp|Q7TNG8|LDHD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:4	ms_run[1]:scan=1.1.3006.15	48.94255	3	2093.988671	2093.995273	R	V	63	81
PSM	CDVIAQGIVMAVK	4030	sp|Q9Z2I9|SUCB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:4	ms_run[1]:scan=1.1.3117.16	52.04902	2	1402.720247	1402.731243	R	D	384	397
PSM	TVQGAFFGVPVYK	4031	sp|Q61838|PZP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3170.10	53.5427	2	1411.745447	1411.749987	K	D	625	638
PSM	DAGVSTYMYEFR	4032	tr|D3Z5G7|D3Z5G7_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3136.14	52.58703	2	1437.621847	1437.623466	R	Y	439	451
PSM	TPSSDVLVFDYTK	4033	sp|Q60972|RBBP4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3038.16	49.82082	2	1470.720647	1470.724226	K	H	144	157
PSM	EGPAVVGQFIQDVK	4034	sp|Q6ZQ38|CAND1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3161.3	53.29088	2	1485.774447	1485.782744	K	N	813	827
PSM	VFTAIADQPWAQR	4035	sp|Q8BJY1|PSMD5_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3001.16	48.80272	2	1501.763247	1501.767763	K	L	417	430
PSM	LVWIETPTNPTLK	4036	sp|Q8VCN5|CGL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3133.16	52.5027	2	1510.828047	1510.839531	K	L	152	165
PSM	QCFLYMVCQTAK	4037	sp|Q9DCY0|KEG1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	2-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.3006.18	48.94507	2	1547.688047	1547.693477	K	K	129	141
PSM	VDFPQDQLATLTGR	4038	sp|P08249|MDHM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3189.17	54.07507	2	1559.786047	1559.794371	K	I	216	230
PSM	GFGFVDFNSEEDAK	4039	sp|P09405|NUCL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3144.18	52.82	2	1560.665447	1560.673253	K	A	608	622
PSM	YYVGDTEDVLFEK	4040	sp|Q78JT3|3HAO_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3093.12	51.38307	2	1576.723647	1576.729705	R	W	118	131
PSM	SFNRGDVFLLDLGK	4041	sp|Q62468|VILI_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3166.2	53.42528	3	1579.831871	1579.835842	K	L	159	173
PSM	TCEDWVDGISQFK	4042	sp|Q8R164|BPHL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	2-UNIMOD:4	ms_run[1]:scan=1.1.3203.17	54.47453	2	1583.687647	1583.692609	K	Q	205	218
PSM	TCEDWVDGISQFK	4043	sp|Q8R164|BPHL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	2-UNIMOD:4	ms_run[1]:scan=1.1.3191.19	54.13242	2	1583.687647	1583.692609	K	Q	205	218
PSM	VVDLLAQDADIVCR	4044	sp|P46664|PURA2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	13-UNIMOD:4	ms_run[1]:scan=1.1.3169.16	53.51997	2	1585.802247	1585.813392	K	C	46	60
PSM	FGFQAPNVTFLHGR	4045	sp|Q91WU5|AS3MT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3056.5	50.3204	3	1589.795471	1589.810296	K	I	123	137
PSM	PVIAAIHGGCIGGGVDLVSACDIR	4046	sp|O35459|ECH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	10-UNIMOD:4,21-UNIMOD:4	ms_run[1]:scan=1.1.3123.18	52.22066	3	2406.205271	2406.214785	K	Y	161	185
PSM	VFVHYTGWLLDGTK	4047	sp|P30416|FKBP4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3086.4	51.1783	3	1634.835671	1634.845679	R	F	53	67
PSM	EGGSIPVTLTFQEATGK	4048	sp|Q9D1A2|CNDP2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3110.19	51.85788	2	1733.877847	1733.883580	R	N	414	431
PSM	AILNYIATKYDLYGK	4049	tr|E9Q6L7|E9Q6L7_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3114.4	51.955	3	1744.931471	1744.939973	R	D	70	85
PSM	QNPDIPQLEPSDYLR	4050	sp|Q9DBM2|ECHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3173.20	53.63512	2	1783.866647	1783.874078	R	R	680	695
PSM	VSHALAEGLGVIACIGEK	4051	sp|P17751|TPIS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	14-UNIMOD:4	ms_run[1]:scan=1.1.3127.20	52.33648	2	1822.951447	1822.961119	K	L	164	182
PSM	TLSPGDSFSTFDTPYCK	4052	sp|Q9JHW2|NIT2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	16-UNIMOD:4	ms_run[1]:scan=1.1.3064.19	50.5608	2	1921.830847	1921.840395	K	V	131	148
PSM	IEWLESHQDADIEDFK	4053	sp|P20029|BIP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3029.16	49.56577	3	1973.893271	1973.900687	K	A	603	619
PSM	VLSYAPGPLDNDMQQLAR	4054	sp|Q64105|SPRE_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3197.21	54.30575	2	1986.977447	1986.983311	R	E	194	212
PSM	RLETYYNATEPVISFYDK	4055	sp|Q9R0Y5|KAD1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3087.12	51.21337	3	2208.067271	2208.073900	K	R	149	167
PSM	DAEVVLCGGTESMSQSPYCVR	4056	sp|Q8BWT1|THIM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	7-UNIMOD:4,19-UNIMOD:4	ms_run[1]:scan=1.1.3045.18	50.02368	3	2344.004471	2344.013368	K	N	110	131
PSM	TITSQWKEEDATLSSPAVVMPTMGR	4057	sp|Q9EQ20|MMSA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3170.21	53.55187	3	2734.333571	2734.330602	K	-	511	536
PSM	AFQFVETHGEVCPANWTPESPTIK	4058	sp|P20108|PRDX3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	12-UNIMOD:4	ms_run[1]:scan=1.1.3154.21	53.11234	3	2744.285471	2744.290452	K	P	219	243
PSM	LNCQVIGASVDSHFCHLAWINTPK	4059	sp|P35700|PRDX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	3-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=1.1.3119.14	52.10393	4	2766.334094	2766.337026	K	K	69	93
PSM	LLSHCLLVTLASHHPADFTPAVHASLDK	4060	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	5-UNIMOD:4	ms_run[1]:scan=1.1.3039.8	49.84295	5	3049.586118	3049.580761	K	F	101	129
PSM	FASLDVTHAALVNSLWHFGGNEK	4061	sp|Q9DCY0|KEG1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3442.2	61.13803	4	2512.243694	2512.249908	K	S	169	192
PSM	DLELLIQTATR	4062	sp|Q02819|NUCB1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3497.6	62.68815	2	1271.701447	1271.708516	R	D	152	163
PSM	HGYPLILYDVFPDVCK	4063	sp|Q99L13|3HIDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	15-UNIMOD:4	ms_run[1]:scan=1.1.3546.3	64.07771	3	1934.954471	1934.960057	K	E	60	76
PSM	RIFDFQGLQHQVAQVATQLEATR	4064	sp|Q9DBL1|ACDSB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3616.6	66.05511	4	2655.383294	2655.388133	K	L	325	348
PSM	DAVLQGMFYFR	4065	sp|P97494|GSH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3590.5	65.31207	2	1345.649247	1345.648893	R	K	477	488
PSM	AWNIWADIPAPK	4066	sp|Q9DBF1|AL7A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3517.6	63.24373	2	1380.706847	1380.719021	K	R	98	110
PSM	GTIEILSDVQLIK	4067	sp|P14869|RLA0_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3452.8	61.4224	2	1427.815847	1427.823546	R	T	150	163
PSM	DIVLVAYGVLGTQR	4068	sp|Q91WR5|AK1CL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3628.9	66.40573	2	1502.841647	1502.845679	K	Y	210	224
PSM	LAGFLDLTEQEFR	4069	sp|Q8QZY1|EIF3L_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3540.15	63.91448	2	1537.772247	1537.777659	K	I	475	488
PSM	MFVLDEADEMLSR	4070	sp|P10630|IF4A2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3530.16	63.62718	2	1554.701247	1554.705816	K	G	179	192
PSM	EPVGQGEALLGMDLLR	4071	sp|Q8VCA8|SCRN2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3554.16	64.31631	2	1696.875847	1696.881806	K	L	104	120
PSM	AIFLADGNVFTTGFSR	4072	sp|Q9WUM4|COR1C_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3537.20	63.83158	2	1714.865447	1714.867871	R	M	224	240
PSM	AHCLSEVEHDTMPADLPAIAADFVEDQEVCK	4073	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	3-UNIMOD:4,12-UNIMOD:35,30-UNIMOD:4	ms_run[1]:scan=1.1.3444.14	61.20156	4	3512.567294	3512.553422	K	N	311	342
PSM	TLASLSPETSLFIIASK	4074	sp|P06745|G6PI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3616.18	66.06513	2	1776.984647	1776.987317	K	T	195	212
PSM	ILPYLAAAYALDHFSK	4075	sp|Q9EPL9|ACOX3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3570.4	64.7585	3	1791.949571	1791.955957	R	T	356	372
PSM	EEFQQFAGLLQAGIEK	4076	sp|P47199|QOR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3607.7	65.79622	3	1806.909671	1806.915215	K	G	279	295
PSM	TYYMSAGLQPVPIVFR	4077	sp|Q9D051|ODPB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3532.18	63.68613	2	1840.952647	1840.954577	K	G	130	146
PSM	SLRPGVAIADFVIFPPR	4078	sp|O09173|HGD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3521.4	63.3574	3	1854.036671	1854.051589	K	W	305	322
PSM	IPNIYAIGDVVAGPMLAHK	4079	sp|O08749|DLDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3527.6	63.53243	3	1978.070171	1978.071004	K	A	347	366
PSM	TTVLLADMNDFGTVNEIYK	4080	sp|P52760|RIDA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3589.10	65.28865	3	2143.050371	2143.050722	K	T	79	98
PSM	GLIAAICAGPTALLAHEVGFGCK	4081	sp|Q99LX0|PARK7_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	7-UNIMOD:4,22-UNIMOD:4	ms_run[1]:scan=1.1.3618.17	66.12217	3	2325.193571	2325.197344	K	V	100	123
PSM	ILNKPVPSLPNMDSVFAEAIAK	4082	sp|Q9DBM2|ECHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3478.12	62.1462	3	2353.266371	2353.271554	R	V	196	218
PSM	FAELVYTGFWHSPECEFVR	4083	sp|P16460|ASSY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	15-UNIMOD:4	ms_run[1]:scan=1.1.3467.8	61.83557	3	2373.087371	2373.088839	K	H	317	336
PSM	ASYISSAQLDQPDPGAVAAAAIFR	4084	sp|Q8VC30|TKFC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3604.15	65.71692	3	2418.222971	2418.217939	R	A	544	568
PSM	NFDSLISSNCTEELENAGVEVLK	4085	sp|P47791|GSHR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	10-UNIMOD:4	ms_run[1]:scan=1.1.3642.17	66.81924	3	2567.199671	2567.206114	R	F	247	270
PSM	VAPEEVSEVIFGHVLTAGCGQNPTR	4086	tr|Q80X81|Q80X81_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	19-UNIMOD:4	ms_run[1]:scan=1.1.3473.19	62.00968	3	2666.310671	2666.312250	K	Q	47	72
PSM	DLTQLFGFAR	4087	sp|Q9ET22|DPP2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3756.3	70.0041	2	1166.601447	1166.608408	K	N	264	274
PSM	DSTLIMQLLR	4088	sp|O70456|1433S_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3678.3	67.81609	2	1188.647247	1188.653644	K	D	215	225
PSM	TAFLDLLPLIR	4089	sp|Q9QXD1|ACOX2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3819.5	71.77277	2	1270.758647	1270.764909	R	K	607	618
PSM	ITVVGVGQVGMACAISILGK	4090	sp|P16125|LDHB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	13-UNIMOD:4	ms_run[1]:scan=1.1.3775.2	70.54987	3	1972.081271	1972.084940	K	S	24	44
PSM	LDILDMFTEIK	4091	sp|P46664|PURA2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3846.6	72.52856	2	1336.688247	1336.694840	K	V	363	374
PSM	SVLVDFLIGSGLK	4092	sp|Q9JHU9|INO1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3761.5	70.14938	2	1346.776247	1346.780953	K	T	313	326
PSM	YGINTTDIFQTVDLWEGK	4093	sp|Q9WVA4|TAGL2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3799.10	71.22532	3	2099.020571	2099.021136	R	N	103	121
PSM	AGDTVGEGDLLVELE	4094	sp|Q91ZA3|PCCA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3684.9	67.99207	2	1515.730047	1515.730434	K	-	710	725
PSM	VLLASPDLQEAVEEVLPTLKK	4095	sp|O35488|S27A2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3750.11	69.83836	3	2291.299871	2291.298815	K	D	154	175
PSM	YAHMVDVGQVGVNVPIPVPLPMFSFTGSR	4096	sp|Q9EQ20|MMSA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3814.12	71.63998	4	3113.594894	3113.583069	K	S	460	489
PSM	ADMVIEAVFEDLGVK	4097	sp|Q8BMS1|ECHA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3844.13	72.47755	2	1634.816647	1634.822560	K	H	441	456
PSM	FPITTLCCVPTLFR	4098	sp|Q8BGA8|ACSM5_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	7-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.3667.10	67.51138	2	1723.870847	1723.878970	R	L	311	325
PSM	TMLELLNQLDGFDSR	4099	sp|P62192|PRS4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3795.16	71.11816	2	1750.864447	1750.855985	R	G	308	323
PSM	EQGYDVIAYLANIGQK	4100	sp|P16460|ASSY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3711.18	68.75797	2	1780.913847	1780.899565	K	E	26	42
PSM	NSDQFVTSVLDGVVLPK	4101	sp|Q91WU0|CES1F_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3702.14	68.50418	2	1816.948847	1816.957080	K	D	313	330
PSM	ENDAVTIQVLNQLIQK	4102	sp|Q9EQH3|VPS35_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3655.13	67.18913	2	1824.992647	1824.994528	K	I	734	750
PSM	VFTLNLSAPFISQFFK	4103	sp|P55264|ADK_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3872.11	73.26669	2	1857.995847	1858.002908	R	E	208	224
PSM	LGACLAFLPEAFDFIAR	4104	sp|Q8VDK1|NIT1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	4-UNIMOD:4	ms_run[1]:scan=1.1.3866.7	73.09748	2	1909.970847	1909.976041	R	N	73	90
PSM	GIVSLSDILQALVLTGGEK	4105	sp|O54950|AAKG1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3933.2	74.88631	3	1912.076471	1912.088094	K	K	310	329
PSM	LLIVSNPVDILTYVAWK	4106	sp|P06151|LDHA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3876.2	73.36514	3	1943.100071	1943.113186	K	I	133	150
PSM	AFMTADLPNELIELLEK	4107	sp|Q68FD5|CLH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	3-UNIMOD:35	ms_run[1]:scan=1.1.3854.8	72.76963	2	1962.007847	1962.001981	K	I	994	1011
PSM	VTYVDFLAYDILDQYR	4108	sp|P10649|GSTM1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3856.3	72.81755	3	1992.972671	1992.983294	K	M	153	169
PSM	VLVLGSGYVSGPVLEYLSR	4109	sp|Q99K67|AASS_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3748.2	69.77431	3	2007.104771	2007.104078	K	D	483	502
PSM	LVQIEYALAAVAGGAPSVGIK	4110	sp|P49722|PSA2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3748.3	69.77515	3	2026.143971	2026.146277	K	A	19	40
PSM	FFPEDVSEELIQEITQR	4111	sp|P26043|RADI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3853.5	72.72988	3	2079.009371	2079.016051	K	L	84	101
PSM	LADPVFIGFCVLQGADCGAK	4112	sp|Q3TW96|UAP1L_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	10-UNIMOD:4,17-UNIMOD:4	ms_run[1]:scan=1.1.3781.5	70.72432	3	2137.026671	2137.033633	R	V	262	282
PSM	IAIAALEVLEEENLAENADK	4113	sp|P29758|OAT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3661.3	67.34016	3	2154.099971	2154.105594	R	M	332	352
PSM	IKVGDPAEDFGTFFSAVIDAK	4114	sp|Q8CHT0|AL4A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3782.5	70.7515	3	2226.120971	2226.120851	R	A	374	395
PSM	CAFMGSLAPGHVADFLVADFR	4115	sp|P97328|KHK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:4	ms_run[1]:scan=1.1.3718.8	68.94801	3	2280.084071	2280.081980	R	Q	57	78
PSM	AEGSDVANAVLDGADCIMLSGETAK	4116	sp|P52480|KPYM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	16-UNIMOD:4	ms_run[1]:scan=1.1.3671.19	67.62759	3	2493.123071	2493.136319	R	G	343	368
PSM	YCTFNDDIQGTASVAVAGLLAALR	4117	sp|P06801|MAOX_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	2-UNIMOD:4	ms_run[1]:scan=1.1.3908.5	74.24641	3	2525.262971	2525.258424	K	I	263	287
PSM	LCYVALDFEQEMATAASSSSLEK	4118	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	2-UNIMOD:4	ms_run[1]:scan=1.1.3749.14	69.81248	3	2549.176571	2549.166557	K	S	216	239
PSM	GQDLGDTTTLEDPSVITEILSAFQK	4119	sp|Q99NB1|ACS2L_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3937.4	75.00743	3	2677.336871	2677.333422	R	Y	649	674
PSM	DGILSDEIYCPPETAVLLGSYAVQAK	4120	sp|P26040|EZRI_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	10-UNIMOD:4	ms_run[1]:scan=1.1.3823.20	71.89668	3	2808.390971	2808.389163	K	F	108	134
PSM	IPENVSLQDAAVLPVSYGTAILAVDHR	4121	sp|Q3UNZ8|QORL2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3719.20	68.98538	3	2847.515171	2847.513058	R	A	132	159
PSM	DLGEELEALKTELEDTLDSTAAQQELR	4122	sp|Q8VDD5|MYH9_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3918.5	74.53429	3	3016.484171	3016.472435	R	S	1136	1163
PSM	PVTTPEEIAQVATISANGDK	4123	sp|P63038|CH60_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3132.13	52.47188	3	2040.031571	2040.037515	K	D	161	181
PSM	VAMSHFEPSEYIR	4124	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2665.10	39.3656	3	1566.729671	1564.734414	K	Y	32	45
PSM	SDDIINSSGYR	4125	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2328.20	30.04872	2	1226.560447	1225.557495	R	I	463	474
PSM	LDQLIYIPLPDEK	4126	sp|Q01853|TERA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3522.16	63.39643	2	1555.842447	1555.849761	R	S	639	652
PSM	GPREEIVYLPCIYR	4127	sp|P17563|SBP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	11-UNIMOD:4	ms_run[1]:scan=1.1.2999.5	48.7365	3	1765.922471	1763.902876	K	N	21	35
PSM	VFIMDSCDELIPEYLNFIR	4128	sp|P11499|HS90B_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	7-UNIMOD:4	ms_run[1]:scan=1.1.3855.4	72.7909	3	2373.145271	2373.138492	R	G	360	379
PSM	DDDIAALVVDNGSGMCK	4129	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=1.1.3690.16	68.17447	2	1820.7933	1820.7915	M	A	2	19
PSM	ARPFPDGLAEDIDKGEVSAR	4130	sp|P58252|EF2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	16		ms_run[1]:scan=1.1.2745.6	41.61002	4	2142.0668	2142.0700	K	Q	606	626
PSM	TAVCDIPPR	4131	sp|P68372|TBB4B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	4-UNIMOD:4	ms_run[1]:scan=1.1.2196.16	26.40388	2	1027.503447	1027.512065	K	G	351	360
PSM	AKLDNNTELSFFAK	4132	sp|O88844|IDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2768.8	42.24733	3	1596.799271	1596.814772	R	A	344	358
PSM	EYLISLDPENLTLLEK	4133	sp|Q9DC50|OCTC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3765.20	70.27877	2	1889.002447	1889.003361	R	I	253	269
PSM	CPLPRPWK	4134	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.2843.4	44.3672	2	1035.5231	1035.5319	R	L	290	298
PSM	VPLVAMHHAYVVTER	4135	sp|Q99LB7|SARDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2360.15	30.9158	3	1720.908371	1720.908296	K	I	287	302
PSM	GAAAVFNMSYFGK	4136	sp|Q99LB7|SARDH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3166.14	53.4353	2	1361.639447	1361.643808	R	F	567	580
PSM	GITFDSGGISIK	4137	sp|Q9CPY7|AMPL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3004.7	48.87988	2	1193.621247	1193.629203	K	A	283	295
PSM	VITAFNDGLNHLDSLK	4138	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2965.6	47.80033	3	1755.923771	1755.915549	K	G	68	84
PSM	QIDDVLSVASVRPAVLQVECHPYLAQNELIAHCHAR	4139	sp|Q9JII6|AK1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:28,20-UNIMOD:4,33-UNIMOD:4	ms_run[1]:scan=1.1.3438.8	61.03878	5	4091.0572	4091.0462	R	G	168	204
PSM	QGAALGIPYFTACR	4140	sp|P47199|QOR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	13-UNIMOD:4	ms_run[1]:scan=1.1.3191.18	54.13158	2	1523.751847	1523.755484	R	A	125	139
PSM	QGAALGIPYFTACR	4141	sp|P47199|QOR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:28,13-UNIMOD:4	ms_run[1]:scan=1.1.3725.4	69.13748	2	1506.7243	1506.7284	R	A	125	139
PSM	IQDTIEITGTFK	4142	sp|O35488|S27A2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2872.17	45.20602	2	1364.709847	1364.718747	R	H	561	573
PSM	IQDTIEITGTFK	4143	sp|O35488|S27A2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2885.14	45.56483	2	1364.709847	1364.718747	R	H	561	573
PSM	EEIFGPVMQILK	4144	sp|P47738|ALDH2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3644.7	66.86584	2	1402.747447	1402.753024	K	F	417	429
PSM	CSDFTEEICR	4145	sp|Q9D6R2|IDH3A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:385,1-UNIMOD:4,9-UNIMOD:4	ms_run[1]:scan=1.1.3096.8	51.46217	2	1298.4851	1298.4902	K	R	351	361
PSM	DHADVSNQLYACYAIGK	4146	sp|P62814|VATB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	12-UNIMOD:4	ms_run[1]:scan=1.1.2783.17	42.67798	3	1924.878671	1923.878512	K	D	414	431
PSM	RIPQSTLSEFYPR	4147	sp|P62814|VATB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2717.9	40.82932	3	1592.822471	1592.831091	K	D	494	507
PSM	MGISVLEALGDGEFIK	4148	sp|Q9Z2V4|PCKGC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:35	ms_run[1]:scan=1.1.3686.7	68.05766	2	1694.858247	1693.859674	R	C	176	192
PSM	CLHSVGCPLPLK	4149	sp|Q9Z2V4|PCKGC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:385,1-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=1.1.2989.9	48.46608	2	1362.6683	1362.6783	K	K	192	204
PSM	CFYNSDGDFLIVPQK	4150	sp|O09173|HGD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.3828.12	72.02963	2	1784.8053	1784.8074	R	G	146	161
PSM	KPFDPENTEEAEFHVDESTTVK	4151	sp|P07758|A1AT1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2619.18	38.09103	4	2548.151294	2548.160543	K	V	214	236
PSM	YDDMAACMK	4152	sp|P63101|1433Z_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	7-UNIMOD:4	ms_run[1]:scan=1.1.2177.20	25.87193	2	1104.402047	1103.408588	R	S	19	28
PSM	CLGELICTLNAANVPAGTEVVCAPPTAYIDFAR	4153	sp|P17751|TPIS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:385,1-UNIMOD:4,7-UNIMOD:4,22-UNIMOD:4	ms_run[1]:scan=1.1.4052.2	76.88863	4	3545.7212	3545.6992	K	Q	71	104
PSM	KGESVMVVPTLSEEEAK	4154	sp|O08709|PRDX6_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2638.13	38.61973	3	1832.917271	1831.923731	K	Q	183	200
PSM	MFASFPTTK	4155	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:35	ms_run[1]:scan=1.1.2617.7	38.02923	2	1044.486847	1044.495018	R	T	33	42
PSM	MYSYVTEELPQLINANFPVDPQR	4156	sp|Q9R0P3|ESTD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	16		ms_run[1]:scan=1.1.3787.10	70.89993	3	2723.3195	2723.3260	R	M	120	143
PSM	TIEEYAICPDLK	4157	sp|Q9D0F9|PGM1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	8-UNIMOD:4	ms_run[1]:scan=1.1.2871.16	45.17648	2	1451.697047	1450.701382	K	V	153	165
PSM	VFVTGPLPAEGR	4158	sp|Q91Z53|GRHPR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2693.9	40.14247	2	1241.668447	1241.676822	K	A	9	21
PSM	AGDFGAAFVER	4159	sp|Q8K010|OPLA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2699.11	40.31502	2	1139.548847	1138.540723	R	Y	605	616
PSM	CPDIAIQLAGTK	4160	sp|P51855|GSHB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.3459.4	61.61308	2	1268.6349	1268.6429	K	K	294	306
PSM	RESHSILTPLVSLDTPGK	4161	sp|Q9CPV4|GLOD4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2779.16	42.56285	3	1949.053271	1949.058191	K	A	220	238
PSM	MFVLDEADEMLSR	4162	sp|P10630|IF4A2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3528.12	63.56615	2	1554.701247	1554.705816	K	G	179	192
PSM	VIVLTAAAQGIGR	4163	sp|Q8JZV9|BDH2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2830.16	44.01073	2	1267.750047	1267.761221	K	A	8	21
PSM	IPLSQEEIPLQGHAFEAR	4164	sp|Q99MR8|MCCA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2893.14	45.78857	3	2035.043171	2034.053440	K	I	364	382
PSM	YLSPVSAEGAQGGTIAPMTGTIEK	4165	sp|Q99MR8|MCCA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3032.20	49.65285	3	2377.184171	2377.183527	K	V	632	656
PSM	VNIDGGAIALGHPLGASGCR	4166	sp|Q8CAY6|THIC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	16	19-UNIMOD:4	ms_run[1]:scan=1.1.2777.15	42.50563	3	1933.9699	1933.9787	K	I	342	362
PSM	APSWIDTGLSEMR	4167	sp|P23927|CRYAB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3200.13	54.38538	2	1461.690247	1461.692214	R	L	57	70
PSM	LTAFEEAIPK	4168	sp|Q9Z2W0|DNPEP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2762.11	42.08237	2	1117.594847	1117.601926	R	S	328	338
PSM	TDAAVSFAK	4169	sp|P51881|ADT2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1	ms_run[1]:scan=1.1.2718.4	40.85378	2	950.4611	950.4704	M	D	2	11
PSM	GLCAIAQAESLR	4170	sp|P62908|RS3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	3-UNIMOD:4	ms_run[1]:scan=1.1.2728.8	41.14207	2	1288.651047	1287.660521	R	Y	95	107
PSM	GFCFITFKEEEPVK	4171	sp|Q60668|HNRPD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	3-UNIMOD:4	ms_run[1]:scan=1.1.2994.5	48.59532	3	1730.829671	1729.838545	R	K	224	238
PSM	VFVTSGLGGMSGAQAK	4172	sp|Q8VC12|HUTU_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2671.18	39.5397	2	1507.764847	1508.765714	K	A	243	259
PSM	SLDFLSSPSVK	4173	sp|Q9DCJ9|NPL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2905.10	46.1226	2	1178.607247	1178.618304	K	E	302	313
PSM	ESVNAAFEMTLTEGNKLEK	4174	sp|Q8BH95|ECHM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3008.10	48.99343	3	2112.038171	2110.025236	K	R	242	261
PSM	AFAFVTFADDK	4175	sp|Q921F2|TADBP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3197.10	54.29659	2	1229.598647	1230.592090	R	V	228	239
PSM	AAGTLYTYPENWR	4176	sp|Q9D8N0|EF1G_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1	ms_run[1]:scan=1.1.3437.3	61.00702	2	1582.7497	1582.7411	M	A	2	15
PSM	CSGIASAAATAVEVAR	4177	sp|Q91X91|NADC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.3468.9	61.86378	2	1515.7277	1515.7346	R	S	111	127
PSM	SLLCLADFK	4178	sp|Q9NYQ2|HAOX2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1,4-UNIMOD:4	ms_run[1]:scan=1.1.3818.2	71.74236	2	1107.5575	1107.5629	M	A	2	11
PSM	CGNQAAIMELDDTLK	4179	sp|P62715|PP2AB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.3585.13	65.18367	2	1661.7662	1660.7432	R	Y	269	284
PSM	VFQPMFNHSIFTSAVSPAAER	4180	sp|O88343-2|S4A4-2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	16		ms_run[1]:scan=1.1.3182.16	53.88197	3	2335.1182	2335.1412	R	I	27	48
PSM	RPPSAFFLFCSEYRPK	4181	sp|P63158|HMGB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	16	10-UNIMOD:4	ms_run[1]:scan=1.1.2927.14	46.74753	3	2002.9992	2000.9922	K	I	97	113
PSM	DIICQIAYAR	4182	sp|P47962|RL5_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	4-UNIMOD:4	ms_run[1]:scan=1.1.2965.9	47.80283	2	1222.614647	1221.617593	R	I	59	69
PSM	ADDLDFETGDAGASATFPMQCSALR	4183	sp|P63242|IF5A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1,21-UNIMOD:4	ms_run[1]:scan=1.1.3771.15	70.4477	3	2687.1412	2687.1474	M	K	2	27
PSM	VVVVVPNEEDWK	4184	sp|Q00PI9|HNRL2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	16		ms_run[1]:scan=1.1.2913.16	46.35247	2	1412.7572	1411.7342	K	R	557	569
PSM	YAVLYQPLFDK	4185	sp|P28656|NP1L1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3191.11	54.12573	2	1355.711247	1355.712539	K	R	106	117
PSM	SHTILLVQPTK	4186	sp|P84089|ERH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1	ms_run[1]:scan=1.1.2699.15	40.31835	2	1277.7259	1277.7338	M	R	2	13
PSM	AGKPVLHYFDGR	4187	sp|P30115|GSTA3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1	ms_run[1]:scan=1.1.2609.2	37.8079	3	1400.7179	1400.7196	M	G	2	14
PSM	LTPLSHEVISR	4188	sp|Q9Z0N1|IF2G_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2223.9	27.1382	3	1251.700871	1250.698286	K	Q	28	39
PSM	EKIEAEK	4189	sp|P54726|RD23A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1575.11	9.126083	2	845.448247	845.449448	K	G	30	37
PSM	IGGHGAEYGAEALER	4190	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2211.12	26.80953	3	1528.718771	1528.727020	K	M	18	33
PSM	PVTFVDGR	4191	sp|Q64462|CP4B1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2213.10	26.86215	2	888.464047	889.465767	K	S	390	398
PSM	SVDEIIR	4192	sp|P35700|PRDX1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2223.8	27.13735	2	829.446247	830.449782	R	L	152	159
PSM	IIYGGSVTGATCK	4193	sp|P17751|TPIS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	12-UNIMOD:4	ms_run[1]:scan=1.1.2273.20	28.52232	2	1325.656047	1325.664937	R	E	257	270
PSM	QNVFACVR	4194	sp|Q922D8|C1TC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	6-UNIMOD:4	ms_run[1]:scan=1.1.2295.9	29.11782	2	993.483447	992.486185	R	Q	403	411
PSM	IFAQLDR	4195	sp|Q99KP3|CRYL1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2361.7	30.93615	2	862.476247	861.470852	K	I	105	112
PSM	GPLNWYR	4196	sp|P34914|HYES_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2622.3	38.16155	2	905.458247	904.455536	R	N	460	467
PSM	SLLVTELGSSR	4197	sp|O55023|IMPA1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2746.9	41.63977	2	1159.643447	1160.640102	K	K	157	168
PSM	MNVLADALK	4198	sp|P62245|RS15A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2776.4	42.46855	2	974.521247	973.526653	R	S	4	13
PSM	MEKLLSTPK	4199	sp|Q30KP5|DFB18_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2849.7	44.5381	2	1045.581847	1045.584167	R	Y	74	83
PSM	GSLLIDSSTIDPSVSK	4200	sp|Q99L13|3HIDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2993.18	48.57857	2	1616.829447	1617.846132	K	E	125	141
PSM	AEGIVFNTQSTIKL	4201	sp|Q99K67|AASS_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3160.11	53.27037	2	1520.813047	1519.824609	K	-	913	927
PSM	SAIDLEEMASGLNK	4202	tr|E9PXC0|E9PXC0_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3162.11	53.32315	2	1477.703247	1476.713009	K	R	58	72
PSM	HHPEDVEPALRK	4203	sp|Q9JII6|AK1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1760.6	14.24807	4	1426.724094	1426.731711	K	T	86	98
PSM	HIYIDK	4204	sp|Q9WUM5|SUCA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1756.10	14.13815	2	787.415047	787.422839	K	N	49	55
PSM	SSDFTDR	4205	sp|Q02013|AQP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1755.13	14.11247	2	826.338447	826.345711	R	M	235	242
PSM	SGVEAMNK	4206	sp|Q9CQ62|DECR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1702.14	12.65513	2	834.382447	834.390553	K	S	215	223
PSM	LKEEISK	4207	sp|P38647|GRP75_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1671.16	11.78923	2	845.477847	845.485834	K	M	611	618
PSM	EECPAVR	4208	sp|P09103|PDIA1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	3-UNIMOD:4	ms_run[1]:scan=1.1.1720.13	13.14328	2	859.377247	859.385802	K	L	312	319
PSM	QIEEARK	4209	tr|E9Q6L7|E9Q6L7_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1573.17	9.075316	2	872.464647	872.471580	K	I	212	219
PSM	ETIEQEK	4210	tr|A2AEH9|A2AEH9_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1666.15	11.65178	2	875.415647	875.423627	K	E	67	74
PSM	RDQALTEEHAR	4211	sp|Q7TPR4|ACTN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1640.12	10.9267	3	1324.635371	1324.648376	R	Q	614	625
PSM	YDSTHYK	4212	sp|Q9JII6|AK1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1637.17	10.84907	2	912.388847	912.397747	R	E	135	142
PSM	YVSHGATGK	4213	sp|P16460|ASSY_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1570.15	8.991567	2	918.449047	918.455930	K	G	113	122
PSM	LQTCCDK	4214	sp|P07724|ALBU_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	4-UNIMOD:4,5-UNIMOD:4	ms_run[1]:scan=1.1.1615.17	10.24508	2	923.375647	923.384088	K	P	299	306
PSM	CQYVTEK	4215	sp|P05063|ALDOC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	1-UNIMOD:4	ms_run[1]:scan=1.1.1747.12	13.88713	2	926.416847	926.416768	R	V	202	209
PSM	HGVYNPNK	4216	sp|P08249|MDHM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1626.18	10.55302	2	927.447847	927.456265	K	I	158	166
PSM	ADHGEPIGR	4217	sp|P11499|HS90B_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1654.18	11.32205	2	950.458047	950.456993	R	G	169	178
PSM	TSATDLQTK	4218	sp|Q9Z0S1|BPNT1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1759.17	14.22913	2	963.478047	963.487290	K	A	41	50
PSM	GYELAHQR	4219	sp|Q60928|GGT1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1752.20	14.03383	2	972.475047	972.477728	R	H	139	147
PSM	HEFQAETK	4220	sp|Q9CQN1|TRAP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1655.16	11.34795	2	988.452247	988.461410	K	K	90	98
PSM	TPVSEHVTK	4221	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1677.17	11.95653	2	996.515847	996.524010	K	C	491	500
PSM	DPAAAPATGNK	4222	tr|E9Q7L0|E9Q7L0_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1689.18	12.29567	2	1011.501047	1011.498523	R	N	994	1005
PSM	EDAANNYAR	4223	sp|P05213|TBA1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1729.20	13.39552	2	1022.434447	1022.441737	K	G	97	106
PSM	KLMSEHGVR	4224	sp|Q9Z2I8|SUCB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1659.18	11.45958	2	1055.545847	1055.554599	K	V	48	57
PSM	HEANNLQLK	4225	sp|Q60864|STIP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1763.21	14.34435	2	1065.548647	1065.556707	K	E	101	110
PSM	VQEAVEENR	4226	sp|Q64516|GLPK_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1730.19	13.42237	2	1072.506447	1072.514902	K	A	164	173
PSM	ETHQQVVSR	4227	sp|P70441|NHRF1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1609.19	10.08143	2	1082.536647	1082.546871	K	I	70	79
PSM	TDGCHAYLSK	4228	sp|P40124|CAP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	4-UNIMOD:4	ms_run[1]:scan=1.1.1756.21	14.14733	2	1150.496847	1150.507708	K	N	412	422
PSM	ASVEDADTQNK	4229	sp|Q99KJ8|DCTN2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1686.21	12.21343	2	1176.514447	1176.525861	K	V	299	310
PSM	NPEAYSHSER	4230	sp|Q3TNA1|XYLB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1645.21	11.07303	2	1188.505047	1188.515964	K	I	198	208
PSM	KVQEAVEENR	4231	sp|Q64516|GLPK_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1661.21	11.51792	2	1200.599447	1200.609865	K	A	163	173
PSM	TAEEEDEADPK	4232	sp|Q9D0J8|PTMS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1695.20	12.46702	2	1232.492847	1232.504456	R	R	81	92
PSM	NCSETQYESK	4233	sp|P61982|1433G_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	2-UNIMOD:4	ms_run[1]:scan=1.1.1695.21	12.46785	2	1244.485647	1244.497931	K	V	111	121
PSM	IHMGNCAENTAK	4234	sp|Q8QZT1|THIL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	6-UNIMOD:4	ms_run[1]:scan=1.1.1727.21	13.34162	2	1344.583247	1344.591455	K	K	188	200
PSM	SCCSCCPVGCSK	4235	sp|P02802|MT1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	2-UNIMOD:4,3-UNIMOD:4,5-UNIMOD:4,6-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.1757.20	14.17485	2	1460.486647	1460.497497	K	C	32	44
PSM	EGTGSTATSSGSAGGAVGK	4236	sp|Q91WK2|EIF3H_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1739.21	13.67642	2	1580.715847	1580.727808	K	G	6	25
PSM	LCDVLAQAGHR	4237	sp|Q8R086|SUOX_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	2-UNIMOD:4	ms_run[1]:scan=1.1.2185.8	26.08618	3	1238.613071	1238.618990	R	L	299	310
PSM	FLPSELRDEH	4238	sp|P26039|TLN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2317.10	29.73147	3	1241.593871	1241.604051	K	-	2532	2542
PSM	AFNADFR	4239	sp|Q9JHI5|IVD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2281.6	28.73375	2	839.384847	839.392602	R	-	418	425
PSM	AFNADFR	4240	sp|Q9JHI5|IVD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2288.3	28.9197	2	839.384847	839.392602	R	-	418	425
PSM	TEWLDGK	4241	sp|P17742|PPIA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2243.4	27.67975	2	847.401247	847.407583	K	H	119	126
PSM	EEGIEFK	4242	sp|O08749|DLDH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15		ms_run[1]:scan=1.1.2208.6	26.726	2	850.3995	850.4067	K	I	411	418
PSM	SLAAEWGR	4243	sp|Q9CQ62|DECR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2353.3	30.71935	2	888.439647	888.445366	K	Y	223	231
PSM	GMPGFSTSK	4244	sp|Q9JHI5|IVD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2175.8	25.80703	2	910.414647	910.421853	K	K	231	240
PSM	FSGIVYSR	4245	sp|Q9D2R0|AACS_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2367.11	31.10467	2	927.473047	927.481417	K	M	68	76
PSM	EATQLWGK	4246	sp|Q920A5|RISC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2252.10	27.93543	2	931.472047	931.476331	K	A	248	256
PSM	VAIEPGVPR	4247	sp|Q64442|DHSO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2291.8	29.0056	2	936.530447	936.539266	R	E	92	101
PSM	VAIEPGVPR	4248	sp|Q64442|DHSO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2293.8	29.06087	2	936.530447	936.539266	R	E	92	101
PSM	VAIEPGVPR	4249	sp|Q64442|DHSO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2279.9	28.68157	2	936.530447	936.539266	R	E	92	101
PSM	HELIEFR	4250	sp|Q68FD5|CLH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2299.11	29.23327	2	942.483647	942.492316	K	R	1502	1509
PSM	GLTSVINQK	4251	sp|P16125|LDHB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2214.15	26.89372	2	958.537647	958.544745	R	L	300	309
PSM	RIYLELR	4252	sp|O35381|AN32A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2333.3	30.17553	2	961.561647	961.570901	K	N	6	13
PSM	KPPPDGPYVEVVR	4253	sp|P24472|GSTA4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2275.10	28.5703	3	1451.768171	1451.777265	R	T	205	218
PSM	KPPPDGPYVEVVR	4254	sp|P24472|GSTA4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2269.10	28.40203	3	1451.768171	1451.777265	R	T	205	218
PSM	VSVMSYSAK	4255	sp|P10518|HEM2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2185.11	26.08868	2	970.470447	970.479368	R	F	191	200
PSM	VALLSGGGSGHEPAHAGFIGK	4256	sp|Q8VC30|TKFC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2367.15	31.108	4	1960.998094	1961.011909	R	G	49	70
PSM	VDGALCLDK	4257	sp|Q91X72|HEMO_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	6-UNIMOD:4	ms_run[1]:scan=1.1.2265.12	28.2933	2	989.477247	989.485182	K	S	401	410
PSM	LTDCVVMRDPASK	4258	sp|O88569|ROA2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	4-UNIMOD:4	ms_run[1]:scan=1.1.2217.10	26.97263	3	1490.709971	1490.722135	K	R	47	60
PSM	ASANMDLMR	4259	sp|Q9CPY7|AMPL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2253.12	27.96425	2	1007.445647	1007.452836	K	A	295	304
PSM	GGNFGFGDSR	4260	sp|O88569|ROA2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2287.8	28.89683	2	1012.430247	1012.436258	R	G	204	214
PSM	GTGIVSAPVPK	4261	sp|P25444|RS2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2274.13	28.54463	2	1024.581847	1024.591696	R	K	201	212
PSM	AIGAFAAADSFDHKK	4262	sp|P32848|PRVA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2344.11	30.47672	3	1547.767571	1547.773242	K	F	15	30
PSM	LQELESYR	4263	sp|Q8JZV9|BDH2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2238.13	27.54977	2	1036.508647	1036.518925	K	G	43	51
PSM	LPHSLAMIR	4264	sp|Q9DBM2|ECHP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2347.2	30.55265	3	1036.575671	1036.585170	R	L	7	16
PSM	KPLIVFTPK	4265	tr|E9Q7L0|E9Q7L0_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2363.11	30.99393	2	1041.648847	1041.658653	R	S	857	866
PSM	KLDPGSEETQTLVR	4266	sp|Q9D8N0|EF1G_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2244.15	27.71677	3	1571.807771	1571.815501	R	E	401	415
PSM	LRVDPVNFK	4267	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2361.12	30.94032	2	1086.611247	1086.618579	K	L	92	101
PSM	LVIVGDGACGK	4268	sp|Q62159|RHOC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	9-UNIMOD:4	ms_run[1]:scan=1.1.2295.13	29.12115	2	1087.560447	1087.569580	K	T	8	19
PSM	GSDFDCELR	4269	sp|P61979|HNRPK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	6-UNIMOD:4	ms_run[1]:scan=1.1.2302.12	29.3194	2	1097.436447	1097.444774	K	L	140	149
PSM	IGFTGSTEVGK	4270	sp|Q8R0Y6|AL1L1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2302.11	29.31857	2	1094.551447	1094.560789	K	H	646	657
PSM	TPVSEDMLGR	4271	sp|P62814|VATB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2380.14	31.46703	2	1103.521047	1103.528109	R	V	121	131
PSM	IAGPGLSSCVR	4272	sp|Q80X90|FLNB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	9-UNIMOD:4	ms_run[1]:scan=1.1.2249.13	27.85538	2	1115.566847	1115.575728	K	A	1426	1437
PSM	LHVDPENFR	4273	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2275.4	28.5653	3	1125.547571	1125.556707	K	L	97	106
PSM	EAIEGTYIDK	4274	sp|P62281|RS11_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2297.14	29.17885	2	1137.548647	1137.555370	K	K	49	59
PSM	VLGDVIEVHGK	4275	sp|P23927|CRYAB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2322.5	29.86743	3	1164.638771	1164.650273	K	H	93	104
PSM	EITALAPSTMK	4276	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	10-UNIMOD:35	ms_run[1]:scan=1.1.2243.18	27.69143	2	1176.597047	1176.606025	K	I	316	327
PSM	RLPEAIEEVK	4277	sp|Q91Z53|GRHPR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2251.18	27.91473	2	1182.653847	1182.660838	R	N	125	135
PSM	AEAEAWYQTK	4278	sp|Q9DCV7|K2C7_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2293.16	29.06753	2	1195.557647	1195.550953	R	F	271	281
PSM	ATISNDGATILK	4279	sp|P80313|TCPH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2366.16	31.0811	2	1202.641047	1202.650667	K	L	56	68
PSM	DMYVNTIGHR	4280	sp|P42125|ECI1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2222.19	27.11907	2	1204.557447	1204.565892	K	E	178	188
PSM	VLEDNSVPQVK	4281	sp|Q9D051|ODPB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2278.16	28.65947	2	1226.641047	1226.650667	K	D	337	348
PSM	SLNPELGTDADK	4282	sp|P06151|LDHA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2239.17	27.5805	2	1258.596447	1258.604111	K	E	213	225
PSM	ALDGDFTEENR	4283	sp|P26039|TLN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2317.20	29.73982	2	1265.547647	1265.552410	K	A	1545	1556
PSM	AAQTSVAYGCIK	4284	sp|Q9D0I9|SYRC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	10-UNIMOD:4	ms_run[1]:scan=1.1.2193.20	26.3226	2	1267.613847	1267.623072	K	Y	493	505
PSM	NVNGVNYASVTR	4285	sp|Q9WUU7|CATZ_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2249.18	27.85955	2	1292.642047	1292.647313	R	N	72	84
PSM	EGMNIVEAMER	4286	sp|P17742|PPIA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	9-UNIMOD:35	ms_run[1]:scan=1.1.2378.20	31.41532	2	1293.560847	1293.569322	K	F	134	145
PSM	YHSLAPMYYR	4287	sp|P35278|RAB5C_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2351.7	30.66688	3	1299.596471	1299.607028	R	G	83	93
PSM	LHGSGDLEAWEK	4288	sp|Q9CPY7|AMPL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2311.10	29.56355	3	1340.628371	1340.636080	K	G	177	189
PSM	INVYYNEAAGNK	4289	sp|Q7TMM9|TBB2A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2289.19	28.96012	2	1354.644847	1354.651730	R	Y	47	59
PSM	GGGGNFGPGPGSNFR	4290	sp|O88569|ROA2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2329.20	30.07708	2	1376.612247	1376.622161	R	G	214	229
PSM	VVAGVAAALAHKYH	4291	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2328.13	30.04288	3	1405.773071	1405.783019	K	-	134	148
PSM	GVAINMVTEEDKR	4292	sp|P60843|IF4A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2299.13	29.23493	3	1460.722271	1460.729328	K	T	370	383
PSM	AGALQCSPSDVYTK	4293	sp|P26039|TLN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	6-UNIMOD:4	ms_run[1]:scan=1.1.2300.21	29.2701	2	1495.695047	1495.697694	K	K	1934	1948
PSM	HSSLAGCQIINYR	4294	sp|Q68FD5|CLH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	7-UNIMOD:4	ms_run[1]:scan=1.1.2347.14	30.56267	3	1517.727971	1517.740896	R	T	145	158
PSM	IQHILCTGNLCTK	4295	sp|Q9QZ88|VPS29_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	6-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=1.1.2280.13	28.71263	3	1556.767871	1556.780318	K	E	31	44
PSM	NAGLPLSTTSNEACK	4296	sp|A3KMP2|TTC38_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	14-UNIMOD:4	ms_run[1]:scan=1.1.2315.21	29.68443	2	1561.735647	1561.740621	K	L	11	26
PSM	IFRDGEEAGAYDGPR	4297	sp|P27773|PDIA3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2227.14	27.25347	3	1651.744871	1651.759048	K	T	105	120
PSM	EGYLHIGGTTQQAQR	4298	sp|Q91WU0|CES1F_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2191.17	26.26412	3	1657.808171	1657.817232	K	L	522	537
PSM	LEPAPLDSSPAVSTHEGSK	4299	sp|P82343|RENBP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2309.19	29.51593	3	1920.927671	1920.942886	R	-	412	431
PSM	IGADFLGR	4300	sp|P05201|AATC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2631.4	38.41385	2	847.447247	847.455202	R	W	115	123
PSM	AVWLPAVK	4301	sp|Q9DBG3|AP2B1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2783.3	42.66632	2	882.524447	882.532724	K	A	712	720
PSM	YNIMLVR	4302	sp|P42932|TCPQ_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2699.4	40.30919	2	907.489447	907.494958	K	L	308	315
PSM	FVDAYFR	4303	sp|Q99NB1|ACS2L_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2676.4	39.67092	2	916.436847	916.444303	R	A	510	517
PSM	FVDAYFR	4304	sp|Q99NB1|ACS2L_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2670.7	39.50223	2	916.436847	916.444303	R	A	510	517
PSM	FKVDLSPYPTISHINK	4305	sp|Q9WVL0|MAAI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2789.4	42.83873	4	1857.992494	1857.998885	R	E	176	192
PSM	ITAVPTLLK	4306	sp|Q9CQM5|TXD17_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2728.5	41.13707	2	954.603447	954.611368	K	Y	90	99
PSM	HQTLQGVAFPISR	4307	sp|Q91YR1|TWF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2603.9	37.64632	3	1452.774071	1452.783747	K	D	172	185
PSM	CAGLLMTLK	4308	sp|Q91YI0|ARLY_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	1-UNIMOD:4	ms_run[1]:scan=1.1.2789.5	42.83957	2	1005.530847	1005.535109	R	G	307	316
PSM	NFNLPMCK	4309	sp|Q9D0K2|SCOT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	7-UNIMOD:4	ms_run[1]:scan=1.1.2630.7	38.38855	2	1022.459247	1022.467758	R	A	229	237
PSM	KFLPLFDR	4310	sp|Q64433|CH10_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2787.7	42.7842	2	1034.582247	1034.591302	R	V	8	16
PSM	REELITNWEQIR	4311	sp|P16546|SPTN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2780.5	42.58218	3	1585.814771	1585.821255	K	T	336	348
PSM	IVLETSFEK	4312	sp|Q9D939|ST1C2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2599.10	37.53627	2	1064.569247	1064.575377	K	M	224	233
PSM	RMTGSEFDFEEMK	4313	sp|Q61598|GDIB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2648.9	38.90028	3	1605.669071	1605.680329	K	R	423	436
PSM	ARPFPDGLAEDIDKGEVSAR	4314	sp|P58252|EF2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15		ms_run[1]:scan=1.1.2754.6	41.85425	4	2142.0660	2142.0700	K	Q	606	626
PSM	HDVVFLITK	4315	sp|Q68FD5|CLH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2600.8	37.56225	2	1070.603447	1070.612431	K	Y	270	279
PSM	DGTGVVEFVR	4316	sp|Q6PDM2|SRSF1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2739.7	41.44298	2	1077.541047	1077.545474	R	K	155	165
PSM	AVASAAAALVLK	4317	sp|P26039|TLN1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2780.9	42.58552	2	1083.657247	1083.665195	K	A	674	686
PSM	YNILPVADGK	4318	sp|Q61838|PZP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2692.8	40.11374	2	1088.579247	1088.586610	K	A	1348	1358
PSM	LSISGDYNLK	4319	sp|P22599|A1AT2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2606.14	37.73518	2	1108.565847	1108.576440	R	T	309	319
PSM	SSSEIYGLMK	4320	sp|Q64516|GLPK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2606.15	37.73602	2	1113.527847	1113.537611	R	I	235	245
PSM	SSSEIYGLMK	4321	sp|Q64516|GLPK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2599.13	37.53876	2	1113.527847	1113.537611	R	I	235	245
PSM	SADTLWGIQK	4322	sp|P06151|LDHA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2682.6	39.83945	2	1117.569247	1117.576774	K	E	319	329
PSM	DLMQTPNFR	4323	sp|P13707|GPDA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2760.9	42.0247	2	1120.526047	1120.533529	K	I	179	188
PSM	MEIQEIQLK	4324	sp|P58771|TPM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2746.7	41.6381	2	1130.591847	1130.600546	K	E	141	150
PSM	NDIAWNFEK	4325	sp|P11352|GPX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2774.10	42.41795	2	1135.520647	1135.529824	R	F	156	165
PSM	IAMQTLDMGR	4326	sp|Q07417|ACADS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2607.12	37.76197	2	1134.545047	1134.552550	K	I	263	273
PSM	IAMQTLDMGR	4327	sp|Q07417|ACADS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2614.9	37.94847	2	1134.545047	1134.552550	K	I	263	273
PSM	HGYIGEFEIIDDHR	4328	sp|P62245|RS15A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2701.11	40.37233	3	1699.785071	1699.795434	K	A	44	58
PSM	YEWDVAEAR	4329	sp|P58252|EF2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2630.15	38.39522	2	1137.499447	1137.509088	K	K	639	648
PSM	NAQAMADALLK	4330	sp|Q9CZN7|GLYM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2754.7	41.85508	2	1144.586047	1144.591044	R	R	357	368
PSM	KLFPSLLDTK	4331	sp|Q91XE0|GLYAT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2753.6	41.82695	2	1160.670447	1160.680511	K	N	142	152
PSM	ELHINLIPSK	4332	sp|P07901|HS90A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2666.14	39.39651	2	1162.662047	1162.671009	K	Q	75	85
PSM	LDIDSAPITAR	4333	sp|P52480|KPYM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2659.10	39.20267	2	1170.615847	1170.624452	R	N	33	44
PSM	ILEATAHAQAQLGCPVIIHPGR	4334	sp|Q60866|PTER_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	14-UNIMOD:4	ms_run[1]:scan=1.1.2668.13	39.45123	4	2351.249694	2351.253219	K	N	183	205
PSM	EVAQQAVDADVHAVGVSTLAAGHK	4335	sp|P16332|MUTA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2642.12	38.7323	4	2372.203294	2372.208437	R	T	654	678
PSM	LVQAFQFTDK	4336	sp|P35700|PRDX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2777.13	42.50397	2	1195.616647	1195.623724	R	H	159	169
PSM	HQSLGGQYGVQGFPTIK	4337	sp|Q922R8|PDIA6_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2720.11	40.91688	3	1815.912071	1815.926782	K	I	86	103
PSM	ASSTANLIFEDCRIPK	4338	sp|Q07417|ACADS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	12-UNIMOD:4	ms_run[1]:scan=1.1.2755.16	41.89007	3	1820.898371	1820.909084	R	E	235	251
PSM	AAYFGIYDTAK	4339	sp|P51881|ADT2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2791.16	42.90522	2	1218.584247	1218.592090	R	G	189	200
PSM	VFQPLPHENKPLTLSSYQTNK	4340	sp|Q62426|CYTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2593.15	37.37525	4	2440.268094	2440.275060	R	E	69	90
PSM	ELLTTLQEASK	4341	sp|A3KMP2|TTC38_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2695.13	40.20225	2	1231.654847	1231.665983	R	S	347	358
PSM	ENVLIGEGAGFK	4342	sp|P45952|ACADM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2710.12	40.62973	2	1232.632047	1232.640102	K	I	260	272
PSM	FKVDLSPYPTISHINK	4343	sp|Q9WVL0|MAAI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2786.14	42.76132	3	1857.992171	1857.998885	R	E	176	192
PSM	SLAPLTVGVQEK	4344	sp|P06728|APOA4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2628.17	38.34122	2	1240.691647	1240.702703	R	L	222	234
PSM	GVLFYGPPGCGK	4345	sp|Q01853|TERA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	10-UNIMOD:4	ms_run[1]:scan=1.1.2744.13	41.58828	2	1250.608247	1250.611779	K	T	513	525
PSM	ENIIDLSNANR	4346	sp|A2BIM8|MUP18_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2623.18	38.20198	2	1257.621847	1257.631329	R	C	165	176
PSM	VLCLAVAVGHVK	4347	sp|P53026|RL10A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	3-UNIMOD:4	ms_run[1]:scan=1.1.2605.3	37.6976	3	1264.723571	1264.732563	K	M	162	174
PSM	LYSTQFNLQR	4348	sp|P50285|FMO1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2618.19	38.06465	2	1268.645447	1268.651336	K	C	93	103
PSM	MLLADQGQSWK	4349	tr|F6RWR5|F6RWR5_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2654.13	39.07047	2	1275.621647	1275.628158	R	E	20	31
PSM	AINYLISGYQR	4350	sp|Q61838|PZP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2787.12	42.78838	2	1296.672847	1296.682636	K	Q	1016	1027
PSM	NANSLGGGFHCWTCDVR	4351	sp|Q9D964|GATM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	11-UNIMOD:4,14-UNIMOD:4	ms_run[1]:scan=1.1.2650.13	38.95935	3	1949.817671	1949.826099	R	R	397	414
PSM	NPAVLSAASFDGR	4352	sp|Q3UPL0|SC31A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2703.13	40.43145	2	1303.645047	1303.652064	R	I	315	328
PSM	YVDIAIPCNNK	4353	sp|P14206|RSSA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	8-UNIMOD:4	ms_run[1]:scan=1.1.2618.20	38.06548	2	1305.631447	1305.638722	R	G	156	167
PSM	GRDWNVDLIPK	4354	sp|P50396|GDIA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2744.16	41.59078	2	1311.686047	1311.693535	R	F	69	80
PSM	HLGFQSAVEALR	4355	tr|A0A0J9YTU1|A0A0J9YTU1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2702.17	40.40603	2	1326.697847	1326.704434	K	G	198	210
PSM	ELTSICSPIISK	4356	sp|Q61316|HSP74_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	6-UNIMOD:4	ms_run[1]:scan=1.1.2775.17	42.45158	2	1346.698247	1346.711553	K	P	775	787
PSM	VLDASWYSPGTR	4357	sp|P52196|THTR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2784.18	42.7074	2	1350.648447	1350.656815	R	Q	31	43
PSM	VIDPATATSVDLR	4358	sp|P80315|TCPD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2722.17	40.97963	2	1356.712447	1356.724895	K	D	194	207
PSM	KCSNEPVGPSIAALTSEER	4359	sp|Q9DC50|OCTC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	2-UNIMOD:4	ms_run[1]:scan=1.1.2625.18	38.25793	3	2043.980771	2043.989519	K	T	227	246
PSM	KLDLFANVVHVK	4360	tr|Q91VA7|Q91VA7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2713.8	40.71302	3	1381.799171	1381.808171	R	S	134	146
PSM	QLQALSSELAQAR	4361	sp|P26043|RADI_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2697.15	40.26093	2	1413.746847	1413.757592	K	D	527	540
PSM	SQISTESFLHLR	4362	sp|Q8K010|OPLA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2761.4	42.0486	3	1416.723971	1416.736128	R	Y	570	582
PSM	ETTIQGLDGLSER	4363	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2647.19	38.88047	2	1417.698847	1417.704888	K	C	122	135
PSM	PFETLLSQNQGGK	4364	sp|P19157|GSTP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2666.16	39.39818	2	1417.709647	1417.720144	K	A	129	142
PSM	GHIEDCGHWTQIEKPTEVNQILIK	4365	sp|P34914|HYES_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	6-UNIMOD:4	ms_run[1]:scan=1.1.2776.19	42.48107	4	2844.419294	2844.422863	R	W	516	540
PSM	LFIGGLNTETNEK	4366	tr|A0A2I3BRL8|A0A2I3BRL8_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2765.21	42.17445	2	1434.725447	1434.735459	K	A	10	23
PSM	AAFIDNMNQYTR	4367	sp|Q71RI9|KAT3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2754.20	41.86592	2	1442.655447	1442.661249	K	G	89	101
PSM	LHTVYQSVELPETHQMLR	4368	sp|Q07417|ACADS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2669.19	39.48418	3	2180.098271	2180.104823	R	Q	25	43
PSM	SPWSNKYDPPLEDGAMPSAR	4369	sp|P47757|CAPZB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2788.20	42.82362	3	2217.014171	2217.016068	R	L	73	93
PSM	AGGIETIANEYSDR	4370	sp|Q61316|HSP74_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2688.19	40.01275	2	1494.688447	1494.695051	R	C	20	34
PSM	VWCTSLHPELVR	4371	sp|Q91WR5|AK1CL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	3-UNIMOD:4	ms_run[1]:scan=1.1.2652.20	39.0207	2	1495.752247	1495.760569	K	A	85	97
PSM	VGTGEPCCDWVGDEGAGHFVK	4372	sp|Q9DCD0|6PGD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	7-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.2726.17	41.09112	3	2275.957271	2275.962653	K	M	164	185
PSM	TSLDLYANVIHCK	4373	sp|P70404|IDHG1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	12-UNIMOD:4	ms_run[1]:scan=1.1.2776.8	42.47188	3	1532.754071	1532.765714	R	S	137	150
PSM	VDLSPYPTISHINK	4374	sp|Q9WVL0|MAAI_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2663.6	39.30743	3	1582.825271	1582.835508	K	E	178	192
PSM	IYQIYEGTAQIQR	4375	sp|P45952|ACADM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2701.21	40.38068	2	1581.807247	1581.815107	K	L	396	409
PSM	YLLGTSLARPCIAR	4376	sp|P16460|ASSY_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	11-UNIMOD:4	ms_run[1]:scan=1.1.2726.3	41.07943	3	1589.862071	1589.871182	R	R	87	101
PSM	LGVEFDEITADDRK	4377	sp|P04117|FABP4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2725.4	41.05293	3	1606.775771	1606.783866	K	V	67	81
PSM	IEDLSQQAQLAAAEK	4378	sp|P70670|NACAM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2606.21	37.74102	2	1613.816447	1613.826065	K	F	2100	2115
PSM	KVCIVGSGNWGSAIAK	4379	sp|P13707|GPDA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	3-UNIMOD:4	ms_run[1]:scan=1.1.2589.11	37.25997	3	1645.849571	1645.861011	K	I	5	21
PSM	HGGTIPVVPTAEFQDR	4380	sp|P26443|DHE3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2658.6	39.17997	3	1722.867071	1722.868933	K	I	481	497
PSM	ADNFEYSDPVDGSISK	4381	sp|Q9D0F9|PGM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2755.19	41.89257	2	1742.756247	1742.763525	K	N	471	487
PSM	QFSYTHICAGASAFGK	4382	sp|Q99LC5|ETFA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	8-UNIMOD:4	ms_run[1]:scan=1.1.2636.21	38.56938	2	1743.800247	1743.803890	K	N	102	118
PSM	ILDSVGIEADDDRLNK	4383	sp|P99027|RLA2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2618.15	38.06132	3	1771.889171	1771.895208	K	V	26	42
PSM	AIESQCYVIAAAQCGR	4384	sp|Q8VDK1|NIT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	6-UNIMOD:4,14-UNIMOD:4	ms_run[1]:scan=1.1.2706.21	40.52348	2	1795.827447	1795.834539	R	H	242	258
PSM	YLESVKPFANEDEYK	4385	sp|Q9DC50|OCTC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2612.6	37.8945	3	1830.861071	1830.867596	K	K	35	50
PSM	TDDYLDQPCCETINR	4386	sp|Q61598|GDIB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	9-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.2605.21	37.71262	2	1898.770247	1898.777478	R	I	194	209
PSM	QATVGDVNTDRPGLLDLK	4387	sp|P31786|ACBP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2756.16	41.9178	3	1911.002771	1911.006155	K	G	34	52
PSM	SVVLMSHLGRPDGVPMPDK	4388	sp|P09411|PGK1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2700.18	40.34958	3	2034.028571	2034.039052	K	Y	57	76
PSM	RVIISAPSADAPMFVMGVNHEK	4389	tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	16-UNIMOD:35	ms_run[1]:scan=1.1.2739.20	41.45383	3	2384.191271	2384.198072	K	Y	116	138
PSM	MMLVLPR	4390	sp|Q8BGA8|ACSM5_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2852.2	44.61962	2	858.474847	858.481951	R	L	117	124
PSM	ICLDILK	4391	sp|P61089|UBE2N_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	2-UNIMOD:4	ms_run[1]:scan=1.1.2921.3	46.56723	2	873.492047	873.499375	R	D	86	93
PSM	DSAFGLLR	4392	sp|Q921I1|TRFE_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2930.3	46.82418	2	877.457447	877.465767	K	V	316	324
PSM	GLFIIDDK	4393	sp|O08807|PRDX4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2939.2	47.07927	2	919.492847	919.501484	R	G	204	212
PSM	GFTCECPDDFQTVQLR	4394	sp|A2ARV4|LRP2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	4-UNIMOD:4,6-UNIMOD:4	ms_run[1]:scan=1.1.2974.10	48.06237	2	1971.853447	1971.845498	R	D	3490	3506
PSM	FGVVVVGVGR	4395	sp|Q9CY64|BIEA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2799.6	43.12173	2	987.579647	987.586551	K	A	9	19
PSM	LSNIFVIGK	4396	sp|P62702|RS4X_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2919.5	46.51157	2	989.584647	989.590967	R	G	222	231
PSM	DVTLGSVLGR	4397	sp|Q9R0H0|ACOX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2993.4	48.56688	2	1015.558247	1015.566209	K	Y	614	624
PSM	VGLTASLAGPHAILGR	4398	sp|O09164|SODE_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2838.5	44.2297	3	1531.871171	1531.883461	R	S	175	191
PSM	EAFQLFDR	4399	sp|Q60605|MYL6_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2921.8	46.5714	2	1024.490047	1024.497795	K	T	14	22
PSM	WLPELVDR	4400	sp|Q9EQ20|MMSA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2995.4	48.6223	2	1026.543247	1026.549831	K	A	332	340
PSM	YGLAAAVFTK	4401	sp|P47738|ALDH2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2801.6	43.17875	2	1039.563647	1039.570232	K	D	444	454
PSM	YPQLLSGIR	4402	sp|P50247|SAHH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15		ms_run[1]:scan=1.1.2855.9	44.71158	2	1045.5812	1045.5912	K	G	143	152
PSM	FVDVSQVIR	4403	sp|Q60928|GGT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2860.6	44.85242	2	1061.576447	1061.586945	K	N	334	343
PSM	LDAFVEGVVK	4404	sp|Q9Z1G3|VATC1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2807.7	43.34742	2	1075.580847	1075.591361	K	K	61	71
PSM	THILLFLPK	4405	sp|P09103|PDIA1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2870.6	45.13935	2	1080.660047	1080.669552	K	S	257	266
PSM	FANPFPAAVR	4406	sp|Q99MN9|PCCB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2818.7	43.66012	2	1088.568647	1088.576714	K	G	492	502
PSM	FANPFPAAVR	4407	sp|Q99MN9|PCCB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2812.6	43.48707	2	1088.568647	1088.576714	K	G	492	502
PSM	ALYYLQIHPQELR	4408	sp|Q3U1J4|DDB1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1000663, ProteinPilot, ]	15		ms_run[1]:scan=1.1.2907.11	46.1797	3	1642.8666706434901	1642.8831262714598	R	Q	515	528
PSM	EIVPVLVSSR	4409	tr|Q80X81|Q80X81_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2796.8	43.0388	2	1097.635047	1097.644459	K	K	201	211
PSM	GDFWLMGDR	4410	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	6-UNIMOD:35	ms_run[1]:scan=1.1.2817.11	43.63482	2	1111.467047	1111.475680	R	G	440	449
PSM	TSFDEMLPGTHFQR	4411	sp|Q60597|ODO1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2863.7	44.9393	3	1664.753471	1664.761691	R	V	870	884
PSM	QTELLLLGTK	4412	sp|Q9D826|SOX_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2899.6	45.94935	2	1114.648847	1114.659775	R	E	89	99
PSM	AAFQLGSPWR	4413	sp|P47738|ALDH2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2973.5	48.02187	2	1131.574847	1131.582528	R	R	87	97
PSM	ATVLNYMSHCIQIR	4414	sp|Q61838|PZP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	10-UNIMOD:4	ms_run[1]:scan=1.1.2911.5	46.28762	3	1704.834071	1704.843981	K	V	824	838
PSM	VFAELSALCK	4415	sp|Q9DBM2|ECHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	9-UNIMOD:4	ms_run[1]:scan=1.1.2889.10	45.67355	2	1136.580847	1136.589981	K	P	387	397
PSM	SGEHDFGAAFDGDGDRNMILGK	4416	sp|Q9D0F9|PGM1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2809.9	43.4046	4	2308.018494	2308.017859	K	H	278	300
PSM	SNFGYNIPLK	4417	sp|O70435|PSA3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2807.9	43.34908	2	1151.595247	1151.597509	R	H	101	111
PSM	FSPAGPILSIR	4418	sp|P29341|PABP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2998.7	48.70965	2	1156.653447	1156.660444	K	V	31	42
PSM	LAVNMVPFPR	4419	sp|A2AQ07|TBB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	5-UNIMOD:35	ms_run[1]:scan=1.1.2797.10	43.06858	2	1158.612647	1158.621950	K	L	253	263
PSM	SQSSNDTFPTAMHIAAAVEVHK	4420	sp|P97807|FUMH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2839.9	44.261	4	2340.108494	2340.116845	K	V	181	203
PSM	DRPFFPGLVK	4421	sp|Q01768|NDKB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2822.10	43.77713	2	1174.644447	1174.649879	K	Y	57	67
PSM	DRPFFTGLVK	4422	sp|P15532|NDKA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2798.2	43.09007	3	1178.634071	1178.644794	K	Y	57	67
PSM	ALQYAFFAEK	4423	sp|Q9DBM2|ECHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2976.10	48.10792	2	1186.602847	1186.602260	R	S	265	275
PSM	VVNVSSMVSLR	4424	sp|P48758|CBR1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2842.12	44.34633	2	1189.639047	1189.648893	R	A	135	146
PSM	KVEFVLDLPK	4425	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2889.11	45.67439	2	1186.689047	1186.696161	R	T	544	554
PSM	VEGGTPLFTLR	4426	sp|Q9D2G2|ODO2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2928.5	46.7685	2	1188.642247	1188.650273	K	K	135	146
PSM	SVDEVFGEVVK	4427	sp|Q9DBP5|KCY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2913.10	46.34747	2	1206.605847	1206.613219	K	I	180	191
PSM	IINEPTAAAIAYGLDKR	4428	sp|P20029|BIP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2910.12	46.26553	3	1814.981171	1814.989048	R	E	199	216
PSM	HNVMVSTEWAAPNVFK	4429	sp|P17563|SBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2971.5	47.96762	3	1828.884971	1828.893040	R	D	196	212
PSM	HCQEFLGSSEVINWK	4430	sp|Q9DCY0|KEG1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	2-UNIMOD:4	ms_run[1]:scan=1.1.2848.11	44.51318	3	1832.847071	1832.851569	K	Q	84	99
PSM	ADVVESWIGEK	4431	sp|P08032|SPTA1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2909.11	46.23648	2	1231.605247	1231.608468	K	E	1933	1944
PSM	LKGEMMDLQHGSLFLK	4432	sp|P06151|LDHA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2828.14	43.95203	3	1845.939971	1845.948112	K	T	58	74
PSM	TAVLETMTAFR	4433	sp|P10518|HEM2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2949.6	47.35212	2	1238.623647	1238.632909	R	R	298	309
PSM	PLGCNIINVPSDEHGIIPEGLKK	4434	sp|Q9WVM8|AADAT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	4-UNIMOD:4	ms_run[1]:scan=1.1.2962.11	47.71898	4	2499.312894	2499.315545	K	I	151	174
PSM	FLASVSTVLTSK	4435	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2996.10	48.65535	2	1251.701447	1251.707454	K	Y	129	141
PSM	MAEDLILYGTK	4436	sp|Q91YI0|ARLY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2916.12	46.43258	2	1252.632647	1252.637325	R	E	256	267
PSM	GFLTERDDILCPDCGK	4437	sp|O70433|FHL2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	11-UNIMOD:4,14-UNIMOD:4	ms_run[1]:scan=1.1.2852.15	44.63045	3	1894.860371	1894.855334	R	D	262	278
PSM	SVSIQYLEAVR	4438	sp|Q99JW2|ACY1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2920.12	46.54603	2	1263.673647	1263.682302	K	R	116	127
PSM	TCFSMVPALQK	4439	sp|P85094|ISC2A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	2-UNIMOD:4	ms_run[1]:scan=1.1.2862.13	44.9156	2	1280.620847	1280.625715	K	E	83	94
PSM	PMFIVNTNVPR	4440	sp|P34884|MIF_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15		ms_run[1]:scan=1.1.2871.12	45.17313	2	1286.6717	1286.6800	M	A	2	13
PSM	HSLMPMLETLK	4441	sp|Q00623|APOA1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2855.16	44.71743	2	1298.660247	1298.672665	R	T	237	248
PSM	IIVDTYGGWGAHGGGAFSGK	4442	sp|Q3THS6|METK2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2826.16	43.89673	3	1948.934771	1948.943161	K	D	266	286
PSM	ASLPPSSSAEVSAIQCNIR	4443	sp|Q99MZ7|PECR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	16-UNIMOD:4	ms_run[1]:scan=1.1.2826.17	43.89757	3	1985.977871	1985.984040	R	K	64	83
PSM	ASLPPSSSAEVSAIQCNIR	4444	sp|Q99MZ7|PECR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	16-UNIMOD:4	ms_run[1]:scan=1.1.2820.11	43.7206	3	1985.977871	1985.984040	R	K	64	83
PSM	EGIECEVINLR	4445	sp|Q9D051|ODPB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	5-UNIMOD:4	ms_run[1]:scan=1.1.2918.12	46.48902	2	1330.649447	1330.655101	K	T	259	270
PSM	DLMVGDEASELR	4446	sp|P61161|ARP2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2841.12	44.31882	2	1333.614047	1333.618381	K	S	54	66
PSM	TLTIVDTGIGMTK	4447	sp|P07901|HS90A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2994.14	48.60283	2	1348.718647	1348.727203	R	A	88	101
PSM	LVILANNCPALR	4448	sp|P62889|RL30_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	8-UNIMOD:4	ms_run[1]:scan=1.1.2831.16	44.03928	2	1352.748847	1352.759841	K	K	45	57
PSM	ITSGPFEPDLYK	4449	sp|P50580|PA2G4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2851.14	44.60085	2	1365.675047	1365.681633	R	S	333	345
PSM	EQGATVLCGGEVYVPEDPK	4450	sp|Q9JLJ2|AL9A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	8-UNIMOD:4	ms_run[1]:scan=1.1.2904.16	46.09955	3	2046.948071	2046.956822	K	L	348	367
PSM	ACGNFGIPCELR	4451	sp|Q9DCL9|PUR6_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	2-UNIMOD:4,9-UNIMOD:4	ms_run[1]:scan=1.1.2820.14	43.7231	2	1392.620847	1392.627840	K	V	287	299
PSM	GAVDAAVPTNIIAAK	4452	sp|Q8BVE3|VATH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2831.19	44.04178	2	1409.781447	1409.787829	R	A	8	23
PSM	DAGEGLLAVQITDQEGKPQR	4453	sp|Q80X90|FLNB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2875.15	45.2886	3	2124.061571	2124.081111	R	A	1546	1566
PSM	CTHWAEGGQGALALAQAVQR	4454	sp|Q922D8|C1TC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	1-UNIMOD:4	ms_run[1]:scan=1.1.2883.19	45.51345	3	2123.028671	2123.033056	K	A	785	805
PSM	QTTVSNSQQAYQEAFEISK	4455	sp|Q9CQV8|1433B_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2828.18	43.95538	3	2158.013171	2158.017842	K	K	141	160
PSM	KLNCQVIGASVDSHFCHLAWINTPK	4456	sp|P35700|PRDX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	4-UNIMOD:4,16-UNIMOD:4	ms_run[1]:scan=1.1.2941.10	47.14398	4	2894.440494	2894.431989	K	K	68	93
PSM	KLNCQVIGASVDSHFCHLAWINTPK	4457	sp|P35700|PRDX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	4-UNIMOD:4,16-UNIMOD:4	ms_run[1]:scan=1.1.2948.11	47.32925	4	2894.440494	2894.431989	K	K	68	93
PSM	RDPLHEELLGQGCVFQER	4458	sp|Q99LB7|SARDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	13-UNIMOD:4	ms_run[1]:scan=1.1.2800.19	43.16103	3	2182.053071	2182.058936	R	Q	486	504
PSM	LCLNICVGESGDR	4459	sp|Q9CXW4|RL11_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	2-UNIMOD:4,6-UNIMOD:4	ms_run[1]:scan=1.1.2859.16	44.83207	2	1491.676647	1491.680998	K	L	20	33
PSM	SGGMSNELNNIISR	4460	sp|Q91V92|ACLY_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2853.18	44.66158	2	1490.705047	1490.714741	R	T	653	667
PSM	LCLNICVGESGDR	4461	sp|Q9CXW4|RL11_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	2-UNIMOD:4,6-UNIMOD:4	ms_run[1]:scan=1.1.2866.19	45.03525	2	1491.676647	1491.680998	K	L	20	33
PSM	SVEVSDPVPAGDLVK	4462	sp|P21981|TGM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2796.19	43.04799	2	1510.777647	1510.787889	K	A	634	649
PSM	ENEFFIVTQTCK	4463	sp|O08677|KNG1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	11-UNIMOD:4	ms_run[1]:scan=1.1.2971.14	47.97513	2	1514.698047	1514.707530	R	I	115	127
PSM	IIAFVGSPVEDNEK	4464	sp|O35226|PSMD4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2853.19	44.66242	2	1516.767847	1516.777324	R	D	109	123
PSM	SQLSCVVVDDIER	4465	sp|P46460|NSF_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	5-UNIMOD:4	ms_run[1]:scan=1.1.2909.15	46.23982	2	1518.735247	1518.734808	K	L	595	608
PSM	DVVDALQSPLVDKK	4466	sp|O55137|ACOT1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2822.19	43.78465	2	1525.827647	1525.835174	K	S	291	305
PSM	IPEQSVLLLHACAHNPTGVDPRPEQWK	4467	sp|P05202|AATM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	12-UNIMOD:4	ms_run[1]:scan=1.1.2840.18	44.29622	4	3091.562894	3091.566174	K	E	201	228
PSM	VEVECSSLEEAFR	4468	sp|Q91X91|NADC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	5-UNIMOD:4	ms_run[1]:scan=1.1.2920.20	46.5527	2	1553.695447	1553.703173	K	A	198	211
PSM	AENACVPPFTVEVK	4469	sp|Q9D964|GATM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	5-UNIMOD:4	ms_run[1]:scan=1.1.2898.17	45.92982	2	1559.760847	1559.765380	R	A	83	97
PSM	ELLHLGCNVVIASR	4470	sp|Q99MZ7|PECR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	7-UNIMOD:4	ms_run[1]:scan=1.1.2828.19	43.95621	2	1579.843847	1579.850447	R	K	37	51
PSM	DVMICPDTSLEDAK	4471	sp|Q99LX0|PARK7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	5-UNIMOD:4	ms_run[1]:scan=1.1.2872.20	45.20852	2	1592.699447	1592.706210	R	T	49	63
PSM	KPIGLCCIAPVLAAK	4472	sp|Q9D172|GAL3A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	6-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=1.1.2880.21	45.43252	2	1609.893447	1609.904791	K	V	169	184
PSM	YLGAEYMQSVGNMR	4473	sp|Q921I1|TRFE_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2954.18	47.49878	2	1617.720647	1617.727948	K	K	668	682
PSM	QLETIDQLHLEYAK	4474	sp|P57780|ACTN4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2850.11	44.56985	3	1699.868471	1699.878101	K	R	523	537
PSM	EFGASECISPQDFSK	4475	sp|P28474|ADHX_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	7-UNIMOD:4	ms_run[1]:scan=1.1.2861.21	44.8936	2	1700.728447	1700.735202	K	S	234	249
PSM	CELLSDESLAVCSPR	4476	sp|Q8R146|APEH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	1-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.2919.20	46.52408	2	1734.786447	1734.791671	K	L	292	307
PSM	HGLLPSETIAVVEHIK	4477	sp|Q9Z2Y8|PLPHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2877.11	45.34087	3	1741.965071	1741.972670	K	A	154	170
PSM	NQNINLENSLGDVEAR	4478	sp|P05784|K1C18_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2849.20	44.54895	2	1784.858047	1784.865304	K	Y	308	324
PSM	SQNIITDSSSLNAEAIR	4479	sp|Q62261|SPTB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2819.21	43.70033	2	1817.910647	1817.911920	R	Q	1548	1565
PSM	YQVADHWYPADLQAR	4480	sp|Q61133|GSTT2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2811.13	43.46433	3	1831.859171	1831.864182	K	A	78	93
PSM	VVYRPEHISFEELLK	4481	sp|Q9D6Y7|MSRA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2937.4	47.02643	4	1857.989294	1857.998885	R	V	119	134
PSM	LSGSNPYTTVTPQIINSK	4482	sp|P57780|ACTN4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2843.21	44.38138	2	1918.990247	1919.000007	K	W	606	624
PSM	EVNKGDILVVATGQPEMVK	4483	sp|Q922D8|C1TC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2831.15	44.03845	3	2026.068971	2026.076877	K	G	205	224
PSM	EGQVFYYAEDYHQQYLSK	4484	sp|Q9D6Y7|MSRA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2871.17	45.17732	3	2267.011271	2267.017114	R	N	195	213
PSM	QVIHPNQIAVVQEQFTPTPEK	4485	sp|Q8R4N0|CLYBL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2850.18	44.57568	3	2402.249771	2402.259410	K	I	268	289
PSM	PLGCNIINVPSDEHGIIPEGLKK	4486	sp|Q9WVM8|AADAT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	4-UNIMOD:4	ms_run[1]:scan=1.1.2965.20	47.81202	3	2499.309971	2499.315545	K	I	151	174
PSM	FLPLFDR	4487	sp|Q64433|CH10_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3119.3	52.09475	2	906.488647	906.496339	K	V	9	16
PSM	QFSLFLGK	4488	sp|P48774|GSTM5_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3065.2	50.57542	2	938.514647	938.522553	K	F	140	148
PSM	AGIPVFAWK	4489	sp|P50247|SAHH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3149.2	52.95105	2	987.548447	987.554188	K	G	95	104
PSM	LNLDSIIGR	4490	sp|P62137|PP1A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3087.2	51.20502	2	999.577647	999.571295	K	L	7	16
PSM	LFPSLLDTK	4491	sp|Q91XE0|GLYAT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3060.4	50.43242	2	1032.576847	1032.585548	K	N	143	152
PSM	LFPSLLDTK	4492	sp|Q91XE0|GLYAT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3053.3	50.23637	2	1032.576847	1032.585548	K	N	143	152
PSM	GFTIPEAFR	4493	sp|Q9Z1Q5|CLIC1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3050.4	50.1546	2	1036.525247	1036.534181	R	G	196	205
PSM	YLTVAAVFR	4494	sp|P68372|TBB4B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3022.4	49.36515	2	1038.576847	1038.586216	R	G	310	319
PSM	MDELQLFR	4495	sp|Q01853|TERA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3043.6	49.95615	2	1050.516247	1050.516816	K	G	46	54
PSM	GDFWLMGDR	4496	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3160.3	53.26202	2	1095.472647	1095.480765	R	G	440	449
PSM	ELNLPFGGMK	4497	sp|Q8BH00|AL8A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3084.6	51.1227	2	1104.555047	1104.563766	R	S	452	462
PSM	TIFAYFSGSK	4498	sp|Q9CQM5|TXD17_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3021.5	49.33897	2	1119.549847	1119.560061	K	D	26	36
PSM	QGEIFLLPAR	4499	sp|Q78JT3|3HAO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3058.6	50.37707	2	1142.637447	1142.644794	R	V	79	89
PSM	QGEIFLLPAR	4500	sp|Q78JT3|3HAO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3051.5	50.18303	2	1142.637447	1142.644794	R	V	79	89
PSM	TREGNDLYHEMIESGVINLK	4501	sp|P56480|ATPB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3124.6	52.23913	4	2317.127294	2317.137246	R	D	240	260
PSM	APDFVFYAPR	4502	sp|P26040|EZRI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3067.4	50.63467	2	1181.580247	1181.586945	K	L	264	274
PSM	GDFSLCEVLR	4503	sp|Q80W22|THNS2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	6-UNIMOD:4	ms_run[1]:scan=1.1.3152.9	53.04402	2	1194.562447	1194.570309	K	T	298	308
PSM	SYELPDGQVITIGNER	4504	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3075.9	50.86598	3	1789.874771	1789.884643	K	F	239	255
PSM	TLMNLGGLAVAR	4505	sp|Q9WVA4|TAGL2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3067.6	50.63635	2	1214.668647	1214.680527	R	D	128	140
PSM	VFEFGGPEVLK	4506	sp|P47199|QOR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3077.7	50.92143	2	1220.633847	1220.644125	R	L	13	24
PSM	FSVDVFEETR	4507	sp|O09173|HGD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3036.8	49.75682	2	1227.571447	1227.577168	R	G	188	198
PSM	ICDDELILIK	4508	sp|P11983|TCPA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	2-UNIMOD:4	ms_run[1]:scan=1.1.3047.10	50.07438	2	1230.643447	1230.652976	R	N	356	366
PSM	RGWDENVYYTVPLVR	4509	sp|O55125|NIPS1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3080.8	51.00875	3	1865.934671	1865.942433	K	H	254	269
PSM	ELEVLLMCNK	4510	sp|P62911|RL32_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	8-UNIMOD:4	ms_run[1]:scan=1.1.3029.11	49.5616	2	1247.625247	1247.625381	K	S	84	94
PSM	SYQANSLVITAGPWTNR	4511	sp|Q9D826|SOX_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3151.8	53.01417	3	1876.935671	1876.943161	K	L	192	209
PSM	HSMNPFCEIAVEEAVR	4512	sp|Q9DCW4|ETFB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	7-UNIMOD:4	ms_run[1]:scan=1.1.3030.12	49.59018	3	1887.852071	1887.860753	K	L	36	52
PSM	TASAQPVSSVGVLGLGTMGR	4513	sp|Q9DBM2|ECHP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3133.6	52.49435	3	1886.977871	1886.988397	K	G	289	309
PSM	NIPGITLLNVSK	4514	sp|Q9D8E6|RL4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3183.10	53.90457	2	1267.743047	1267.749987	R	L	223	235
PSM	SLFFPDEAINK	4515	sp|P97494|GSH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3102.13	51.63165	2	1279.637247	1279.644853	K	H	172	183
PSM	ALSDALTELGYK	4516	sp|P50431|GLYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3170.6	53.53935	2	1279.656447	1279.665983	R	I	331	343
PSM	AHDGGIYAISWSPDSTHLLSASGDK	4517	sp|O88342|WDR1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3060.10	50.43744	4	2584.221294	2584.219395	K	T	232	257
PSM	AELGFLESCLR	4518	sp|Q9JHK4|PGTA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	9-UNIMOD:4	ms_run[1]:scan=1.1.3154.12	53.10482	2	1293.633447	1293.638722	K	V	91	102
PSM	HLLPLVQCPTLIVHGEKDPLVPR	4519	sp|Q8R164|BPHL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	8-UNIMOD:4	ms_run[1]:scan=1.1.3042.9	49.9299	4	2630.469694	2630.473048	R	F	227	250
PSM	RFEETGQELTELLEEEK	4520	sp|Q9WUL7|ARL3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3181.11	53.85023	3	2078.996771	2079.000795	K	L	99	116
PSM	QAQEYEALLNIK	4521	sp|P05784|K1C18_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3004.14	48.88572	2	1418.733447	1418.740545	R	V	352	364
PSM	PLSIEEIEVAPPK	4522	sp|P28474|ADHX_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3062.15	50.49935	2	1420.770047	1420.781347	K	A	19	32
PSM	PLSIEEIEVAPPK	4523	sp|P28474|ADHX_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3056.15	50.32875	2	1420.770047	1420.781347	K	A	19	32
PSM	FIQDSIFGLCPHMTEDNK	4524	sp|P27773|PDIA3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	10-UNIMOD:4	ms_run[1]:scan=1.1.3164.13	53.37958	3	2150.973671	2150.976512	K	D	235	253
PSM	VNLLSFTGSTQVGK	4525	sp|Q9DBF1|AL7A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3063.17	50.53003	2	1449.773247	1449.782744	R	E	267	281
PSM	APSWIDTGLSEMR	4526	sp|P23927|CRYAB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3194.16	54.2153	2	1461.690247	1461.692214	R	L	57	70
PSM	DGGSTTAGNSSQVSDGAAAVLLAR	4527	sp|Q8VCH0|THIKB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3054.12	50.2712	3	2204.065271	2204.066918	K	R	266	290
PSM	DGQAMLWDLNEGK	4528	sp|P68040|RACK1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3184.14	53.93535	2	1475.660047	1475.671479	K	H	213	226
PSM	SSGPALWWMNGSGK	4529	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3155.12	53.13353	2	1476.688047	1476.681984	R	E	64	78
PSM	LGEYGFQNAILVR	4530	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3171.14	53.57387	2	1478.783847	1478.788164	K	Y	422	435
PSM	EANELQQWITEK	4531	sp|P16546|SPTN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3033.16	49.6778	2	1487.717847	1487.725623	R	E	1099	1111
PSM	VNQAIWLLCTGAR	4532	sp|P97461|RS5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	9-UNIMOD:4	ms_run[1]:scan=1.1.3195.15	54.24335	2	1500.778047	1500.787118	R	E	147	160
PSM	SQNVMAAASIANIVK	4533	sp|P11983|TCPA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3049.18	50.13818	2	1515.798847	1515.807913	R	S	19	34
PSM	NSTLTFVTMSGELK	4534	sp|Q9DCG6|PBLD1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3109.17	51.8287	2	1526.758047	1526.765045	R	A	98	112
PSM	GCALQCAILSPAFK	4535	sp|P48722|HS74L_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	2-UNIMOD:4,6-UNIMOD:4	ms_run[1]:scan=1.1.3094.16	51.41402	2	1534.759847	1534.763606	R	V	375	389
PSM	FNADEFEDMVAEK	4536	sp|Q6ZWV3|RL10_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3175.16	53.6886	2	1543.647247	1543.650075	K	R	176	189
PSM	WSSLACNIALDAVK	4537	sp|P80318|TCPG_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	6-UNIMOD:4	ms_run[1]:scan=1.1.3180.16	53.82698	2	1546.773647	1546.781364	R	T	168	182
PSM	LQIWDTAGQESFR	4538	sp|P53994|RAB2A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3039.19	49.85212	2	1549.745047	1549.752506	K	S	57	70
PSM	YCLVVLNQPLDAR	4539	sp|Q9R0M5|TPK1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	2-UNIMOD:4	ms_run[1]:scan=1.1.3159.15	53.24488	2	1559.804247	1559.812999	K	F	19	32
PSM	VSHLLGINVTDFTR	4540	sp|Q8VDD5|MYH9_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3034.3	49.6953	3	1570.839971	1570.846741	K	G	374	388
PSM	AAAAGALAPGPLPDLAAR	4541	sp|Q3TW96|UAP1L_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3051.20	50.19555	2	1601.881647	1601.888940	R	L	53	71
PSM	SQVTNYLGIEWMR	4542	sp|Q9D964|GATM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	12-UNIMOD:35	ms_run[1]:scan=1.1.3177.16	53.74438	2	1611.764647	1611.771528	R	R	270	283
PSM	TVGIDDLTGEPLIQR	4543	sp|Q9WTP7|KAD3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3189.18	54.07592	2	1625.852647	1625.862451	K	E	147	162
PSM	VINEPTAAALAYGLDK	4544	sp|P38647|GRP75_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3082.19	51.07567	2	1644.864047	1644.872287	R	S	219	235
PSM	SQEQLAAELAEYTAK	4545	sp|P26040|EZRI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3091.19	51.3331	2	1650.802047	1650.810081	K	I	413	428
PSM	FAVELEGEQPISVPPSTNHTVYR	4546	sp|Q8CHT0|AL4A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3005.19	48.91785	3	2569.276871	2569.281267	K	G	175	198
PSM	EGGSIPVTLTFQEATGK	4547	sp|Q9D1A2|CNDP2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3117.20	52.05235	2	1733.877847	1733.883580	R	N	414	431
PSM	LNKDEYEFFTYLDK	4548	sp|P16331|PH4H_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3197.9	54.29575	3	1823.856071	1823.861782	R	R	72	86
PSM	GVGIISEGNETVEDIAAR	4549	sp|Q6PIC6|AT1A3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3031.20	49.62475	2	1828.911247	1828.916671	K	L	620	638
PSM	ESSIYLIGGSIPEEDAGK	4550	sp|Q9JHW2|NIT2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3131.20	52.44953	2	1863.903447	1863.910189	K	L	75	93
PSM	NALPTPSDDPTALMTDPK	4551	sp|P11352|GPX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3016.9	49.2178	2	1882.891447	1882.898244	R	Y	129	147
PSM	TSIDAYDNFDNISLAQR	4552	sp|Q68FD5|CLH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3187.21	54.0234	2	1941.903647	1941.906835	R	L	1482	1499
PSM	IFNNGADLSGITEENAPLK	4553	sp|P07758|A1AT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3078.21	50.96181	2	2001.991447	2002.000735	R	L	329	348
PSM	FTDTDLLDFGQCVDQNHQR	4554	sp|Q9DCJ9|NPL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	12-UNIMOD:4	ms_run[1]:scan=1.1.3163.13	53.35212	3	2308.004771	2308.017859	K	Q	174	193
PSM	LQEVPHEGPMCDLLWSDPDDR	4555	sp|P62715|PP2AB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	11-UNIMOD:4	ms_run[1]:scan=1.1.3201.20	54.41983	3	2508.108071	2508.104960	R	G	186	207
PSM	LLSHCLLVTLASHHPADFTPAVHASLDK	4556	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	5-UNIMOD:4	ms_run[1]:scan=1.1.3026.2	49.47172	6	3049.584741	3049.580761	K	F	101	129
PSM	LLSHCLLVTLASHHPADFTPAVHASLDK	4557	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	5-UNIMOD:4	ms_run[1]:scan=1.1.3045.8	50.01534	5	3049.586118	3049.580761	K	F	101	129
PSM	GDFIALDLGGSSFR	4558	sp|P17710|HXK1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3431.7	60.84948	2	1453.726447	1453.720144	K	I	134	148
PSM	FDMIVPILEK	4559	sp|O55222|ILK_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3499.6	62.74586	2	1203.651847	1203.657332	K	M	439	449
PSM	DVIVDLLCYR	4560	sp|A2ATU0|DHTK1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	8-UNIMOD:4	ms_run[1]:scan=1.1.3607.8	65.79707	2	1264.645047	1264.648559	K	Q	423	433
PSM	EFEPLLNWMK	4561	sp|P08113|ENPL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3593.4	65.39415	2	1305.641847	1305.642745	K	D	614	624
PSM	ALLAYAFALAGNK	4562	sp|Q61838|PZP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3460.8	61.64371	2	1321.730247	1321.739423	K	A	1160	1173
PSM	AWNIWADIPAPK	4563	sp|Q9DBF1|AL7A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3516.8	63.21673	2	1380.706847	1380.719021	K	R	98	110
PSM	TGEAIVDAALSALR	4564	sp|Q922R8|PDIA6_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3600.8	65.59602	2	1385.743047	1385.751444	R	Q	119	133
PSM	LLIQSEFPSLLK	4565	sp|P97816|S100G_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3470.5	61.91512	2	1386.807247	1386.812253	K	A	34	46
PSM	IISYAQGFMLLR	4566	sp|Q9DCD0|6PGD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3450.9	61.36542	2	1410.761647	1410.769342	K	Q	332	344
PSM	SLNYWSNLLGMK	4567	sp|Q9CPV4|GLOD4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3529.8	63.5916	2	1424.704247	1424.712222	K	I	151	163
PSM	VADALANAAGHLDDLPGALSALSDLHAHK	4568	tr|Q91VB8|Q91VB8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3448.12	61.31085	4	2862.460494	2862.462420	K	L	63	92
PSM	LAPITSDPTEAAAVGAVEASFK	4569	sp|P52480|KPYM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3527.10	63.53577	3	2144.097371	2144.100115	R	C	401	423
PSM	LTAGNALAFLGLER	4570	sp|Q8R519|ACMSD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3604.8	65.71107	2	1444.796047	1444.803814	K	K	319	333
PSM	EEGWLAEHMLILGITNPEGK	4571	sp|Q9Z2V4|PCKGC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3633.9	66.55732	3	2236.114271	2236.119805	K	K	257	277
PSM	LMNESLMLVTALNPHIGYDK	4572	sp|P97807|FUMH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3493.11	62.57608	3	2258.142371	2258.143911	K	A	445	465
PSM	VTMWVFEEDIGGR	4573	sp|P13707|GPDA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3458.10	61.59095	2	1537.720247	1537.723515	R	K	36	49
PSM	INFLVNNGGGQFMAPVEDITAK	4574	sp|Q99MZ7|PECR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3606.14	65.77338	3	2334.162071	2334.167818	K	G	101	123
PSM	LASQANIAQVLAELK	4575	sp|O35643|AP1B1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3514.12	63.16262	2	1567.886047	1567.893357	R	E	345	360
PSM	LLGQFTLIGIPPAPR	4576	sp|P38647|GRP75_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3634.14	66.5858	2	1591.939847	1591.944999	K	G	499	514
PSM	VSALDLAVLDQVEAR	4577	sp|Q99KJ8|DCTN2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3478.14	62.14787	2	1597.859247	1597.867536	K	L	269	284
PSM	DVSELTGFPEMLGGR	4578	sp|Q9CWJ9|PUR9_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3588.9	65.26037	2	1606.767847	1606.766108	R	V	50	65
PSM	CPEALFQPSFLGMESCGIHETTFNSIMK	4579	sp|P60710|ACTB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	1-UNIMOD:4,16-UNIMOD:4	ms_run[1]:scan=1.1.3641.13	66.78844	4	3230.463694	3230.454500	R	C	257	285
PSM	EIWLAPPQFYEMR	4580	sp|P11930|NUD19_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3620.8	66.17664	2	1678.813647	1678.817749	K	R	232	245
PSM	ALPFWNEEIVPQIK	4581	sp|Q9DBJ1|PGAM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3625.17	66.32487	2	1682.902447	1682.903193	R	E	163	177
PSM	VSILIGASQDLIPQLK	4582	sp|O88587|COMT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3601.15	65.63063	2	1693.993047	1693.997822	K	K	155	171
PSM	TLTQCSWLLDGFPR	4583	sp|Q9WTP7|KAD3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	5-UNIMOD:4	ms_run[1]:scan=1.1.3500.18	62.7844	2	1692.828847	1692.829377	K	T	81	95
PSM	SSTAQEAVHVIAGLLDR	4584	sp|Q8VCA8|SCRN2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3500.6	62.77438	3	1765.927571	1765.932262	R	Y	125	142
PSM	QCIVAHPVNPPYYVPLVELVPHPETAPATMDR	4585	sp|Q99KP3|CRYL1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	2-UNIMOD:4	ms_run[1]:scan=1.1.3456.20	61.54483	4	3609.822094	3609.811231	K	T	140	172
PSM	SLRPGVAIADFVIFPPR	4586	sp|O09173|HGD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3527.4	63.53077	3	1854.036671	1854.051589	K	W	305	322
PSM	AYSEALAAFGNGALFVEK	4587	sp|Q05920|PYC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3510.16	63.05853	2	1856.928847	1856.930865	R	F	220	238
PSM	LFDSDPITVVLPEEVSK	4588	sp|Q06890|CLUS_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3597.17	65.51887	2	1886.989647	1886.987711	K	D	408	425
PSM	HGYPLILYDVFPDVCK	4589	sp|Q99L13|3HIDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	15-UNIMOD:4	ms_run[1]:scan=1.1.3547.3	64.10582	3	1934.954471	1934.960057	K	E	60	76
PSM	AIAELGIYPAVDPLDSTSR	4590	sp|P56480|ATPB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3499.21	62.75838	2	1987.022647	1987.026222	R	I	388	407
PSM	SLPADILYEDQQCLVFR	4591	sp|Q9D0S9|HINT2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	13-UNIMOD:4	ms_run[1]:scan=1.1.3590.6	65.3129	3	2066.011271	2066.014277	R	D	63	80
PSM	GPLLVQDVVFTDEMAHFDR	4592	sp|P24270|CATA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3547.7	64.10915	3	2188.073171	2188.062290	R	E	48	67
PSM	AVDDSYNVQPDTVAPIWNLR	4593	sp|Q8R086|SUOX_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3488.12	62.43252	3	2272.110671	2272.112411	K	G	511	531
PSM	ETAMINWDQPAEAIHNWIR	4594	sp|Q8R0Y6|AL1L1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3553.8	64.28091	3	2294.088371	2294.090236	K	G	207	226
PSM	ETLQLVDSTTSYGLTGAVFAQDK	4595	sp|Q8CHT0|AL4A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3537.19	63.83075	3	2443.205171	2443.211851	R	A	464	487
PSM	DVPVGSIICITVEKPQDIEAFK	4596	sp|Q8BMF4|ODP2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	9-UNIMOD:4	ms_run[1]:scan=1.1.3561.14	64.51432	3	2457.287171	2457.282513	R	N	155	177
PSM	GNVQVVIPFLTESYSSSQDPPEK	4597	sp|Q02053|UBA1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3583.5	65.12442	3	2520.238871	2520.238400	K	S	605	628
PSM	GLQVVEHACSVTSLMLGETMPSITK	4598	sp|Q9EQ20|MMSA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	9-UNIMOD:4	ms_run[1]:scan=1.1.3491.18	62.52398	3	2687.334071	2687.333245	R	D	141	166
PSM	EIENLILNDPDFQHEDYNFLTR	4599	sp|Q9R0H0|ACOX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3615.21	66.03875	3	2734.288571	2734.287475	R	S	35	57
PSM	LQLNIVEMKDENATLDGGDVLFTGR	4600	sp|Q9CWS0|DDAH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3476.20	62.09545	3	2747.376371	2747.379995	K	E	112	137
PSM	SFQGPVLIGSAQGGVNIEDVAAENPEAIVK	4601	sp|Q9Z2I9|SUCB1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3623.21	66.27016	3	3008.552171	3008.545481	R	E	176	206
PSM	LLVVYPWTQR	4602	tr|A8DUK4|A8DUK4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.6122.3	89.94828	2	1273.708847	1273.718293	R	Y	32	42
PSM	DSTLIMQLLR	4603	sp|O70456|1433S_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3658.4	67.25867	2	1188.647247	1188.653644	K	D	215	225
PSM	GLDTVVDLLADVVLHPR	4604	sp|Q9DC61|MPPA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3908.2	74.2389	3	1831.017371	1831.020349	K	L	158	175
PSM	AFLTLAEDILR	4605	sp|P61027|RAB10_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3676.6	67.75922	2	1260.698447	1260.707788	K	K	162	173
PSM	SFLLDLLNATGK	4606	sp|P16381|DDX3L_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3764.3	70.2355	2	1290.712247	1290.718353	R	D	428	440
PSM	VGWEQLLTTIAR	4607	sp|P57780|ACTN4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3741.5	69.58345	2	1385.764447	1385.766700	R	T	735	747
PSM	NIVEEIEDLVAR	4608	sp|Q9DBG6|RPN2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3822.8	71.85886	2	1398.734247	1398.735459	R	L	179	191
PSM	LLSHCLLVTLASHHPADFTPAVHASLDKFLASVSTVLTSK	4609	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	5-UNIMOD:4	ms_run[1]:scan=1.1.3767.9	70.32748	6	4283.287341	4283.277650	K	Y	101	141
PSM	AGYTDQVVIGMDVAASEFYR	4610	sp|P17182|ENOA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3735.9	69.41555	3	2191.030571	2191.025570	K	S	234	254
PSM	LGANSLLDLVVFGR	4611	sp|Q8K2B3|SDHA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3819.9	71.7761	2	1472.829647	1472.835114	R	A	452	466
PSM	FDTTFFLCCLR	4612	sp|P11930|NUD19_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	8-UNIMOD:4,9-UNIMOD:4	ms_run[1]:scan=1.1.3652.9	67.0921	2	1478.661847	1478.668643	R	D	191	202
PSM	GLVLIAFSQYLQK	4613	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3693.6	68.24838	2	1478.846447	1478.849701	K	C	45	58
PSM	GSVNMPFMDFLTK	4614	sp|P52196|THTR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3713.9	68.80695	2	1485.696847	1485.699608	R	D	207	220
PSM	TFCQLILDPIFK	4615	sp|P58252|EF2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	3-UNIMOD:4	ms_run[1]:scan=1.1.3708.6	68.66507	2	1493.787447	1493.795223	R	V	288	300
PSM	TFCQLILDPIFK	4616	sp|P58252|EF2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	3-UNIMOD:4	ms_run[1]:scan=1.1.3702.8	68.49917	2	1493.787447	1493.795223	R	V	288	300
PSM	AILPFDLQIIDEK	4617	sp|Q91VA0|ACSM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3711.9	68.75045	2	1513.833647	1513.839196	K	G	388	401
PSM	DFLIPVAWYEDR	4618	sp|O09173|HGD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3790.10	70.9725	2	1522.740247	1522.745630	R	R	226	238
PSM	GMYGIENEVFLSLPCILNAR	4619	sp|P16125|LDHB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	15-UNIMOD:4	ms_run[1]:scan=1.1.3849.4	72.61552	3	2295.143771	2295.139160	K	G	280	300
PSM	LAGVTALSCWLPLR	4620	sp|P97823|LYPA1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	9-UNIMOD:4	ms_run[1]:scan=1.1.3731.10	69.30175	2	1555.850247	1555.854469	K	A	136	150
PSM	MFESFIESVPLFK	4621	sp|P12367|KAP2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3797.12	71.17077	2	1572.785647	1572.789803	K	S	248	261
PSM	DDGLFSGDPNWFPK	4622	sp|Q9WVA4|TAGL2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3657.9	67.23542	2	1593.706447	1593.709973	R	K	140	154
PSM	SGLLVLTTPLATLAAR	4623	sp|Q9DBL7|COASY_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3716.8	68.89183	2	1595.955847	1595.961043	R	L	6	22
PSM	DMTLEGDDLILEIE	4624	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3935.4	74.95493	2	1604.744847	1604.749120	K	-	1165	1179
PSM	VGTLDVLVGLSDELAK	4625	sp|Q9Z1G3|VATC1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3792.14	71.03162	2	1627.900047	1627.903253	K	L	45	61
PSM	DNYVPEVSALDQEIIEVDPDTK	4626	sp|P63276|RS17_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3740.9	69.55935	3	2488.180871	2488.185695	R	E	82	104
PSM	NTMSLLAANNLLAGLR	4627	sp|Q91Z53|GRHPR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3655.10	67.18412	2	1670.903647	1670.913775	R	G	303	319
PSM	DLADELALVDVMEDK	4628	sp|P06151|LDHA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3823.15	71.89252	2	1674.802647	1674.802218	K	L	43	58
PSM	LSTVASTDILATVLEEMPPFPER	4629	sp|P17427|AP2A2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3892.5	73.81532	3	2515.286171	2515.287992	R	E	585	608
PSM	TLFSNIVLSGGSTLFK	4630	sp|P61164|ACTZ_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3733.3	69.35257	3	1682.916971	1682.924323	R	G	293	309
PSM	IALTMDLAPLLPAAPPP	4631	sp|Q8VE95|CH082_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3901.2	74.04297	2	1699.954647	1699.958266	R	-	202	219
PSM	QQLNIHGLLPPCIISQELQVLR	4632	sp|P06801|MAOX_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	12-UNIMOD:4	ms_run[1]:scan=1.1.3729.11	69.24725	3	2568.425771	2568.421013	R	I	36	58
PSM	DIPRVEPDVAEVVGYQWLSPSEATECFLSK	4633	sp|P11930|NUD19_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	26-UNIMOD:4	ms_run[1]:scan=1.1.3801.17	71.28748	4	3420.660894	3420.654774	R	E	202	232
PSM	VNEMIIGGGMAFTFLK	4634	sp|P09411|PGK1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3747.11	69.75381	2	1726.875647	1726.878635	K	V	231	247
PSM	EQGYDVIAYLANIGQK	4635	sp|P16460|ASSY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3720.13	69.01009	2	1780.913847	1780.899565	K	E	26	42
PSM	VAEQTPLTALYVANLIK	4636	sp|P47738|ALDH2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3710.17	68.7291	2	1843.043847	1843.045501	K	E	212	229
PSM	VGGYILGEFGNLIAGDPR	4637	sp|P17426|AP2A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3743.17	69.64833	2	1846.957047	1846.957748	K	S	499	517
PSM	NVFDEAILAALEPPEPK	4638	sp|P60766|CDC42_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3816.3	71.68763	3	1851.956471	1851.961831	K	K	167	184
PSM	DIQQWEYVPLGPFLGK	4639	sp|P35505|FAAA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3828.3	72.02213	3	1888.965371	1888.972336	R	S	238	254
PSM	EYLISLDPENLTLLEK	4640	sp|Q9DC50|OCTC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3762.20	70.19125	2	1889.002447	1889.003361	R	I	253	269
PSM	AAGTTVVEVEEIVDIGSFAPEDIHIPK	4641	sp|Q9D0K2|SCOT1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3765.20	70.27877	3	2835.458471	2835.454206	K	I	237	264
PSM	DLPITEAVFSALVTGHAR	4642	sp|Q6PB66|LPPRC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3781.2	70.7218	3	1896.004271	1896.010512	K	A	226	244
PSM	DLPITEAVFSALVTGHAR	4643	sp|Q6PB66|LPPRC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3780.4	70.69618	3	1896.004271	1896.010512	K	A	226	244
PSM	NMAEQIIQEIYSQVQSK	4644	sp|P40142|TKT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3838.4	72.3003	3	2007.993371	2007.993542	K	K	265	282
PSM	KEDLVFIFWAPENAPLK	4645	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3651.5	67.05977	3	2016.064871	2016.072050	K	S	96	113
PSM	INSCFSANTVEQIIENLR	4646	sp|Q8QZS1|HIBCH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	4-UNIMOD:4	ms_run[1]:scan=1.1.3801.8	71.27998	3	2107.035071	2107.036804	K	Q	267	285
PSM	AYLDQTVVPILLQGLAVLAK	4647	sp|Q99LT0|DPY30_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.4010.2	76.44202	3	2124.255671	2124.255828	R	E	55	75
PSM	MADAIILAIAGGQELLAQTQK	4648	sp|Q3UPL0|SC31A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3867.3	73.11893	3	2154.163571	2154.171840	R	K	594	615
PSM	YHEQLSTQSLIELFESFK	4649	sp|Q68FD5|CLH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3791.9	70.99942	3	2198.093171	2198.089550	K	S	689	707
PSM	ISFDPQDTFESEFYLDEK	4650	sp|P07759|SPA3K_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3665.10	67.45613	3	2208.969971	2208.973912	K	R	218	236
PSM	AELGIPLEEVDLNEMDYLTR	4651	sp|P58044|IDI1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3793.7	71.05405	3	2319.131171	2319.130429	K	I	114	134
PSM	ALNVEPDGTGLTCSLAPNILSQL	4652	sp|P99029|PRDX5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	13-UNIMOD:4	ms_run[1]:scan=1.1.3886.3	73.63303	3	2382.206771	2382.210077	K	-	188	211
PSM	LAYVAAGDLAPINAFIGGLAAQEVMK	4653	sp|Q02053|UBA1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3862.12	72.9874	3	2602.376471	2602.382896	K	A	386	412
PSM	IYDDDFFQNLDGVANALDNIDAR	4654	sp|Q02053|UBA1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3853.12	72.73573	3	2613.201671	2613.198326	R	M	559	582
PSM	YLLQYQEPIPCEQLVTALCDIK	4655	sp|Q9R1P0|PSA4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	11-UNIMOD:4,19-UNIMOD:4	ms_run[1]:scan=1.1.3780.12	70.70285	3	2693.339171	2693.344462	R	Q	97	119
PSM	SLAFAYVPVQLSEVGQQVEVELLGK	4656	sp|Q9DBT9|M2GD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3901.3	74.04881	3	2702.456471	2702.453084	K	N	805	830
PSM	DILQDVLDADLSNEAFPFSTHQLVR	4657	sp|Q99LB7|SARDH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3845.8	72.5102	3	2842.419971	2842.413738	R	A	693	718
PSM	AASLGLLQFPILNASVDENCQNITYK	4658	sp|P53395|ODB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	20-UNIMOD:4	ms_run[1]:scan=1.1.3788.8	70.92195	3	2878.452371	2878.453495	K	A	314	340
PSM	LDNLHSCFCALQALIDSCASPASLAR	4659	sp|Q9Z2W0|DNPEP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	7-UNIMOD:4,9-UNIMOD:4,18-UNIMOD:4	ms_run[1]:scan=1.1.3765.21	70.2796	3	2889.364271	2889.357169	R	D	261	287
PSM	FMCAQLPNPVLDSISIIDTPGILSGEK	4660	sp|Q9WVK4|EHD1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	3-UNIMOD:4	ms_run[1]:scan=1.1.3859.10	72.90607	3	2914.478171	2914.482018	R	Q	136	163
PSM	YRIPADVDPLTITSSLSSDGVLTVNGPR	4661	sp|P23927|CRYAB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3653.18	67.13118	3	2942.539571	2942.534916	K	K	122	150
PSM	VMDHPGNYVEPTIVTGLAHDAPIVHQETFAPILYVFK	4662	sp|Q9DBF1|AL7A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3716.9	68.89267	5	4118.114118	4118.097560	K	F	401	438
PSM	LLSHCLLVTLASHHPADFTPAVHASLDKFLASVSTVLTSK	4663	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	5-UNIMOD:4	ms_run[1]:scan=1.1.3767.16	70.33334	5	4283.296118	4283.277650	K	Y	101	141
PSM	AVDVFFPPEAQNDFPVAMQISEK	4664	sp|Q68FD5|CLH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3755.12	69.983	3	2578.242971	2578.241377	K	H	247	270
PSM	DRVTDALNATR	4665	sp|P63038|CH60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2297.2	29.16885	3	1230.620471	1230.631663	K	A	419	430
PSM	NAVTQEFGPVPDTAR	4666	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2698.20	40.2938	2	1600.778047	1600.784535	R	Y	634	649
PSM	TGLVFMPGTIQMR	4667	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	12-UNIMOD:35	ms_run[1]:scan=1.1.3081.13	51.04175	2	1465.731847	1465.742142	R	S	129	142
PSM	MLLQQDLSSYK	4668	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2798.17	43.10258	2	1324.665047	1324.669688	R	F	318	329
PSM	SDDIINSSGYR	4669	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2334.13	30.2133	2	1226.560447	1225.557495	R	I	463	474
PSM	FNRDVDETIGWIK	4670	sp|P16546|SPTN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2860.6	44.85242	3	1591.794671	1591.799457	R	E	260	273
PSM	QFYPDLIR	4671	sp|P17563|SBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15	1-UNIMOD:28	ms_run[1]:scan=1.1.3596.2	65.4762	2	1033.5150	1033.5228	K	E	412	420
PSM	LTYGTMVFVR	4672	sp|Q9R0H0|ACOX1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2969.7	47.915	2	1185.612247	1185.621616	K	S	273	283
PSM	DMDLYSYR	4673	sp|Q9EQ20|MMSA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2739.5	41.44132	2	1061.439847	1061.448796	K	L	166	174
PSM	CNEIISWLDK	4674	sp|P63017|HSP7C_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.3838.2	72.29863	2	1259.5777	1259.5851	K	N	574	584
PSM	RAPFDLFENK	4675	sp|P11499|HS90B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2787.11	42.78753	2	1235.620247	1235.629872	R	K	338	348
PSM	KGFIGPGIDVPAPDMSTGER	4676	sp|P26443|DHE3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2959.12	47.63438	3	2042.999171	2043.009526	K	E	212	232
PSM	KGFIGPGIDVPAPDMSTGER	4677	sp|P26443|DHE3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2958.18	47.61095	3	2042.999171	2043.009526	K	E	212	232
PSM	DLYANTVLSGGTTMYPGIADR	4678	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3486.11	62.37433	3	2214.063071	2214.062684	K	M	292	313
PSM	MSATFIGNSTAIQELFK	4679	sp|P68372|TBB4B_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15		ms_run[1]:scan=1.1.3635.10	66.61753	2	1856.9255	1856.9337	K	R	363	380
PSM	CSNEPVGPSIAALTSEER	4680	sp|Q9DC50|OCTC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15	1-UNIMOD:4	ms_run[1]:scan=1.1.2918.9	46.4865	3	1915.9027	1915.8940	K	T	228	246
PSM	IVGAPMHDLLLWNNATVTTCHSK	4681	sp|Q922D8|C1TC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15	20-UNIMOD:4	ms_run[1]:scan=1.1.3053.13	50.2447	4	2577.2784	2577.2827	K	T	176	199
PSM	MFGVPVVVAVNVFK	4682	sp|Q922D8|C1TC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3754.11	69.95357	2	1504.840247	1504.847593	R	T	747	761
PSM	ANHAPFETDISTLTR	4683	sp|Q9QXD6|F16P1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15	1-UNIMOD:1	ms_run[1]:scan=1.1.3084.20	51.13438	2	1713.8231	1713.8317	M	F	2	17
PSM	VDFNVPMK	4684	sp|P09041|PGK2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2641.7	38.69968	2	948.465847	948.473889	R	N	23	31
PSM	YTMGDAPDFDR	4685	sp|P10649|GSTM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2619.19	38.09187	2	1286.516047	1286.523752	R	S	33	44
PSM	CLDAFPNLR	4686	sp|P10649|GSTM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.3695.2	68.2999	2	1087.5025	1087.5115	K	D	174	183
PSM	KDGVDFGK	4687	sp|Q91Y97|ALDOB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15		ms_run[1]:scan=1.1.1768.12	14.47683	2	864.4281	864.4336	K	W	140	148
PSM	EIIDPVLDR	4688	sp|P68368|TBA4A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2758.6	41.96565	2	1068.572647	1068.581525	K	I	113	122
PSM	FDLMYAK	4689	sp|P05213|TBA1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2698.3	40.27962	2	886.417447	886.425876	K	R	395	402
PSM	VVGYFVSGCDPTIMGIGPVPAINGALK	4690	sp|Q8BWT1|THIM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	9-UNIMOD:4	ms_run[1]:scan=1.1.3786.8	70.86622	3	2732.395571	2731.407731	R	K	279	306
PSM	HPDEPVLLEEPVVLALAEK	4691	sp|Q9JII6|AK1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3577.8	64.95998	3	2098.135271	2097.135772	R	H	222	241
PSM	QGAALGIPYFTACR	4692	sp|P47199|QOR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	13-UNIMOD:4	ms_run[1]:scan=1.1.3197.18	54.30325	2	1523.751847	1523.755484	R	A	125	139
PSM	LHTVYQSVELPETHQMLR	4693	sp|Q07417|ACADS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15		ms_run[1]:scan=1.1.2658.5	39.17745	4	2180.1036	2180.1043	R	Q	25	43
PSM	SDDIILSSGYR	4694	sp|Q3UNX5|ACSM3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2639.15	38.64968	2	1224.592447	1224.598632	R	I	471	482
PSM	IKADYAQLLEDMQNAFR	4695	sp|P50516|VATA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3693.5	68.24755	3	2026.011371	2024.998961	K	S	597	614
PSM	AAVVLENGVLSR	4696	sp|P16331|PH4H_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15	1-UNIMOD:1	ms_run[1]:scan=1.1.3549.4	64.16309	2	1268.7005	1268.7083	M	K	2	14
PSM	SFQHLLQTLNRPDSELQLSTGNGLFVNNDLK	4697	sp|P07758|A1AT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3553.17	64.28844	4	3498.778894	3497.790296	K	L	113	144
PSM	TLMSPLGITR	4698	sp|P07758|A1AT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2832.9	44.06197	2	1087.597047	1087.605965	K	I	319	329
PSM	DIPNGATLLVGGFGLCGIPENLIGALLK	4699	sp|Q9D0K2|SCOT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	16-UNIMOD:4	ms_run[1]:scan=1.1.4143.2	77.86285	3	2822.527271	2821.541188	K	T	52	80
PSM	RTIAQDYGVLK	4700	sp|P35700|PRDX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2297.4	29.17052	3	1262.686871	1262.698286	K	A	110	121
PSM	SSGAGWQSQASAK	4701	sp|Q5U5V2|HYKK_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15	1-UNIMOD:1	ms_run[1]:scan=1.1.2267.20	28.35522	2	1305.5897	1305.5944	M	P	2	15
PSM	FDNLYGCR	4702	sp|P50247|SAHH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	7-UNIMOD:4	ms_run[1]:scan=1.1.2298.13	29.20648	2	1043.441447	1043.449465	K	E	189	197
PSM	MGAVFMDAPVSGGVGAAR	4703	sp|Q99L13|3HIDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	1-UNIMOD:35	ms_run[1]:scan=1.1.2839.21	44.27102	2	1708.800447	1707.807261	K	S	149	167
PSM	KGATLVCAWAEEGADALGPDGQLLHSDAFPPPR	4704	sp|P97328|KHK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	7-UNIMOD:4	ms_run[1]:scan=1.1.3464.18	61.7618	4	3446.673294	3445.672489	K	V	217	250
PSM	KGATLVCAWAEEGADALGPDGQLLHSDAFPPPR	4705	sp|P97328|KHK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	7-UNIMOD:4	ms_run[1]:scan=1.1.3451.17	61.40095	4	3446.673294	3445.672489	K	V	217	250
PSM	IGGHGAEYGAEALER	4706	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2229.10	27.30402	3	1529.741471	1528.727020	K	M	18	33
PSM	LLSHCLLVTLASHHPADFTPAVHASLDK	4707	tr|Q91VB8|Q91VB8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15	5-UNIMOD:4	ms_run[1]:scan=1.1.3077.7	50.92143	5	3049.5831	3049.5802	K	F	101	129
PSM	IAIDAGFHHFDSASVYNTEDHVGEAIR	4708	sp|Q91WR5|AK1CL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2923.10	46.6302	5	2970.396118	2970.389649	K	S	40	67
PSM	QTELLLLGTK	4709	sp|Q9D826|SOX_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15	1-UNIMOD:28	ms_run[1]:scan=1.1.3632.3	66.518	2	1097.6239	1097.6327	R	E	89	99
PSM	QGIDHEYLSSVDLK	4710	sp|Q9D826|SOX_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15	1-UNIMOD:28	ms_run[1]:scan=1.1.3008.16	48.99845	2	1585.7561	1585.7619	R	Q	113	127
PSM	CSEGPGLCLAR	4711	sp|Q8VDK1-2|NIT1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15	1-UNIMOD:385,1-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.2936.12	47.00435	2	1201.5102	1201.5212	R	I	248	259
PSM	GPILMELQTYR	4712	sp|P35486|ODPA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3086.12	51.18497	2	1319.682447	1319.690758	K	Y	278	289
PSM	AASGAPLRPATVLGTMEMGR	4713	sp|Q8CG76|ARK72_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15		ms_run[1]:scan=1.1.2896.12	45.87018	3	1986.0452	1985.0182	R	R	38	58
PSM	QLLTLSNELSQAR	4714	sp|P26040|EZRI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15	1-UNIMOD:28	ms_run[1]:scan=1.1.3662.6	67.37438	2	1454.7645	1454.7724	R	D	530	543
PSM	NTDEMVELR	4715	sp|P61979|HNRPK_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2347.17	30.56517	2	1105.501247	1105.507374	R	I	38	47
PSM	ILSQWKPEDSK	4716	sp|Q9WVM8|AADAT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2186.10	26.11638	3	1330.704971	1329.692866	K	D	174	185
PSM	SALYYVDLSGGK	4717	sp|Q8R146|APEH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2881.11	45.45173	2	1271.645447	1271.639768	R	C	280	292
PSM	YRADAGGELNLAR	4718	sp|Q9QYR9|ACOT2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2258.9	28.09743	3	1404.699071	1404.710976	R	A	93	106
PSM	CLDEFPNLK	4719	sp|P48774|GSTM5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.3591.3	65.33807	2	1117.5052	1117.5109	K	A	177	186
PSM	QDVDVWLWQQEGSSK	4720	sp|Q78JT3|3HAO_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15	1-UNIMOD:28	ms_run[1]:scan=1.1.3768.14	70.36058	2	1786.8205	1786.8157	R	V	224	239
PSM	VADLYELVQYAGNIIPR	4721	sp|Q9EQH3|VPS35_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3851.3	72.67233	3	1933.027571	1933.030913	K	L	91	108
PSM	IPVDTYNNILTVLK	4722	sp|Q9EQH3|VPS35_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3500.14	62.78107	2	1601.893647	1601.902859	K	L	404	418
PSM	AAIGDTLVQDIR	4723	sp|Q9CXN7|PBLD2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2881.11	45.45173	2	1270.680447	1270.688115	K	Y	142	154
PSM	TGCTFPEKPDFH	4724	sp|P55264|ADK_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	3-UNIMOD:4	ms_run[1]:scan=1.1.2371.10	31.21323	3	1434.614771	1434.623801	R	-	350	362
PSM	DPLHYSIVSAPAAQK	4725	sp|Q8BH86|GLUCM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2606.12	37.73352	3	1595.815871	1595.830757	K	V	281	296
PSM	VRELESTIAVDPGNR	4726	sp|Q8BH86|GLUCM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2373.11	31.26888	3	1654.850471	1654.863848	K	G	296	311
PSM	IQIWDTAGQER	4727	sp|Q8K386|RAB15_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2698.17	40.2913	2	1315.643447	1315.652064	R	Y	59	70
PSM	TSLDLYANVIHCK	4728	sp|P70404|IDHG1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	12-UNIMOD:4	ms_run[1]:scan=1.1.2770.7	42.30275	3	1532.754071	1532.765714	R	S	137	150
PSM	TSTSENVLFGMGNPLLDISAVVDK	4729	sp|P55264-2|ADK-2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15	1-UNIMOD:1	ms_run[1]:scan=1.1.4047.2	76.75395	3	2548.2757	2548.2725	M	D	2	26
PSM	HQSLGGQYGVQGFPTIK	4730	sp|Q922R8|PDIA6_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2726.8	41.0836	3	1815.912071	1815.926782	K	I	86	103
PSM	LYRPGSVAYVSR	4731	sp|Q91V92|ACLY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2219.13	27.0311	3	1366.728371	1366.735734	K	S	641	653
PSM	SSSRPVALVTGANK	4732	sp|P48758|CBR1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15	1-UNIMOD:1	ms_run[1]:scan=1.1.2363.20	31.00145	2	1427.7689	1427.7727	M	G	2	16
PSM	GFVVQGSTGEFPFLTSLER	4733	sp|Q9DCU9|HOGA1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3742.3	69.6092	3	2070.042371	2070.042206	R	L	65	84
PSM	APLQELSPTEEEALR	4734	sp|Q9DCU9|HOGA1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2816.9	43.60452	3	1681.843871	1681.852280	R	L	298	313
PSM	MENLFQLVR	4735	sp|Q9CZ42-2|NNRD-2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15	1-UNIMOD:1	ms_run[1]:scan=1.1.3881.3	73.50355	2	1190.6042	1190.6113	-	N	1	10
PSM	AAGTLYTYPENWR	4736	sp|Q9D8N0|EF1G_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15	1-UNIMOD:1	ms_run[1]:scan=1.1.3436.5	60.98185	2	1582.7497	1582.7411	M	A	2	15
PSM	QLDEVPASIDALR	4737	sp|Q9NYQ2|HAOX2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2992.10	48.54465	2	1426.742047	1425.746358	R	E	252	265
PSM	AAFVTLLTGAK	4738	tr|G5E895|G5E895_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15	1-UNIMOD:1	ms_run[1]:scan=1.1.3928.2	74.74422	2	1132.6407	1132.6487	M	M	2	13
PSM	VHIEIGPDGR	4739	sp|O35737|HNRH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15		ms_run[1]:scan=1.1.2176.6	25.83278	3	1091.5645	1091.5718	R	V	317	327
PSM	AEGQVLVLDGR	4740	sp|P19253|RL13A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15	1-UNIMOD:1	ms_run[1]:scan=1.1.3156.3	53.15328	2	1197.6232	1197.6352	M	G	2	13
PSM	SSLYSSDIGK	4741	sp|A2ATU0|DHTK1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2189.19	26.20943	2	1055.513247	1055.513505	R	L	380	390
PSM	APILIATDVASR	4742	sp|Q501J6|DDX17_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2756.13	41.9153	2	1224.699847	1225.703037	K	G	390	402
PSM	PSNLLINTTCDLK	4743	sp|Q63844|MK03_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	10-UNIMOD:4	ms_run[1]:scan=1.1.2833.20	44.09982	2	1487.758847	1487.765380	K	I	170	183
PSM	ADLIAYLK	4744	sp|P62897|CYC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2976.2	48.10125	2	905.514647	905.522219	R	K	93	101
PSM	DLLHPSPEEEK	4745	sp|Q6ZWU9|RS27_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2236.9	27.4919	3	1292.617871	1292.624846	K	R	6	17
PSM	SLFSSIGEVESAK	4746	sp|P70372|ELAV1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2998.14	48.7155	2	1352.688847	1352.682361	R	L	38	51
PSM	GVVQDLQQAISK	4747	sp|P57776|EF1D_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3035.10	49.7298	2	1284.693647	1284.703765	R	L	96	108
PSM	QFLLTNLVEVGGR	4748	sp|Q8K4F5|ABHDB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3470.7	61.91678	2	1444.797047	1444.803814	R	F	209	222
PSM	GVLMYGPPGCGK	4749	sp|P54775|PRS6B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15	4-UNIMOD:35,10-UNIMOD:4	ms_run[1]:scan=1.1.2744.13	41.58828	2	1251.5992	1250.5782	R	T	201	213
PSM	ACGLVASNLNLKPGECLK	4750	sp|P16045|LEG1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15	1-UNIMOD:1,2-UNIMOD:4,16-UNIMOD:4	ms_run[1]:scan=1.1.3147.14	52.90312	3	1985.0027	1985.0069	M	V	2	20
PSM	SEFWLISAPGDK	4751	sp|Q99L60|VATC2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15	1-UNIMOD:1	ms_run[1]:scan=1.1.3812.7	71.57993	2	1390.6662	1390.6762	M	E	2	14
PSM	YAGLKPEELPTCESLK	4752	sp|O70250|PGAM2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	12-UNIMOD:4	ms_run[1]:scan=1.1.2639.15	38.64968	3	1834.910771	1833.918252	R	D	142	158
PSM	EALTYDGALLGDR	4753	sp|Q9WUK2|IF4H_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2913.14	46.3508	2	1392.697047	1392.688509	K	S	97	110
PSM	EAVDIICSFLK	4754	sp|E9Q9A9|OAS2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15	7-UNIMOD:4	ms_run[1]:scan=1.1.3498.5	62.71633	2	1293.6718	1293.6634	K	N	407	418
PSM	TGTYIVLDSMLQQIQHEGTVNIFGFLK	4755	sp|B9EKR1|PTPRZ_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15		ms_run[1]:scan=1.1.3039.8	49.84295	5	3052.5692	3051.5732	R	H	1937	1964
PSM	MAAAVLRAALQDWR	4756	sp|Q9CQ40|RM49_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=1.1.3800.15	71.25757	2	1629.8462	1628.8452	-	S	1	15
PSM	CTISQMAVNFSQMLPVEKR	4757	sp|Q402B2|WDR93_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15	1-UNIMOD:4,6-UNIMOD:35,13-UNIMOD:35	ms_run[1]:scan=1.1.3013.8	49.13462	3	2271.0762	2270.0852	K	C	638	657
PSM	QQVAKENQQVAK	4758	sp|Q9JIB0|MOG1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15		ms_run[1]:scan=1.1.2277.21	28.63568	2	1369.7258	1369.7309	K	D	109	121
PSM	QLEEQVK	4759	sp|Q8BX02|KANK2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1573.17	9.075316	2	873.462447	872.460347	R	L	203	210
PSM	SPNGTIR	4760	sp|O88844|IDHC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1641.11	10.95338	2	742.384447	743.392602	K	N	94	101
PSM	KMVMETIEK	4761	sp|Q99NB9|SF3B1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	2-UNIMOD:35	ms_run[1]:scan=1.1.1660.12	11.48242	3	1122.551171	1123.561718	R	I	866	875
PSM	ATAEKIK	4762	sp|Q69Z23|DYH17_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1666.9	11.64677	2	758.440447	759.449054	K	C	3287	3294
PSM	YDDMAACMK	4763	sp|P63101|1433Z_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	7-UNIMOD:4	ms_run[1]:scan=1.1.2180.15	25.9505	2	1104.402047	1103.408588	R	S	19	28
PSM	NLLISDLK	4764	sp|P60954|NOL4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2231.10	27.35787	2	913.549247	914.543683	K	M	334	342
PSM	PPKDIDLK	4765	sp|Q8BTT6|DIEXF_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2232.8	27.38305	2	926.529847	924.528033	K	L	254	262
PSM	IFAQLDR	4766	sp|Q99KP3|CRYL1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2354.5	30.74952	2	862.476247	861.470852	K	I	105	112
PSM	LLVVDPETDER	4767	sp|P70441|NHRF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2617.11	38.03592	2	1285.661647	1284.656146	R	L	88	99
PSM	GIAISFAR	4768	sp|Q9DBM2|ECHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2623.2	38.18863	2	832.469447	833.475938	R	V	309	317
PSM	GIAISFAR	4769	sp|Q9DBM2|ECHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2629.2	38.35655	2	832.473247	833.475938	R	V	309	317
PSM	LGFPMYAHVDK	4770	sp|Q9DCY0|KEG1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2629.3	38.35738	3	1277.622671	1276.627429	K	A	256	267
PSM	LGPALATGNVVVMK	4771	sp|P47738|ALDH2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	13-UNIMOD:35	ms_run[1]:scan=1.1.2652.19	39.01987	2	1385.765447	1384.774822	K	V	198	212
PSM	MAPYQGPDAAPGALDYK	4772	sp|P57780|ACTN4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2757.11	41.94168	3	1762.816571	1763.818872	R	S	884	901
PSM	EGHVEVVSELLQR	4773	sp|G5E8K5|ANK3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2787.6	42.78337	3	1492.784171	1493.783807	K	E	67	80
PSM	GWVKPVIGSEYPLEK	4774	sp|P47199|QOR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2814.7	43.5455	3	1702.905971	1700.913758	K	A	295	310
PSM	MEKLLSTPK	4775	sp|Q30KP5|DFB18_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2855.9	44.71158	2	1045.581847	1045.584167	R	Y	74	83
PSM	NCIVLIDSTPYR	4776	sp|P62242|RS8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	2-UNIMOD:4	ms_run[1]:scan=1.1.2917.19	46.46658	2	1448.720647	1449.728600	K	Q	99	111
PSM	AQFERDLQTR	4777	sp|Q61879|MYH10_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2933.12	46.91782	2	1263.649847	1262.636748	K	D	1574	1584
PSM	WNVLMDYCYTTPSGNPNDDTRYDLFLSCDK	4778	sp|Q8BGZ8|ZPLD1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	8-UNIMOD:4,28-UNIMOD:4	ms_run[1]:scan=1.1.3012.4	49.09858	6	3662.538741	3659.564321	R	D	228	258
PSM	GFSLELSDHSEAMVPVAGQGR	4779	sp|A2ARV4|LRP2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3033.15	49.67697	3	2185.041971	2186.042617	R	N	2076	2097
PSM	GPIVMELQTYR	4780	sp|P35487|ODPAT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	5-UNIMOD:35	ms_run[1]:scan=1.1.3090.17	51.30298	2	1320.679447	1321.670023	K	Y	279	290
PSM	GLLGCNIIPLQR	4781	sp|Q9CR00|PSMD9_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	5-UNIMOD:4	ms_run[1]:scan=1.1.3196.11	54.26877	2	1353.753047	1352.759841	K	-	211	223
PSM	DSLLQDGEFTMDLR	4782	sp|P62962|PROF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3517.14	63.25042	2	1638.749447	1638.755937	R	T	76	90
PSM	MASTFIGNSTAIQELFK	4783	sp|Q922F4|TBB6_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3635.10	66.61753	2	1856.926047	1856.934236	K	R	363	380
PSM	NGPVEGAFTVFSDFLTYK	4784	sp|P10605|CATB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3982.2	75.92525	2	1991.953047	1990.967644	K	S	246	264
PSM	TCIAEK	4785	sp|Q9R0P5|DEST_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	2-UNIMOD:4	ms_run[1]:scan=1.1.1636.7	10.8135	2	720.340847	720.347626	R	L	146	152
PSM	AEFAER	4786	tr|D3Z2H9|D3Z2H9_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1758.11	14.1956	2	721.333247	721.339504	R	S	203	209
PSM	LETPSAK	4787	sp|P51174|ACADL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1754.8	14.08027	2	744.401647	744.401770	R	K	36	43
PSM	NDIIHR	4788	sp|Q80W22|THNS2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1717.10	13.05915	2	766.401447	766.408586	R	T	288	294
PSM	AELAESR	4789	sp|P21107-2|TPM3-2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14		ms_run[1]:scan=1.1.1682.10	12.09132	2	774.3844	774.3867	R	C	147	154
PSM	NEGSESAPEGQAQQR	4790	sp|P62960|YBOX1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1709.21	12.85337	2	1586.687447	1586.692091	K	R	169	184
PSM	TMGCLATTHSK	4791	sp|P61922|GABT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	4-UNIMOD:4	ms_run[1]:scan=1.1.1759.10	14.22328	3	1205.542571	1205.553278	R	A	221	232
PSM	TSYAQHQQVR	4792	sp|P97351|RS3A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1649.7	11.1738	3	1216.584071	1216.594884	K	Q	153	163
PSM	EALTEEK	4793	sp|Q02053|UBA1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1703.11	12.68053	2	818.396447	818.402163	K	C	437	444
PSM	SLEAASEK	4794	sp|Q6IRU2|TPM4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1677.13	11.9532	2	833.406447	833.413063	K	Y	170	178
PSM	ACQIAHDHTDHVIR	4795	sp|Q64462|CP4B1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	2-UNIMOD:4	ms_run[1]:scan=1.1.1748.16	13.91823	4	1671.777294	1671.789972	R	Q	249	263
PSM	TLDCEPK	4796	sp|P15105|GLNA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	4-UNIMOD:4	ms_run[1]:scan=1.1.1737.13	13.61327	2	861.394047	861.390219	R	C	46	53
PSM	EFVTHTK	4797	sp|Q9CPY7|AMPL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1665.12	11.62215	2	860.430847	860.439218	R	W	470	477
PSM	ICYEHR	4798	sp|O88844|IDHC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	2-UNIMOD:4	ms_run[1]:scan=1.1.1673.17	11.84545	2	876.383247	876.391222	K	L	244	250
PSM	KIGQSPVR	4799	sp|Q99KP3|CRYL1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14		ms_run[1]:scan=1.1.1668.14	11.70533	2	883.5161	883.5234	K	V	178	186
PSM	RDHALLEEQSK	4800	sp|P57780|ACTN4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1720.14	13.14412	3	1324.662071	1324.673528	K	Q	634	645
PSM	YDSTHYK	4801	sp|Q9JII6|AK1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1633.15	10.73915	2	912.388847	912.397747	R	E	135	142
PSM	VAQEHFGK	4802	sp|Q921I1|TRFE_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1678.19	11.98615	2	914.452847	914.461016	K	G	288	296
PSM	EVDEYCK	4803	sp|Q64442|DHSO_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	6-UNIMOD:4	ms_run[1]:scan=1.1.1756.16	14.14317	2	941.372847	941.380048	R	I	101	108
PSM	GENCIAAGR	4804	sp|Q8K009|AL1L2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	4-UNIMOD:4	ms_run[1]:scan=1.1.1740.17	13.70025	2	946.420247	946.429064	K	L	725	734
PSM	VQQLADQR	4805	sp|Q3TW96|UAP1L_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1754.18	14.08862	2	956.496247	956.503943	R	Q	149	157
PSM	ANKPGDVVR	4806	sp|Q9CPY7|AMPL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1651.13	11.2347	2	954.515447	954.524679	K	A	343	352
PSM	EKEELMEK	4807	sp|P26041|MOES_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14		ms_run[1]:scan=1.1.1717.19	13.06667	2	1034.4859	1034.4949	R	L	343	351
PSM	NLQAQVSHR	4808	sp|Q9R0H0|ACOX1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1726.16	13.31013	2	1051.542447	1051.552290	K	K	501	510
PSM	KATQEAFMK	4809	sp|Q91Y97|ALDOB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1771.16	14.56473	2	1052.522847	1052.532466	K	R	322	331
PSM	GACAGSEDAVK	4810	sp|P16546|SPTN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	3-UNIMOD:4	ms_run[1]:scan=1.1.1674.19	11.8748	2	1063.451847	1063.460424	R	A	1620	1631
PSM	NIIHGSDSVK	4811	sp|P15532|NDKA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1761.19	14.2868	2	1068.546647	1068.556373	R	S	115	125
PSM	NIIHGSDSVK	4812	sp|P15532|NDKA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1767.17	14.4529	2	1068.546647	1068.556373	R	S	115	125
PSM	NNQITNNQR	4813	sp|P09041|PGK2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1625.20	10.52668	2	1100.527047	1100.532283	K	I	31	40
PSM	RLDSGSASMAK	4814	sp|P51174|ACADL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1709.19	12.8517	2	1121.539847	1121.549907	K	Y	359	370
PSM	SGQASAKPNLR	4815	sp|Q9DBM2|ECHP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1657.18	11.40465	2	1127.594847	1127.604720	K	F	349	360
PSM	EGVHGGLINKK	4816	sp|P62962|PROF1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1682.21	12.1005	2	1150.635047	1150.645856	K	C	117	128
PSM	HSEVQQANLK	4817	sp|O55029|COPB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1688.21	12.26995	2	1152.577647	1152.588736	K	A	319	329
PSM	NKEEAAEYAK	4818	sp|P62754|RS6_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1649.20	11.18465	2	1151.536647	1151.545868	K	L	202	212
PSM	HQATGELDDAK	4819	sp|Q8CC88|VWA8_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1674.21	11.87648	2	1183.541447	1183.546930	R	I	1673	1684
PSM	IQNWHEEHR	4820	sp|P26043|RADI_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1694.21	12.4395	2	1247.583447	1247.579568	R	G	172	181
PSM	HHLDGETEEER	4821	sp|P10649|GSTM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1624.21	10.49957	2	1350.569447	1350.580021	K	I	84	95
PSM	KHHLDGETEEER	4822	sp|P10649|GSTM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1596.10	9.715683	3	1478.661071	1478.674984	R	I	83	95
PSM	LEAEAVPEVSEK	4823	sp|Q9CQM9|GLRX3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2360.21	30.92082	2	1299.655047	1299.655812	K	Y	70	82
PSM	DALNQATSQVESK	4824	sp|Q99PL5|RRBP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2331.19	30.13218	2	1389.664247	1389.673587	R	Q	1010	1023
PSM	LCYLVK	4825	sp|Q9JIL4|NHRF3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	2-UNIMOD:4	ms_run[1]:scan=1.1.2286.3	28.8658	2	794.428447	794.436047	R	E	135	141
PSM	LCYLVK	4826	sp|Q9JIL4|NHRF3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	2-UNIMOD:4	ms_run[1]:scan=1.1.2279.6	28.67907	2	794.428447	794.436047	R	E	135	141
PSM	MLEAFAK	4827	sp|Q9DC50|OCTC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2339.4	30.33537	2	808.408447	808.415311	K	H	483	490
PSM	SRVVGNPFDSR	4828	sp|P47738|ALDH2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2173.8	25.7512	3	1232.620871	1232.626184	K	T	347	358
PSM	TEWLDGK	4829	sp|P17742|PPIA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2244.9	27.71175	2	847.401247	847.407583	K	H	119	126
PSM	TEWLDGK	4830	sp|P17742|PPIA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2250.6	27.87725	2	847.401247	847.407583	K	H	119	126
PSM	TQIDHYVGIAR	4831	sp|Q9ES97|RTN3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2299.7	29.22993	3	1271.664371	1271.662235	K	D	931	942
PSM	TLVWSEK	4832	sp|P24527|LKHA4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2304.4	29.36737	2	861.451447	861.459619	R	E	219	226
PSM	TGPNLHGLFGRK	4833	sp|P62897|CYC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2240.8	27.60045	3	1295.705471	1295.709854	K	T	29	41
PSM	FQLVDSR	4834	sp|P52196|THTR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2323.6	29.89633	2	863.445247	863.450117	R	A	177	184
PSM	FANYIDK	4835	sp|P20152|VIME_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2181.10	25.9742	2	869.420247	869.428319	R	V	114	121
PSM	ADEGISFR	4836	sp|P35700|PRDX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2262.8	28.20663	2	893.415647	893.424296	K	G	121	129
PSM	SEDCFILDHGR	4837	sp|P13020|GELS_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	4-UNIMOD:4	ms_run[1]:scan=1.1.2362.6	30.96247	3	1347.579971	1347.587750	R	D	326	337
PSM	DSILAAADK	4838	sp|Q9WVM8|AADAT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2302.5	29.31355	2	902.462047	902.470912	R	W	331	340
PSM	IIFEDDR	4839	sp|P70349|HINT1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2362.7	30.9633	2	906.436647	906.444697	K	C	31	38
PSM	ADLYLEGK	4840	sp|Q8BIJ6|SYIM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2258.7	28.09577	2	907.461447	907.465098	R	D	618	626
PSM	EVYFAER	4841	sp|P63254|CRIP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2244.10	27.71258	2	912.425847	912.434132	K	V	10	17
PSM	IIDGLAGEK	4842	sp|Q8CC88|VWA8_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2215.14	26.92033	2	914.499447	914.507297	K	S	1684	1693
PSM	MPTPPSYK	4843	sp|P40142|TKT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2171.11	25.69655	2	919.445447	919.447340	R	V	303	311
PSM	VMEYINR	4844	sp|Q68FD5|CLH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2173.13	25.75538	2	923.444247	923.453488	R	L	1040	1047
PSM	FEEDYVK	4845	sp|Q3UZZ6|ST1D1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2194.9	26.34165	2	928.409047	928.417814	K	K	276	283
PSM	DSQGNLFR	4846	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1000663, ProteinPilot, ]	14		ms_run[1]:scan=1.1.2238.8	27.5456	2	935.43744709566	935.4460936925099	K	N	88	96
PSM	AHGGYSVFAGVGER	4847	sp|P56480|ATPB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2376.11	31.35178	3	1405.662671	1405.673862	K	T	226	240
PSM	LVIEEAER	4848	sp|P80315|TCPD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2200.8	26.50965	2	957.507247	957.513111	K	S	396	404
PSM	DVNVNFEK	4849	sp|Q9R0Q7|TEBP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2326.12	29.98575	2	963.458647	963.466161	K	S	26	34
PSM	DVNVNFEK	4850	sp|Q9R0Q7|TEBP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2320.12	29.81728	2	963.458647	963.466161	K	S	26	34
PSM	KGNIYSLNEGYAK	4851	sp|Q9QXD6|F16P1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2196.11	26.39972	3	1455.728771	1455.735794	K	D	206	219
PSM	GNRPVILTYHDIGMNHK	4852	sp|Q62433|NDRG1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2302.8	29.31605	4	1964.000494	1964.005050	K	T	54	71
PSM	LTPEEIER	4853	sp|P20029|BIP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2189.18	26.2086	2	985.500447	985.508026	R	M	534	542
PSM	IQSILSSGGK	4854	sp|Q60648|SAP3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2176.16	25.84113	2	988.545647	988.555310	R	R	170	180
PSM	IWHHSFYNELR	4855	sp|P62737|ACTA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2311.13	29.56605	3	1500.719771	1500.726232	K	V	87	98
PSM	VWNLANCK	4856	sp|P68040|RACK1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	7-UNIMOD:4	ms_run[1]:scan=1.1.2341.7	30.39185	2	1003.483047	1003.490936	K	L	176	184
PSM	NIMALSDGGK	4857	sp|P12658|CALB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2312.9	29.59052	2	1004.486847	1004.496081	K	L	237	247
PSM	TYGICGAIR	4858	sp|Q9CQR2|RS21_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	5-UNIMOD:4	ms_run[1]:scan=1.1.2360.10	30.91163	2	1009.494647	1009.501501	K	R	52	61
PSM	NCDEFLVK	4859	sp|P28271|ACOC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	2-UNIMOD:4	ms_run[1]:scan=1.1.2360.11	30.91247	2	1023.464047	1023.469532	R	K	49	57
PSM	GTGIVSAPVPK	4860	sp|P25444|RS2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2280.12	28.7118	2	1024.581847	1024.591696	R	K	201	212
PSM	KPLIVFTPK	4861	tr|E9Q7L0|E9Q7L0_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2370.10	31.1859	2	1041.648847	1041.658653	R	S	857	866
PSM	LDGNQDLIR	4862	sp|P54071|IDHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2245.17	27.74652	2	1042.531247	1042.540723	K	F	385	394
PSM	HIYLLPSGR	4863	sp|P05201|AATC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2349.16	30.6197	2	1054.583647	1054.592364	K	I	379	388
PSM	AVDDGVNTFK	4864	sp|P42932|TCPQ_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2197.14	26.43052	2	1064.513447	1064.513839	R	V	391	401
PSM	HLMESPANEMTPTR	4865	sp|Q9CPY7|AMPL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2236.16	27.49775	3	1612.718171	1612.733762	R	F	201	215
PSM	LGCQVCLTK	4866	sp|P46656|ADX_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	3-UNIMOD:4,6-UNIMOD:4	ms_run[1]:scan=1.1.2189.20	26.21027	2	1077.525047	1077.531087	R	A	154	163
PSM	LTEEITYGR	4867	sp|Q8JZZ0|UD3A2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2294.15	29.09465	2	1080.538847	1080.545139	R	S	95	104
PSM	LRVDPVNFK	4868	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2347.16	30.56433	2	1086.611247	1086.618579	K	L	92	101
PSM	GLSQSALPYR	4869	sp|P62301|RS13_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2378.17	31.41282	2	1090.568047	1090.577108	K	R	10	20
PSM	QVPSQIAVTR	4870	sp|Q6PB66|LPPRC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2199.17	26.48978	2	1097.611647	1097.619307	K	L	1134	1144
PSM	SFVDQYGQR	4871	sp|P12658|CALB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2280.16	28.71513	2	1098.502247	1098.509423	K	D	60	69
PSM	IRADIVENQVMDTR	4872	sp|P10649|GSTM1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1000663, ProteinPilot, ]	14	11-UNIMOD:35	ms_run[1]:scan=1.1.2330.16	30.10217	3	1674.8322706434901	1674.8359187592998	R	M	95	109
PSM	AFAAQEDLEK	4873	sp|P26043|RADI_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2229.15	27.3082	2	1120.531047	1120.540054	K	T	449	459
PSM	LIEQPELASK	4874	sp|P00375|DYR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2306.14	29.43003	2	1126.613047	1126.623390	R	V	100	110
PSM	IQRPPEDSIQPYEK	4875	sp|Q91ZJ5|UGPA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2230.9	27.33178	3	1698.849971	1698.857700	K	I	78	92
PSM	AAGFPTASVCR	4876	sp|Q5U5V2|HYKK_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	10-UNIMOD:4	ms_run[1]:scan=1.1.2318.12	29.76123	2	1135.537447	1135.544428	R	T	93	104
PSM	SQGEEVDFAR	4877	sp|Q9CWS0|DDAH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2181.17	25.98005	2	1136.499447	1136.509816	R	A	33	43
PSM	YLAEVAAGDDK	4878	sp|P63101|1433Z_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2199.18	26.49062	2	1150.542247	1150.550619	R	K	128	139
PSM	PFFHSLCDK	4879	sp|P10639|THIO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	7-UNIMOD:4	ms_run[1]:scan=1.1.2305.13	29.40203	2	1149.525447	1149.527715	K	Y	40	49
PSM	WCALSHLER	4880	sp|Q921I1|TRFE_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	2-UNIMOD:4	ms_run[1]:scan=1.1.2330.4	30.09215	3	1170.550571	1170.560413	K	T	362	371
PSM	HFILDECDK	4881	sp|Q9Z1N5|DX39B_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	7-UNIMOD:4	ms_run[1]:scan=1.1.2269.17	28.40788	2	1175.517047	1175.528109	K	M	192	201
PSM	KNPDSLELIR	4882	sp|Q91YI0|ARLY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2293.14	29.06587	2	1183.646047	1183.656087	K	S	288	298
PSM	MTVQLETQNK	4883	sp|Q9CY64|BIEA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2179.20	25.92695	2	1190.588647	1190.596523	K	S	200	210
PSM	GLETTATYDPK	4884	sp|Q9R0H0|ACOX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2178.18	25.89765	2	1194.568247	1194.576833	R	T	149	160
PSM	ALSTDPASPNLK	4885	sp|P26039|TLN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2220.20	27.06462	2	1212.627247	1212.635017	K	S	1321	1333
PSM	LPAKPEVSSDEDVQYR	4886	sp|Q8BMS1|ECHA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2268.18	28.3811	3	1831.888271	1831.895208	R	V	661	677
PSM	AYGENIGYSEK	4887	sp|P14094|AT1B1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2176.19	25.84363	2	1229.556047	1229.556432	K	D	279	290
PSM	VAGQDGSVVQFK	4888	sp|P61957|SUMO2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2337.14	30.28988	2	1233.627847	1233.635351	K	I	22	34
PSM	YLECSALTQR	4889	sp|P60764|RAC3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	4-UNIMOD:4	ms_run[1]:scan=1.1.2351.17	30.67523	2	1239.580447	1239.591772	K	G	154	164
PSM	RIQYGSFSYK	4890	sp|Q9QXN5|MIOX_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2295.19	29.12617	2	1247.623047	1247.629872	K	K	60	70
PSM	EVNVSPCPTDPCQLHK	4891	sp|Q9Z0J0|NPC2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	7-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.2294.19	29.098	3	1879.850471	1879.855668	K	G	36	52
PSM	FPGQLNADLRK	4892	sp|A2AQ07|TBB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2323.5	29.8955	3	1257.673571	1257.682970	R	L	242	253
PSM	FPGQLNADLRK	4893	sp|A2AQ07|TBB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2329.8	30.06707	3	1257.673571	1257.682970	R	L	242	253
PSM	AVANQTSATFLR	4894	sp|P62192|PRS4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2372.17	31.2465	2	1277.662047	1277.672800	K	V	238	250
PSM	EDVFVHQTAIK	4895	sp|P62960|YBOX1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2246.21	27.77798	2	1285.659847	1285.666652	K	K	80	91
PSM	VNADEVGGEALGR	4896	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2371.18	31.2199	2	1285.621247	1285.626243	K	L	19	32
PSM	VPGAWTEACGQK	4897	sp|Q8R0Y6|AL1L1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	9-UNIMOD:4	ms_run[1]:scan=1.1.2240.18	27.6088	2	1302.597047	1302.602671	K	L	230	242
PSM	EDQTEYLEER	4898	sp|P07901|HS90A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2278.19	28.66197	2	1310.554047	1310.562640	K	R	192	202
PSM	LHGSGDLEAWEK	4899	sp|Q9CPY7|AMPL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2302.4	29.31272	3	1340.628371	1340.636080	K	G	177	189
PSM	GDGPVQGTIHFEQK	4900	sp|P08228|SODC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2281.8	28.73542	3	1511.726771	1511.736856	K	A	11	25
PSM	QFLECAQNQSDVK	4901	tr|B2RPU8|B2RPU8_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	5-UNIMOD:4	ms_run[1]:scan=1.1.2292.21	29.04398	2	1565.710447	1565.714407	K	L	122	135
PSM	NQQEGVCPEGSIDNSPVK	4902	sp|Q921I1|TRFE_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	7-UNIMOD:4	ms_run[1]:scan=1.1.2366.21	31.08527	2	1956.878447	1956.884720	R	W	344	362
PSM	TVVTGIEMFHK	4903	sp|Q8BFR5|EFTU_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2601.2	37.58492	3	1260.642071	1260.653644	R	S	301	312
PSM	VLLPGLQK	4904	sp|P97807|FUMH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2640.4	38.66875	2	866.551047	866.558939	K	L	203	211
PSM	TSVPFLGR	4905	sp|Q99LB7|SARDH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2679.4	39.7562	2	875.481447	875.486502	K	E	804	812
PSM	IIGIDINK	4906	sp|P28474|ADHX_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2606.7	37.72933	2	884.524447	884.533118	R	D	219	227
PSM	SFAVGMFK	4907	sp|P50544|ACADV_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2781.3	42.60895	2	885.433247	885.441860	K	G	73	81
PSM	HLEINPDHPIVETLR	4908	sp|P11499|HS90B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14		ms_run[1]:scan=1.1.2603.4	37.64215	4	1781.9364	1781.9419	K	Q	625	640
PSM	VFDMLNR	4909	sp|P10630|IF4A2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2627.3	38.30165	2	893.435447	893.442923	R	R	163	170
PSM	NFDEILR	4910	sp|O08709|PRDX6_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2659.4	39.19767	2	905.451647	905.460681	R	V	156	163
PSM	ELHDVDLAEVKPLVEK	4911	sp|Q62433|NDRG1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2740.2	41.46702	4	1832.976894	1832.988380	R	G	4	20
PSM	YIPAAIFK	4912	sp|Q91WR5|AK1CL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2789.3	42.8379	2	921.524047	921.532390	R	G	305	313
PSM	LLEVIPSR	4913	sp|Q9DBM2|ECHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2644.5	38.7833	2	925.551847	925.559667	R	Y	437	445
PSM	AAFTMFSR	4914	sp|P16675|PPGB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2696.7	40.22578	2	929.437647	929.442923	R	F	460	468
PSM	LRDEFDIVGDVR	4915	sp|Q3UEG6|AGT2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2786.5	42.75382	3	1432.722671	1432.731043	K	G	420	432
PSM	LYSEFLGK	4916	sp|O35660|GSTM6_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2635.6	38.52833	2	955.494647	955.501484	K	Q	137	145
PSM	HQTLQGVAFPISR	4917	sp|Q91YR1|TWF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2609.5	37.8104	3	1452.774071	1452.783747	K	D	172	185
PSM	NILGGTVFR	4918	sp|O88844|IDHC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2784.3	42.69488	2	975.542847	975.550165	R	E	101	110
PSM	EMVTFLDK	4919	sp|P34914|HYES_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2738.2	41.41043	2	981.476447	981.484119	K	L	314	322
PSM	AVDSLVPIGR	4920	sp|Q03265|ATPA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2691.6	40.08425	2	1025.578047	1025.586945	K	G	195	205
PSM	AVDSLVPIGR	4921	sp|Q03265|ATPA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2697.5	40.2526	2	1025.578047	1025.586945	K	G	195	205
PSM	ATIGADFLTK	4922	sp|P51150|RAB7A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2755.7	41.88255	2	1035.553847	1035.560061	K	E	39	49
PSM	MFASFPTTK	4923	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	1-UNIMOD:35	ms_run[1]:scan=1.1.2608.6	37.78415	2	1044.486847	1044.495018	R	T	33	42
PSM	IQFLSMSTK	4924	sp|Q99K67|AASS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2781.10	42.6148	2	1053.545447	1053.552867	R	K	472	481
PSM	IQFLSMSTK	4925	sp|Q99K67|AASS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2787.8	42.78503	2	1053.545447	1053.552867	R	K	472	481
PSM	RDDGSWEVIEGYR	4926	sp|P26443|DHE3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2775.9	42.4449	3	1580.712071	1580.721935	R	A	124	137
PSM	ILLLGAGESGK	4927	sp|P27600|GNA12_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2689.7	40.02997	2	1056.607847	1056.617910	K	S	58	69
PSM	ARPFPDGLAEDIDKGEVSAR	4928	sp|P58252|EF2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14		ms_run[1]:scan=1.1.2740.9	41.47285	4	2142.0668	2142.0700	K	Q	606	626
PSM	RGTLQSYFD	4929	sp|Q9D964|GATM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2623.11	38.19615	2	1085.514447	1085.514174	R	-	415	424
PSM	LLADPTGAFGK	4930	sp|P99029|PRDX5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1000663, ProteinPilot, ]	14		ms_run[1]:scan=1.1.2719.10	40.88738	2	1088.5768470956602	1088.5866099165999	R	A	145	156
PSM	EIVPVLVSSR	4931	tr|Q80X81|Q80X81_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2790.8	42.87038	2	1097.635047	1097.644459	K	K	201	211
PSM	HEEMAQAFEEWNK	4932	sp|Q9DCD0|6PGD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2677.10	39.70443	3	1647.701471	1647.698756	R	T	213	226
PSM	LLDEAIQAVK	4933	sp|Q9EQH3|VPS35_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2713.14	40.71802	2	1098.618847	1098.628475	K	V	15	25
PSM	NPGAPFQIIR	4934	sp|Q60866|PTER_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2777.9	42.50063	2	1111.605447	1111.613828	R	I	205	215
PSM	MLLDGEIEAK	4935	sp|Q99K67|AASS_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2701.8	40.36983	2	1117.558447	1117.568911	K	G	884	894
PSM	AVITFNQGLR	4936	sp|Q99NB1|ACS2L_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2649.9	38.9283	2	1117.614647	1117.624393	K	G	208	218
PSM	FPGQLNADLR	4937	sp|A2AQ07|TBB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2642.10	38.73062	2	1130.582247	1129.588007	R	K	242	252
PSM	KWLPELVDR	4938	sp|Q9EQ20|MMSA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2667.8	39.4192	2	1154.634847	1154.644794	K	A	331	340
PSM	DRPFFTGLVK	4939	sp|P15532|NDKA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2792.2	42.9216	3	1178.634071	1178.644794	K	Y	57	67
PSM	IALTDNSLIAR	4940	sp|P14148|RL7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2794.11	42.98522	2	1185.660047	1185.671737	R	S	189	200
PSM	LSILYPATTGR	4941	sp|O08709|PRDX6_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2783.11	42.67299	2	1190.655447	1190.665923	K	N	145	156
PSM	WGVISASVDDR	4942	sp|P97494|GSH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2723.11	41.0032	2	1203.577447	1203.588401	R	T	297	308
PSM	LQSSNIFTVAK	4943	sp|O35643|AP1B1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2620.14	38.1151	2	1206.654247	1206.660838	K	R	874	885
PSM	NIDNPAIADIYTEHAHQVVVAK	4944	sp|O88342|WDR1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2789.13	42.84625	4	2417.224094	2417.233923	R	Y	44	66
PSM	YFVEAGAMAVR	4945	sp|P11983|TCPA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2711.10	40.65697	2	1212.594647	1212.596129	K	R	299	310
PSM	APILIATDVASR	4946	sp|Q501J6|DDX17_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2762.14	42.08487	2	1225.693447	1225.703037	K	G	390	402
PSM	EVDIGIPDATGR	4947	sp|Q01853|TERA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2767.14	42.22437	2	1241.616247	1241.625181	R	L	366	378
PSM	LEVDPNIQAVR	4948	sp|P11679|K2C8_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2640.17	38.67958	2	1252.667647	1252.677551	K	T	84	95
PSM	IVEIPFNSTNK	4949	sp|Q8VDN2|AT1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2697.10	40.25677	2	1260.659847	1260.671403	K	Y	477	488
PSM	TIAMDGTEGLVR	4950	sp|P56480|ATPB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2643.14	38.76227	2	1261.625247	1261.633637	R	G	110	122
PSM	TVLVSEGIVTPR	4951	sp|A2ARV4|LRP2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2717.14	40.83348	2	1269.718447	1269.729252	R	G	2227	2239
PSM	DHADVSNQLYACYAIGK	4952	sp|P62814|VATB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	12-UNIMOD:4	ms_run[1]:scan=1.1.2783.16	42.67715	3	1923.867071	1923.878512	K	D	414	431
PSM	DILVTSEDGITK	4953	sp|Q78JN3|ECI3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2721.15	40.94915	2	1289.659447	1289.671462	K	I	63	75
PSM	VQQTVQDLFGR	4954	sp|P38647|GRP75_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2784.15	42.70488	2	1289.663047	1289.672800	K	A	395	406
PSM	DFTPAAQAAFQK	4955	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2676.14	39.67927	2	1293.628647	1293.635351	K	V	122	134
PSM	IFYNQAIMSSK	4956	sp|Q3ULD5|MCCB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2644.15	38.79165	2	1300.641047	1300.648559	R	N	194	205
PSM	VAPEEHPVLLTEAPLNPK	4957	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2764.12	42.13897	3	1953.063971	1953.057128	R	A	96	114
PSM	SLLPGCQSVISR	4958	sp|Q9DCM0|ETHE1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	6-UNIMOD:4	ms_run[1]:scan=1.1.2672.16	39.56662	2	1315.684247	1315.691821	R	L	93	105
PSM	VGVGTSFGLPQTR	4959	sp|Q9ESE1|LRBA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2774.18	42.42463	2	1317.695447	1317.704100	R	R	2176	2189
PSM	HACVPVDFEEVHVSSNADEEDIR	4960	sp|P70404|IDHG1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1000663, ProteinPilot, ]	14	3-UNIMOD:4	ms_run[1]:scan=1.1.2747.16	41.67278	4	2653.1748941913206	2653.1714588423097	R	N	79	102
PSM	DVTADFYGQSPK	4961	sp|Q9ET22|DPP2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2647.17	38.8788	2	1326.603047	1326.609196	R	C	214	226
PSM	LNISFPATGCQK	4962	sp|P62754|RS6_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	10-UNIMOD:4	ms_run[1]:scan=1.1.2742.16	41.53505	2	1334.660047	1334.665272	K	L	3	15
PSM	DYEEIGPSICR	4963	sp|Q99JY9|ARP3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	10-UNIMOD:4	ms_run[1]:scan=1.1.2665.20	39.37395	2	1337.584447	1337.592166	K	H	399	410
PSM	LTSEDLSDDAFK	4964	sp|Q9DBT9|M2GD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2663.14	39.3141	2	1339.606847	1339.614341	K	F	637	649
PSM	GTDFQLNQLEGK	4965	sp|Q921I1|TRFE_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2741.14	41.50518	2	1348.654647	1348.662294	K	K	123	135
PSM	AYSTDVCVPISR	4966	sp|Q7TNG8|LDHD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	7-UNIMOD:4	ms_run[1]:scan=1.1.2598.19	37.51607	2	1366.647647	1366.655101	K	L	363	375
PSM	SLVESVPTPSMNK	4967	sp|Q91VM9|IPYR2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2631.16	38.42387	2	1387.690847	1387.701716	R	E	304	317
PSM	ISDEDWDIIHR	4968	sp|P51660|DHB4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2760.4	42.02052	3	1397.645171	1397.657543	R	V	111	122
PSM	HVMDVVDEELSK	4969	sp|Q8CGK3|LONM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2630.20	38.3994	2	1399.659247	1399.665331	K	L	422	434
PSM	GALYCELCYEK	4970	sp|Q8CI51|PDLI5_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	5-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.2674.20	39.627	2	1404.603047	1404.605374	K	F	458	469
PSM	EGRPSGEAFVELESEDEVK	4971	sp|O35737|HNRH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2720.16	40.92105	3	2105.973071	2105.975309	R	L	50	69
PSM	ETTIQGLDGLSER	4972	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2758.17	41.97483	2	1417.698047	1417.704888	K	C	122	135
PSM	ARPFPDGLAEDIDKGEVSAR	4973	sp|P58252|EF2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14		ms_run[1]:scan=1.1.2741.18	41.50853	3	2142.0673	2142.0700	K	Q	606	626
PSM	TINEVENQILTR	4974	sp|P57780|ACTN4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2764.19	42.1448	2	1428.746447	1428.757257	R	D	747	759
PSM	TINEVENQILTR	4975	sp|P57780|ACTN4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2766.18	42.19983	2	1428.746447	1428.757257	R	D	747	759
PSM	LLGQVSAEDLAAEK	4976	sp|Q9CY64|BIEA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2733.18	41.28277	2	1442.752847	1442.761674	K	K	261	275
PSM	LVVPATQCGSLIGK	4977	sp|P60335|PCBP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	8-UNIMOD:4	ms_run[1]:scan=1.1.2745.17	41.6192	2	1441.791447	1441.796286	R	G	102	116
PSM	VQPIYGGTNEIMK	4978	sp|P51174|ACADL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2624.18	38.22997	2	1448.725247	1448.733351	R	E	407	420
PSM	HWLFGHALEIQK	4979	sp|Q64462|CP4B1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2734.8	41.3022	3	1477.773971	1477.783019	K	T	52	64
PSM	YGYTHLSAGELLR	4980	sp|Q9DBP5|KCY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2675.7	39.6449	3	1478.743871	1478.751778	K	D	27	40
PSM	ECYQTWAQLER	4981	sp|Q9D826|SOX_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	2-UNIMOD:4	ms_run[1]:scan=1.1.2757.18	41.94753	2	1482.646247	1482.656163	K	E	70	81
PSM	ASSTANLIFEDCR	4982	sp|Q07417|ACADS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	12-UNIMOD:4	ms_run[1]:scan=1.1.2716.20	40.80973	2	1482.668847	1482.677293	R	I	235	248
PSM	IFVGGLNPEATEEK	4983	sp|Q99020|ROAA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2752.20	41.81142	2	1502.752247	1502.761674	K	I	161	175
PSM	ASAELALGENNEVLK	4984	sp|P05202|AATM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2737.20	41.3968	2	1556.796247	1556.804602	K	S	108	123
PSM	TGTVLIPGTTQLTQK	4985	sp|Q3UNX5|ACSM3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2781.18	42.62147	2	1556.866247	1556.877373	R	D	137	152
PSM	TPIAAGHPSMNLLLR	4986	sp|Q9D6R2|IDH3A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2768.6	42.24567	3	1589.862071	1589.871182	K	K	101	116
PSM	MDATANDVPSPYEVK	4987	sp|P27773|PDIA3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2630.21	38.40023	2	1635.742047	1635.745038	K	G	434	449
PSM	HEEMAQAFEEWNK	4988	sp|Q9DCD0|6PGD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2683.5	39.86737	3	1647.701471	1647.698756	R	T	213	226
PSM	NQVAMNPTNTVFDAK	4989	sp|P63017|HSP7C_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2689.20	40.04082	2	1648.781447	1648.787906	K	R	57	72
PSM	LIGPNCPGVINPGECK	4990	sp|Q9WUM5|SUCA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	6-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=1.1.2644.21	38.79665	2	1723.834047	1723.838562	R	I	167	183
PSM	EAVCIVLSDDTCSDEK	4991	sp|Q01853|TERA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	4-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.2740.20	41.48203	2	1839.786447	1839.786645	R	I	66	82
PSM	GEVITTYCPANNEPIAR	4992	sp|Q9DBF1|AL7A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	8-UNIMOD:4	ms_run[1]:scan=1.1.2656.3	39.1186	3	1903.906271	1903.909812	R	V	63	80
PSM	HACVPVDFEEVHVSSNADEEDIR	4993	sp|P70404|IDHG1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	3-UNIMOD:4	ms_run[1]:scan=1.1.2741.20	41.5102	3	2653.164671	2653.171459	R	N	79	102
PSM	ALLFVPR	4994	sp|P07901|HS90A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2809.2	43.39877	2	814.498647	814.506509	R	R	340	347
PSM	EGWLNFK	4995	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2910.2	46.2572	2	892.436847	892.444303	R	A	189	196
PSM	SFGLPSIGR	4996	sp|Q91ZA3|PCCA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2865.2	44.9924	2	932.499647	932.507966	K	L	404	413
PSM	GIFPVLCK	4997	sp|P52480|KPYM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	7-UNIMOD:4	ms_run[1]:scan=1.1.2941.2	47.13313	2	932.507047	932.515360	R	D	468	476
PSM	GIAYIEFK	4998	sp|P09405|NUCL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2797.4	43.06358	2	939.499247	939.506569	K	S	432	440
PSM	SNVDFLLR	4999	sp|Q99MR8|MCCA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2853.4	44.6499	2	962.509647	962.518531	R	L	461	469
PSM	YNLGLDLR	5000	sp|P26443|DHE3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2865.4	44.99408	2	962.510447	962.518531	K	T	528	536
PSM	VFFPLCGK	5001	sp|O55060|TPMT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	6-UNIMOD:4	ms_run[1]:scan=1.1.2895.2	45.83425	2	966.490247	966.499710	R	A	60	68
PSM	LACGVIGIAQ	5002	sp|P08228|SODC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	3-UNIMOD:4	ms_run[1]:scan=1.1.2960.2	47.65452	2	1000.527647	1000.537552	R	-	145	155
PSM	LNVLANVIR	5003	tr|E9Q7L0|E9Q7L0_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2922.4	46.59663	2	1010.616447	1010.623664	R	K	321	330
PSM	LVILEGELK	5004	sp|Q6IRU2|TPM4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2842.7	44.34215	2	1012.607647	1012.616848	K	R	133	142
PSM	NTVPWFPR	5005	sp|P16331|PH4H_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2887.4	45.61263	2	1015.514247	1015.523950	K	T	116	124
PSM	EAFQLFDR	5006	sp|Q60605|MYL6_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2915.6	46.39973	2	1024.490047	1024.497795	K	T	14	22
PSM	QFYPDLIR	5007	sp|P17563|SBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2905.5	46.11843	2	1050.542047	1050.549831	K	E	412	420
PSM	QFYPDLIR	5008	sp|P17563|SBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2899.4	45.94767	2	1050.542047	1050.549831	K	E	412	420
PSM	SPLLEIVER	5009	sp|Q91YR1|TWF1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2927.6	46.74085	2	1054.594647	1054.602260	K	Q	277	286
PSM	FVDVSQVIR	5010	sp|Q60928|GGT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2866.5	45.02357	2	1061.576447	1061.586945	K	N	334	343
PSM	ALQFLEQVK	5011	sp|P80317|TCPZ_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2832.8	44.06113	2	1074.598047	1074.607346	K	V	130	139
PSM	ALTLIAGSPLK	5012	sp|Q6ZQ38|CAND1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2895.5	45.83675	2	1082.661447	1082.669946	K	I	631	642
PSM	LVINGKPITIFQER	5013	tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2918.5	46.48317	3	1626.941471	1626.945727	K	D	65	79
PSM	RDPLHEELLGQGCVFQER	5014	sp|Q99LB7|SARDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	13-UNIMOD:4	ms_run[1]:scan=1.1.2798.7	43.09423	4	2182.052894	2182.058936	R	Q	486	504
PSM	FGVLFQDDR	5015	sp|Q4KML4|ABRAL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2895.6	45.83758	2	1095.526647	1095.534909	K	C	30	39
PSM	TDVAAPFGGFK	5016	sp|Q8R0Y6|AL1L1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2823.9	43.80502	2	1108.547647	1108.555310	K	Q	866	877
PSM	LNSLMSLVNK	5017	sp|Q9D8W5|PSD12_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2906.8	46.14907	2	1117.612247	1117.616530	K	T	432	442
PSM	LGISSLQEFK	5018	sp|Q62393|TPD52_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2899.7	45.95018	2	1120.601847	1120.612825	K	Q	110	120
PSM	ILGLLDTHLK	5019	sp|Q9D8N0|EF1G_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2810.10	43.43363	2	1121.671447	1121.680845	R	T	138	148
PSM	IREIADGLCLEVEGK	5020	sp|P63028|TCTP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	9-UNIMOD:4	ms_run[1]:scan=1.1.2796.9	43.03963	3	1700.872271	1700.876721	K	M	20	35
PSM	EQLAIAEFAR	5021	sp|P11983|TCPA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2890.6	45.69807	2	1146.593647	1146.603323	R	S	434	444
PSM	IFEGANDILR	5022	sp|P50544|ACADV_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2843.11	44.37303	2	1146.594647	1146.603323	R	L	461	471
PSM	DIWPTRDEIQAVER	5023	sp|P28271|ACOC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2972.8	47.9973	3	1726.860371	1726.863848	K	Q	588	602
PSM	GTDTVAGIALIK	5024	sp|Q99KQ4|NAMPT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2875.8	45.28277	2	1157.655047	1157.665589	K	K	217	229
PSM	EKVDLLFLGK	5025	sp|Q9DCW4|ETFB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2909.2	46.22897	3	1160.671271	1160.680511	K	Q	115	125
PSM	DVTGAEALLER	5026	sp|P16546|SPTN1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2897.8	45.89452	2	1172.597047	1172.603717	K	H	1370	1381
PSM	SPSAEDVAGVLESYHAK	5027	sp|Q8QZS1|HIBCH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2911.6	46.28845	3	1758.833771	1758.842444	K	S	233	250
PSM	ALATQLPVIPR	5028	sp|Q3TC72|FAHD2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2899.9	45.95185	2	1177.708647	1177.718293	R	S	83	94
PSM	LVPFDHAESTYGLYR	5029	sp|Q9CQ60|6PGL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2869.10	45.11395	3	1766.855471	1766.862785	R	T	82	97
PSM	QIFSAEFEVK	5030	sp|P01027|CO3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2891.8	45.7276	2	1196.596247	1196.607740	K	E	217	227
PSM	FELTGIPPAPR	5031	sp|P63017|HSP7C_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2981.9	48.24733	2	1196.645447	1196.655359	K	G	459	470
PSM	SSGLPITSAVDLEDAAKK	5032	sp|Q9Z2I8|SUCB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2854.9	44.68283	3	1800.935771	1800.946909	K	A	408	426
PSM	IINEPTAAAIAYGLDKR	5033	sp|P20029|BIP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2904.10	46.09455	3	1814.981171	1814.989048	R	E	199	216
PSM	IAEFAFEYAR	5034	sp|Q9D6R2|IDH3A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3000.10	48.76922	2	1215.586047	1215.592424	R	N	179	189
PSM	SIYGEKFEDENFILK	5035	sp|P17742|PPIA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2999.9	48.73983	3	1830.897671	1830.903981	R	H	77	92
PSM	DGLAFNALIHR	5036	tr|E9PX29|E9PX29_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2953.12	47.46625	2	1225.653047	1225.656755	R	H	212	223
PSM	TFEVCDLPVR	5037	sp|O55029|COPB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	5-UNIMOD:4	ms_run[1]:scan=1.1.2892.11	45.75813	2	1234.595247	1234.601609	K	A	52	62
PSM	EVFEDAMEIR	5038	sp|P09405|NUCL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2889.13	45.67605	2	1237.558047	1237.564889	K	L	413	423
PSM	IYSTAFTPMYHAVTTR	5039	sp|P47791|GSHR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2812.13	43.49292	3	1857.904271	1857.908355	K	K	420	436
PSM	DAGQISGLNVLR	5040	sp|P38647|GRP75_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2946.9	47.27362	2	1241.663247	1241.672800	K	V	207	219
PSM	ADLINNLGTIAK	5041	sp|P07901|HS90A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2920.11	46.5452	2	1241.692047	1241.697952	K	S	101	113
PSM	FADGDVDAVLSR	5042	sp|Q8R0Y6|AL1L1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2828.15	43.95287	2	1263.619247	1263.609531	R	A	815	827
PSM	SVSIQYLEAVR	5043	sp|Q99JW2|ACY1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2914.10	46.37525	2	1263.673647	1263.682302	K	R	116	127
PSM	IDVVVNNAGILR	5044	sp|P51660|DHB4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2895.12	45.8426	2	1281.733047	1281.740485	R	D	93	105
PSM	LCLTGQWEAAQELQHR	5045	sp|Q9DCU9|HOGA1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	2-UNIMOD:4	ms_run[1]:scan=1.1.2881.12	45.45257	3	1938.931271	1938.937030	R	L	250	266
PSM	HSLMPMLETLK	5046	sp|Q00623|APOA1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2861.13	44.88693	2	1298.660247	1298.672665	R	T	237	248
PSM	TLLENTAITIGR	5047	sp|Q8BFY9|TNPO1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2909.12	46.23732	2	1300.722447	1300.735065	K	L	774	786
PSM	EMNLSETAFIR	5048	sp|Q9DCG6|PBLD1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2956.15	47.552	2	1309.628247	1309.633637	R	K	41	52
PSM	NELESYAYSLK	5049	sp|P20029|BIP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2806.13	43.3248	2	1315.623047	1315.629597	R	N	564	575
PSM	ILAFPCNQFGR	5050	sp|O70325|GPX4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	6-UNIMOD:4	ms_run[1]:scan=1.1.2968.15	47.8935	2	1321.651847	1321.660127	R	Q	97	108
PSM	QEGQNYGFFLR	5051	sp|Q9JIL4|NHRF3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2958.17	47.6101	2	1357.633647	1357.641499	K	I	15	26
PSM	GYISPYFINTSK	5052	sp|P63038|CH60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2937.18	47.03812	2	1388.691647	1388.697617	R	G	222	234
PSM	HLWDYTFGPEK	5053	sp|P61161|ARP2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2888.16	45.65065	2	1391.648247	1391.651001	K	L	87	98
PSM	ILVLNTPNNPLGK	5054	sp|Q8BTY1|KAT1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2957.14	47.5793	2	1391.805047	1391.813650	K	V	177	190
PSM	DFTPVCTTELGR	5055	sp|O08709|PRDX6_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	6-UNIMOD:4	ms_run[1]:scan=1.1.2814.16	43.55302	2	1394.643247	1394.650015	R	A	42	54
PSM	FAVYLPPQAESGK	5056	sp|Q9R0P3|ESTD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2875.14	45.28777	2	1405.716247	1405.724166	R	C	32	45
PSM	FSASQFWDDCR	5057	sp|O35488|S27A2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	10-UNIMOD:4	ms_run[1]:scan=1.1.3000.16	48.77422	2	1417.568047	1417.572099	K	K	292	303
PSM	EATDPRPYEAENAIESWR	5058	sp|P47754|CAZA2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2861.18	44.8911	3	2132.972171	2132.976312	K	T	104	122
PSM	FVTVQTISGTGALR	5059	sp|P05202|AATM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2842.5	44.34048	3	1448.786171	1448.798728	R	V	126	140
PSM	VAQYMADVLEDSK	5060	sp|Q9Z1G3|VATC1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2862.19	44.9206	2	1467.680047	1467.691546	K	D	72	85
PSM	GSTSPDLLMHQGPPDTAEIIK	5061	sp|Q9CQX8|RT36_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2925.17	46.69297	3	2206.088171	2206.093984	K	S	57	78
PSM	MLGQMTDQVADLR	5062	sp|Q64727|VINC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2864.19	44.978	2	1476.696447	1476.706484	K	A	327	340
PSM	GLAITFVSDENDAK	5063	sp|Q9Z1N5|DX39B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2912.17	46.32552	2	1478.721247	1478.725289	K	I	385	399
PSM	LNTGAWGCCPFAK	5064	sp|P28798|GRN_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	8-UNIMOD:4,9-UNIMOD:4	ms_run[1]:scan=1.1.2820.18	43.72643	2	1480.654247	1480.659141	R	A	297	310
PSM	GYLGPEQLPDCLK	5065	sp|P08249|MDHM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	11-UNIMOD:4	ms_run[1]:scan=1.1.2968.18	47.896	2	1488.723447	1488.728266	K	G	79	92
PSM	VAGHPDVVINNAAGNFISPSER	5066	sp|Q9CQ62|DECR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2809.20	43.41378	3	2263.129271	2263.134544	K	L	134	156
PSM	VTWDSTFCAVNPK	5067	sp|Q9WUM3|COR1B_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	8-UNIMOD:4	ms_run[1]:scan=1.1.2921.19	46.58058	2	1523.698047	1523.707865	R	F	34	47
PSM	DIFAMDDKSENEPIENEAAR	5068	sp|Q9Z2I8|SUCB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2837.19	44.2131	3	2293.014071	2293.016856	K	Y	273	293
PSM	GDLNDCFIPCTPK	5069	sp|Q922D8|C1TC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	6-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.2845.18	44.43448	2	1535.667647	1535.674850	R	G	138	151
PSM	FAPPEAPEPWSGVR	5070	tr|E9PV38|E9PV38_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2989.10	48.46775	2	1538.742047	1538.751778	R	D	75	89
PSM	VLEQLTGQTPVFSK	5071	sp|Q9CXW4|RL11_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2936.19	47.0102	2	1545.832647	1545.840259	K	A	39	53
PSM	TVGIVGNQPNVASGCLDINSSVK	5072	sp|Q99MN9|PCCB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	15-UNIMOD:4	ms_run[1]:scan=1.1.2977.14	48.13892	3	2328.162971	2328.174360	R	G	353	376
PSM	EAVLIDPVLETAHR	5073	sp|Q9DCM0|ETHE1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2870.4	45.13768	3	1561.839671	1561.846407	R	D	47	61
PSM	YVTLIYTNYENGK	5074	sp|P19157|GSTP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2862.20	44.92143	2	1576.773847	1576.777324	K	N	104	117
PSM	AITIAGVPQSVTECVK	5075	sp|P60335|PCBP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	14-UNIMOD:4	ms_run[1]:scan=1.1.2952.18	47.44383	2	1671.877247	1671.886557	R	Q	145	161
PSM	AIVQVFEGTSGIDSQK	5076	tr|Q91YH6|Q91YH6_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2908.20	46.21565	2	1677.851847	1677.857366	K	T	88	104
PSM	APLQELSPTEEEALR	5077	sp|Q9DCU9|HOGA1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2814.21	43.55718	2	1681.843847	1681.852280	R	L	298	313
PSM	AFTTWTANAGIEECR	5078	sp|Q9R0H0|ACOX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	14-UNIMOD:4	ms_run[1]:scan=1.1.2863.21	44.95098	2	1725.772647	1725.778070	K	M	379	394
PSM	GANAVGYTNYPDNVVFK	5079	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2907.19	46.18638	2	1827.873447	1827.879164	R	F	645	662
PSM	EAYPALRPEANPLTWK	5080	sp|Q99K67|AASS_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2972.9	47.99813	3	1854.958271	1854.962834	R	Q	746	762
PSM	AAVDAGFVPNDMQVGQTGK	5081	sp|Q99LC5|ETFA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2869.21	45.12313	2	1903.900647	1903.909812	R	I	250	269
PSM	YPLEEFTTDNQQEEAR	5082	sp|P61922|GABT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2802.21	43.21982	2	1968.865247	1968.870115	K	C	253	269
PSM	CIGAIAMTEPGAGSDLQGVR	5083	sp|P51174|ACADL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	1-UNIMOD:4	ms_run[1]:scan=1.1.2966.21	47.84137	2	2001.953447	2001.961196	K	T	166	186
PSM	GGAEVQIFAPDVPQMHVIDHTK	5084	sp|Q9D172|GAL3A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2992.16	48.54965	3	2388.188771	2388.189616	R	G	71	93
PSM	SYDVPPPPMEPDHPFYSNISK	5085	sp|Q9DBJ1|PGAM1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2977.16	48.14058	3	2416.100771	2416.104549	R	D	118	139
PSM	CNVSSLHTSHCLASGEVMVSTLGDLQGNGK	5086	sp|P17563|SBP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	1-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=1.1.2895.18	45.8476	4	3157.452094	3157.459068	K	G	131	161
PSM	DLQILAEFHEK	5087	sp|P07759|SPA3K_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3025.2	49.44455	3	1341.682871	1341.692866	K	T	145	156
PSM	LGFMSAFVK	5088	sp|Q9D2G2|ODO2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3144.3	52.80748	2	998.516447	998.525924	K	A	279	288
PSM	DSIMNYFK	5089	sp|Q9DC50|OCTC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3123.3	52.20815	2	1016.454847	1016.463718	R	T	174	182
PSM	VSVNDFIIR	5090	sp|Q8BKZ9|ODPX_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3052.4	50.20973	2	1061.579047	1061.586945	K	A	326	335
PSM	ILILGLDGAGK	5091	sp|P61211|ARL1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3075.5	50.86265	2	1068.646047	1068.654296	R	T	20	31
PSM	TCLLIVFSK	5092	sp|P62746|RHOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	2-UNIMOD:4	ms_run[1]:scan=1.1.3166.3	53.42612	2	1079.595847	1079.604903	K	D	19	28
PSM	STTTIGLVQALGAHLR	5093	sp|Q922D8|C1TC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3167.3	53.4538	3	1636.915871	1636.926054	K	Q	387	403
PSM	FVNLFPEVK	5094	sp|P17427|AP2A2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3152.6	53.04152	2	1091.593847	1091.601532	K	A	547	556
PSM	VINEPTAAALAYGLDK	5095	sp|P38647|GRP75_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3075.6	50.86348	3	1644.865571	1644.872287	R	S	219	235
PSM	VFDAIMNFR	5096	sp|P58252|EF2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3174.5	53.65097	2	1111.539247	1111.548451	K	K	300	309
PSM	DLETPIIVVK	5097	sp|Q62468|VILI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3100.7	51.57141	2	1125.657647	1125.664526	R	Q	690	700
PSM	SPAHGISLFLVENGMK	5098	sp|P51174|ACADL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3022.7	49.36765	3	1698.867071	1698.876327	R	G	225	241
PSM	SVAGEIVLITGAGHGIGR	5099	sp|Q9EQ06|DHB11_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3084.7	51.12354	3	1705.938971	1705.947518	K	L	33	51
PSM	QGEIFLLPAR	5100	sp|Q78JT3|3HAO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3051.4	50.1822	2	1142.637447	1142.644794	R	V	79	89
PSM	CVLIFGVPSR	5101	sp|P10518|HEM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	1-UNIMOD:4	ms_run[1]:scan=1.1.3092.6	51.35035	2	1146.613047	1146.621950	R	V	75	85
PSM	EQIDIFEGIK	5102	sp|Q9Z2I8|SUCB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3140.8	52.69673	2	1190.609247	1190.618304	K	D	192	202
PSM	YIIWSPVCR	5103	sp|P11352|GPX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	8-UNIMOD:4	ms_run[1]:scan=1.1.3044.12	49.98993	2	1192.599647	1192.606300	K	N	147	156
PSM	DLSSVQTLLTK	5104	sp|P16546|SPTN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3157.7	53.18555	2	1203.662647	1203.671068	R	Q	2007	2018
PSM	VLAEHGVAALFTAPTAIR	5105	sp|Q14DH7|ACSS3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3100.9	51.57308	3	1836.009971	1836.025768	R	A	376	394
PSM	ICDDELILIK	5106	sp|P11983|TCPA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	2-UNIMOD:4	ms_run[1]:scan=1.1.3053.11	50.24303	2	1230.643447	1230.652976	R	N	356	366
PSM	IHLFDIDVPGK	5107	sp|Q9JHW2|NIT2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3073.2	50.8038	3	1252.673471	1252.681573	K	I	113	124
PSM	NISAMGLYWGR	5108	sp|Q3UNZ8|QORL2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3148.9	52.9279	2	1266.611047	1266.617927	K	Y	281	292
PSM	IGPITPLQFYK	5109	sp|Q8R016|BLMH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3205.9	54.5251	2	1275.715247	1275.722710	K	E	245	256
PSM	IVLLDSSLEYK	5110	sp|P80318|TCPG_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3052.11	50.21558	2	1278.698047	1278.707119	R	K	238	249
PSM	RFGPYYTEPVIAGLDPK	5111	sp|Q9R1P1|PSB3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3039.12	49.84628	3	1921.981871	1921.993799	K	T	99	116
PSM	GVVQDLQQAISK	5112	sp|P57776|EF1D_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3041.8	49.90032	2	1284.693647	1284.703765	R	L	96	108
PSM	TLDSWRDEFLIQASPR	5113	sp|P51150|RAB7A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3202.11	54.44092	3	1932.958271	1932.969376	K	D	98	114
PSM	MAENLGFLGSLK	5114	sp|Q9Z2I8|SUCB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	1-UNIMOD:35	ms_run[1]:scan=1.1.3055.8	50.29522	2	1294.651047	1294.659124	R	N	208	220
PSM	YAALYQPLFDK	5115	sp|Q78ZA7|NP1L4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3086.13	51.18582	2	1327.669447	1327.681239	K	R	95	106
PSM	LLSPGSVMLVSAR	5116	sp|Q64105|SPRE_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3051.12	50.18888	2	1328.737247	1328.748607	R	S	31	44
PSM	LAGQIFLGGSIVR	5117	sp|P17563|SBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3150.12	52.9884	2	1329.768447	1329.776871	R	G	345	358
PSM	VVVCNLYPFVK	5118	sp|Q9CWJ9|PUR9_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	4-UNIMOD:4	ms_run[1]:scan=1.1.3121.12	52.15887	2	1336.709847	1336.721330	R	T	98	109
PSM	GAAGALMVYDITR	5119	sp|Q91V41|RAB14_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3024.10	49.42407	2	1336.677647	1336.680921	R	R	83	96
PSM	EANLLNAVIVQR	5120	sp|Q9CZ44|NSF1C_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3094.11	51.40983	2	1338.752847	1338.761949	K	L	357	369
PSM	LIIWDSYTTNK	5121	sp|P29387|GBB4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3004.13	48.88488	2	1352.688847	1352.697617	K	M	79	90
PSM	FESTSILQTLSK	5122	sp|Q3UNX5|ACSM3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3052.14	50.21808	2	1352.711247	1352.718747	R	F	300	312
PSM	TPVLLMLGQEDR	5123	sp|Q8R146|APEH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3167.13	53.46213	2	1370.714647	1370.722786	K	R	665	677
PSM	DVLDQWTNMEK	5124	sp|Q3UNX5|ACSM3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3201.11	54.41233	2	1377.618047	1377.623466	K	A	57	68
PSM	DNTANFLSWCR	5125	sp|P11862|GAS2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	10-UNIMOD:4	ms_run[1]:scan=1.1.3189.10	54.06923	2	1382.599647	1382.603734	R	D	112	123
PSM	ALAGCDFLTISPK	5126	sp|Q93092|TALDO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	5-UNIMOD:4	ms_run[1]:scan=1.1.3083.10	51.09706	2	1391.704047	1391.711887	K	L	246	259
PSM	FVEGLPINDFSR	5127	sp|P14152|MDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3152.16	53.04987	2	1392.699247	1392.703765	K	E	299	311
PSM	LTTYAMTVPFVR	5128	sp|Q8BMS1|ECHA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3207.13	54.58565	2	1397.733647	1397.737708	K	Q	268	280
PSM	KIEPELEGSSAVTSHDSSTNGLISFIK	5129	sp|P06745|G6PI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3008.11	48.99428	4	2845.437294	2845.434533	K	Q	524	551
PSM	VAIAVAINQAIASGK	5130	sp|Q8VC12|HUTU_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3120.12	52.13052	2	1424.824647	1424.835114	R	I	520	535
PSM	GIHVEIPGAQAESLGPLQVAR	5131	sp|Q9DCW4|ETFB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3149.9	52.9569	3	2141.154371	2141.159302	R	V	86	107
PSM	VDLCATWEAMEK	5132	sp|Q91WR5|AK1CL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	4-UNIMOD:4	ms_run[1]:scan=1.1.3180.9	53.82113	2	1451.638247	1451.642487	R	C	142	154
PSM	VGSHITGGDIYGIVNENSLIK	5133	sp|P50516|VATA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3094.15	51.41317	3	2185.150571	2185.137898	R	H	143	164
PSM	SEVPGIFCAGADLK	5134	sp|Q9JLZ3|AUHM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	8-UNIMOD:4	ms_run[1]:scan=1.1.3044.17	49.9941	2	1462.705447	1462.712616	R	E	106	120
PSM	ITQLTPFIGYAGGK	5135	sp|O35488|S27A2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3096.12	51.4655	2	1464.788847	1464.797666	K	T	429	443
PSM	TGLVFMPGTIQMR	5136	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	12-UNIMOD:35	ms_run[1]:scan=1.1.3087.11	51.21253	2	1465.731847	1465.742142	R	S	129	142
PSM	DGIHNLENIAFPK	5137	sp|Q9R1P3|PSB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3003.2	48.84767	3	1466.748071	1466.751778	K	R	186	199
PSM	SSGPALWWMNGSGK	5138	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3162.11	53.32315	2	1476.688047	1476.681984	R	E	64	78
PSM	LFLAGYDPTPTMR	5139	sp|P40336|VP26A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3129.18	52.39163	2	1480.728247	1480.738436	R	D	250	263
PSM	VEDFSSISELYAK	5140	sp|Q9Z2H7|GIPC2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3127.13	52.33064	2	1486.711247	1486.719141	R	I	57	70
PSM	LFGYQPTIYYPK	5141	sp|Q8K4Z3|NNRE_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3184.15	53.93618	2	1488.756047	1488.765303	K	R	127	139
PSM	AQFEGIVTDLIKR	5142	sp|P38647|GRP75_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3121.5	52.15302	3	1488.818771	1488.830029	R	T	349	362
PSM	VNQAIWLLCTGAR	5143	sp|P97461|RS5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	9-UNIMOD:4	ms_run[1]:scan=1.1.3201.17	54.41733	2	1500.778047	1500.787118	R	E	147	160
PSM	LVWIETPTNPTLK	5144	sp|Q8VCN5|CGL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3126.15	52.30368	2	1510.828047	1510.839531	K	L	152	165
PSM	DILDIVPTEIHQK	5145	sp|Q9QXD6|F16P1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3102.2	51.62247	3	1519.815971	1519.824609	K	A	302	315
PSM	NILFVITKPDVYK	5146	sp|P70670|NACAM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3052.19	50.22225	2	1548.885447	1548.891566	K	S	2073	2086
PSM	FGFPEGSVELYAEK	5147	sp|P62908|RS3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3185.19	53.96695	2	1571.747247	1571.750775	R	V	77	91
PSM	TTGIVMDSGDGVTHTVPIYEGYALPHAILR	5148	sp|P60710|ACTB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	6-UNIMOD:35	ms_run[1]:scan=1.1.3202.16	54.4451	4	3198.600094	3198.601950	R	L	148	178
PSM	QAIMTILDQEADTR	5149	sp|P28825|MEP1A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3077.15	50.92812	2	1603.786447	1603.787571	R	N	506	520
PSM	AAAAGALAPGPLPDLAAR	5150	sp|Q3TW96|UAP1L_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3058.19	50.38792	2	1601.881647	1601.888940	R	L	53	71
PSM	MLLEFTDTSYEEK	5151	sp|P48774|GSTM5_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3102.18	51.63582	2	1604.737447	1604.727991	R	R	22	35
PSM	SVILEAFSSPSEEVK	5152	sp|Q6ZQ38|CAND1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3061.16	50.47133	2	1620.814647	1620.824668	K	S	859	874
PSM	HELLQPFNVLYEK	5153	sp|P50580|PA2G4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3077.4	50.91893	3	1628.845271	1628.856243	K	E	299	312
PSM	AGTEETILYSDIDLK	5154	sp|Q9JHW2|NIT2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3131.16	52.4462	2	1666.823247	1666.830148	K	K	235	250
PSM	SSGLPITSAVDLEDAAK	5155	sp|Q9Z2I8|SUCB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3117.19	52.05152	2	1672.843047	1672.851946	K	K	408	425
PSM	LSQTFPNADFAEITK	5156	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3086.19	51.19081	2	1680.829047	1680.835902	R	L	243	258
PSM	TLVYGGIFLYPANKK	5157	sp|Q9QXD6|F16P1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3041.5	49.89782	3	1682.933471	1682.939579	R	S	256	271
PSM	VAGALAEEGMGLEEITK	5158	sp|Q8VC30|TKFC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3072.19	50.78985	2	1716.847047	1716.860402	K	R	163	180
PSM	VDLFYLHAPDHSTPVEETLR	5159	sp|Q8CG76|ARK72_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3032.8	49.64285	4	2338.154494	2338.159361	R	A	143	163
PSM	LLVSDTSRPGWINFR	5160	sp|Q8BGA8|ACSM5_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3019.5	49.28845	3	1759.928171	1759.936953	K	E	189	204
PSM	QVGYENAGTVEFLVDK	5161	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3087.19	51.21922	2	1767.858447	1767.867930	K	H	301	317
PSM	QGGLGPMNIPLISDPKR	5162	sp|P35700|PRDX1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3060.7	50.43492	3	1791.956171	1791.966539	K	T	94	111
PSM	GYENGNFVGPTIISNVK	5163	sp|Q9EQ20|MMSA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3025.12	49.46041	2	1807.915847	1807.910464	K	P	392	409
PSM	LASVLNTDPALDSELTSK	5164	sp|Q99KK7|DPP3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3106.20	51.7485	2	1872.952047	1872.968038	R	L	216	234
PSM	ECDVLPDDTVSTLYNR	5165	sp|Q8R0Y6|AL1L1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	2-UNIMOD:4	ms_run[1]:scan=1.1.3050.20	50.16795	2	1895.854847	1895.857108	K	F	151	167
PSM	SFCSMAGPNLIAIGSSESAQK	5166	sp|Q9CWS0|DDAH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	3-UNIMOD:4	ms_run[1]:scan=1.1.3185.14	53.96278	3	2154.009371	2154.008540	K	A	176	197
PSM	LIVDEAINEDNSVVSLSQPK	5167	sp|Q01853|TERA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3205.13	54.52843	3	2169.111371	2169.116494	R	M	26	46
PSM	EGFGHLSPTGTTEFWLGNEK	5168	sp|Q8VCM7|FIBG_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3166.17	53.4378	3	2206.031171	2206.033098	K	I	238	258
PSM	LHALVVGPGLGRDDLLLNNVR	5169	sp|Q9CZ42|NNRD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3065.5	50.57793	4	2240.259294	2240.275335	R	G	141	162
PSM	IFSGCNIENACYPLGVCAER	5170	sp|P56389|CDD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	5-UNIMOD:4,11-UNIMOD:4,17-UNIMOD:4	ms_run[1]:scan=1.1.3108.13	51.79793	3	2329.020971	2329.028958	R	T	49	69
PSM	IFSGCNIENACYPLGVCAER	5171	sp|P56389|CDD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	5-UNIMOD:4,11-UNIMOD:4,17-UNIMOD:4	ms_run[1]:scan=1.1.3115.17	51.99368	3	2329.020971	2329.028958	R	T	49	69
PSM	GAQEVFNELPCEYVEPHELR	5172	sp|Q99K67|AASS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	11-UNIMOD:4	ms_run[1]:scan=1.1.3111.19	51.88517	3	2415.109871	2415.116511	K	E	230	250
PSM	STEPCAHLLVSSIGVVGTAEQNR	5173	sp|O35215|DOPD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	5-UNIMOD:4	ms_run[1]:scan=1.1.3005.16	48.91533	3	2424.204071	2424.206723	K	T	53	76
PSM	AYHEQLSVAEITNACFEPANQMVK	5174	sp|P05213|TBA1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	15-UNIMOD:4	ms_run[1]:scan=1.1.3116.20	52.02417	3	2749.278371	2749.283987	K	C	281	305
PSM	YAELLVSQGVVNQPEYEEEISKYDK	5175	sp|Q60597|ODO1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3206.21	54.56387	3	2929.419071	2929.423300	K	I	540	565
PSM	LLSHCLLVTLASHHPADFTPAVHASLDK	5176	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	5-UNIMOD:4	ms_run[1]:scan=1.1.3051.7	50.1847	5	3049.586118	3049.580761	K	F	101	129
PSM	LLQDSGAPDGTLNIIHGQHDAVNFICDHPDIK	5177	sp|Q9EQ20|MMSA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	26-UNIMOD:4	ms_run[1]:scan=1.1.3105.13	51.71485	5	3509.710118	3509.699767	K	A	224	256
PSM	IVFVPGCSVPLTIVK	5178	sp|Q9D0I9|SYRC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	7-UNIMOD:4	ms_run[1]:scan=1.1.3432.5	60.88143	2	1627.931047	1627.937136	K	S	363	378
PSM	HDADGQATLLNLLLR	5179	sp|P14685|PSMD3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3545.2	64.04863	3	1648.882271	1648.889669	R	N	238	253
PSM	NVFLLGFIPAK	5180	sp|Q9EPU0|RENT1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3633.5	66.55065	2	1217.707247	1217.717231	R	A	185	196
PSM	AIFASGSPFDPVTLPDGR	5181	sp|P06801|MAOX_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3471.5	61.94262	3	1845.919571	1845.926114	R	T	428	446
PSM	DLFQVIYNVK	5182	sp|P98078|DAB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3555.6	64.33672	2	1237.662247	1237.670674	K	K	164	174
PSM	LGTLSALDILIK	5183	sp|Q6ZQ38|CAND1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3611.7	65.91133	2	1255.767447	1255.775139	K	N	668	680
PSM	DVIVDLLCYR	5184	sp|A2ATU0|DHTK1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	8-UNIMOD:4	ms_run[1]:scan=1.1.3603.8	65.6823	2	1264.645047	1264.648559	K	Q	423	433
PSM	INVLPLGSGAIAGNPLGVDR	5185	sp|Q91YI0|ARLY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3477.8	62.11418	3	1932.070271	1932.079260	R	E	194	214
PSM	LLALEFAQELR	5186	sp|Q8VC12|HUTU_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3453.8	61.45127	2	1301.725647	1301.734337	K	Q	59	70
PSM	FFPLEAWQIGK	5187	sp|O35215|DOPD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3547.4	64.10665	2	1334.698047	1334.702309	R	K	100	111
PSM	WSFEELGLLSR	5188	sp|Q3UNX5|ACSM3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3631.5	66.49018	2	1335.677047	1335.682302	R	K	89	100
PSM	EHGGSIVNIIVLLNNGFPTAAHTGAAR	5189	sp|Q99MZ7|PECR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3549.6	64.16475	4	2728.432494	2728.440896	R	E	149	176
PSM	IVILPDYLEIAR	5190	sp|P56399|UBP5_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3568.12	64.7088	2	1413.813447	1413.823152	K	D	122	134
PSM	TPFLLVGTQIDLR	5191	sp|P60766|CDC42_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3526.12	63.50855	2	1471.832047	1471.839865	K	D	108	121
PSM	VVGVPVALDLITSGR	5192	sp|Q9DBM2|ECHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3573.6	64.84568	2	1494.874047	1494.876979	R	H	140	155
PSM	LVSDEMVVELIEK	5193	sp|Q9WTP6|KAD2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3496.10	62.66252	2	1502.782847	1502.790197	K	N	73	86
PSM	DIVLVAYGVLGTQR	5194	sp|Q91WR5|AK1CL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3593.11	65.4	2	1502.841647	1502.845679	K	Y	210	224
PSM	TGDTGMLPANYVEAI	5195	sp|Q61792|LASP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3586.6	65.20419	2	1550.724647	1550.728660	R	-	249	264
PSM	LASQANIAQVLAELK	5196	sp|O35643|AP1B1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3522.18	63.3981	2	1567.886047	1567.893357	R	E	345	360
PSM	TFVSITPAEVGVLVGK	5197	sp|P62962|PROF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3528.15	63.56865	2	1615.913247	1615.918509	K	D	39	55
PSM	TFVSITPAEVGVLVGK	5198	sp|P62962|PROF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3519.10	63.30487	2	1615.913247	1615.918509	K	D	39	55
PSM	VLVLDFVTPTPLGTR	5199	sp|Q9JMH6|TRXR1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3642.9	66.81257	2	1626.928647	1626.934494	K	W	152	167
PSM	AGVPPGVINIVFGTGPR	5200	sp|Q8BH00|AL8A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3567.11	64.67983	2	1649.923247	1649.925326	K	V	197	214
PSM	FLPGAHVFPGGVLDAADSSPDWVR	5201	sp|P11930|NUD19_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3470.14	61.92262	3	2509.237871	2509.239009	R	L	40	64
PSM	AVFVDLEPTVIDEIR	5202	sp|P68368|TBA4A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3603.21	65.69315	2	1714.912447	1714.914152	R	N	65	80
PSM	SIGPLTFVFTGTGNVSK	5203	sp|Q99K67|AASS_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3526.17	63.51273	2	1723.912647	1723.914486	K	G	213	230
PSM	AIWNVINWENVTER	5204	sp|P09671|SODM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3596.16	65.48788	2	1742.873047	1742.874019	K	Y	203	217
PSM	SDPLLMGIPTSENPFK	5205	sp|Q9DAS9|GBG12_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3519.17	63.3107	2	1744.867247	1744.870573	R	D	49	65
PSM	AHCLSEVEHDTMPADLPAIAADFVEDQEVCK	5206	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	3-UNIMOD:4,30-UNIMOD:4	ms_run[1]:scan=1.1.3599.12	65.57643	4	3496.576894	3496.558507	K	N	311	342
PSM	FRCPEALFQPSFLGMESCGIHETTFNSIMK	5207	sp|P60710|ACTB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	3-UNIMOD:4,18-UNIMOD:4	ms_run[1]:scan=1.1.3523.19	63.42768	4	3533.623294	3533.624025	R	C	255	285
PSM	SGGGGNFVLSTSLVGYLR	5208	sp|Q9DC50|OCTC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3535.17	63.77143	2	1782.915047	1782.926448	R	V	533	551
PSM	AYLPVNESFGFTADLR	5209	sp|P58252|EF2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3465.20	61.79095	2	1798.879247	1798.889000	K	S	786	802
PSM	LAEWVAIQSVSAWPEK	5210	sp|Q9D1A2|CNDP2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3486.21	62.38267	2	1812.935447	1812.941036	K	R	22	38
PSM	LAEWVAIQSVSAWPEK	5211	sp|Q9D1A2|CNDP2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3485.19	62.35252	2	1812.935447	1812.941036	K	R	22	38
PSM	KEGGLGPLNIPLLADVTK	5212	sp|Q61171|PRDX2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3489.5	62.45535	3	1834.050371	1834.056400	R	S	92	110
PSM	KEGGLGPLNIPLLADVTK	5213	sp|Q61171|PRDX2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3483.6	62.28458	3	1834.050371	1834.056400	R	S	92	110
PSM	FLDGNELTLADCNLLPK	5214	sp|Q9Z1Q5|CLIC1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	12-UNIMOD:4	ms_run[1]:scan=1.1.3551.20	64.23344	2	1931.961847	1931.966264	K	L	167	184
PSM	FLDGDELTLADCNLLPK	5215	sp|Q8BHB9|CLIC6_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	12-UNIMOD:4	ms_run[1]:scan=1.1.3620.11	66.18163	2	1932.958647	1932.950280	K	L	522	539
PSM	AIAELGIYPAVDPLDSTSR	5216	sp|P56480|ATPB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3507.15	62.97713	2	1987.022647	1987.026222	R	I	388	407
PSM	APPSVFAQVPQAPPVLVFK	5217	sp|P05201|AATC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14		ms_run[1]:scan=1.1.3638.16	66.70855	2	1991.1211	1991.1239	M	L	2	21
PSM	AREYLISLDPENLTLLEK	5218	sp|Q9DC50|OCTC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3478.7	62.14202	3	2116.139171	2116.141586	K	I	251	269
PSM	KADCTITMADSDLLALMTGK	5219	sp|P32020|NLTP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	4-UNIMOD:4	ms_run[1]:scan=1.1.3607.13	65.80123	3	2154.036071	2154.037063	K	M	492	512
PSM	SNGWILPTVYQGMYNATTR	5220	sp|Q8CG76|ARK72_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3575.8	64.90415	3	2171.051771	2171.046974	K	Q	195	214
PSM	IILGGFSQGGALSLYTALTTQQK	5221	sp|P97823|LYPA1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3477.17	62.1217	3	2366.281871	2366.284562	R	L	113	136
PSM	RLGPGGLDPVEVYESLPEELQK	5222	sp|Q61081|CDC37_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3490.14	62.4916	3	2424.237971	2424.253656	K	C	287	309
PSM	KLEEVIQILGDNFPCTLEAQK	5223	sp|Q9D892|ITPA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	15-UNIMOD:4	ms_run[1]:scan=1.1.3582.12	65.10235	3	2444.270771	2444.262112	K	I	19	40
PSM	TPGTWSHITEQIGMFSFTGLNPK	5224	sp|P05201|AATC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3607.20	65.80707	3	2548.239671	2548.242045	K	Q	347	370
PSM	IITITGTQDQIQNAQYLLQNSVK	5225	sp|P61979|HNRPK_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3560.14	64.48628	3	2588.379371	2588.380982	R	Q	434	457
PSM	SPWSMDENLMHISYEAGILENPK	5226	sp|P16460|ASSY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3579.15	65.02085	3	2660.229671	2660.225075	K	N	177	200
PSM	ITGTNAEVMPAQWEFQIGPCEGIR	5227	sp|P15105|GLNA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	20-UNIMOD:4	ms_run[1]:scan=1.1.3548.17	64.14567	3	2703.277871	2703.278507	K	M	190	214
PSM	DHLVPDPGCQYDQVIEINLNELK	5228	sp|Q99KI0|ACON_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	9-UNIMOD:4	ms_run[1]:scan=1.1.3577.20	64.97	3	2708.319071	2708.311582	K	P	324	347
PSM	EAGFPPGVVNIVPGFGPTAGAAIASHEGVDK	5229	sp|P47738|ALDH2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3508.14	63.00414	3	2960.507171	2960.503222	K	V	229	260
PSM	EAGFPPGVVNIVPGFGPTAGAAIASHEGVDK	5230	sp|P47738|ALDH2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3521.20	63.37075	3	2960.507171	2960.503222	K	V	229	260
PSM	ETAFEFLSSA	5231	sp|P14152|MDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3663.2	67.39452	2	1100.497447	1100.502606	K	-	325	335
PSM	DLTQLFGFAR	5232	sp|Q9ET22|DPP2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3762.5	70.17873	2	1166.601447	1166.608408	K	N	264	274
PSM	DSTLIMQLLR	5233	sp|O70456|1433S_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3685.5	68.01943	2	1188.647247	1188.653644	K	D	215	225
PSM	ALDVIVDLLEK	5234	sp|Q3TMH2|SCRN3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3727.2	69.18552	2	1226.703047	1226.712205	K	Y	126	137
PSM	AIIIFVPVPQLK	5235	sp|P62082|RS7_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3675.5	67.72947	2	1336.841847	1336.848245	K	S	59	71
PSM	SMEAEMIQLQEELAAAER	5236	sp|Q8VDD5|MYH9_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3744.7	69.6675	3	2047.951571	2047.955441	K	A	1677	1695
PSM	LLWTLESLVTGR	5237	sp|Q571I9|A16A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3767.6	70.32498	2	1386.783847	1386.787101	R	A	118	130
PSM	GIFVIGFSYPVVPK	5238	sp|O88986|KBL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3692.5	68.22608	2	1521.853047	1521.859538	K	G	367	381
PSM	GIFVIGFSYPVVPK	5239	sp|O88986|KBL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3686.4	68.05015	2	1521.853047	1521.859538	K	G	367	381
PSM	LAPPLVTLLSAEPELQYVALR	5240	sp|O35643|AP1B1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3866.5	73.09415	3	2292.309371	2292.309320	K	N	284	305
PSM	GLAFIQDPDGYWIEILNPNK	5241	sp|Q9CPU0|LGUL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3838.9	72.30447	3	2302.164371	2302.163384	K	I	160	180
PSM	TVPAAVPGICFLSGGMSEEDATLNLNAINR	5242	sp|Q91Y97|ALDOB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14	10-UNIMOD:4	ms_run[1]:scan=1.1.3778.11	70.64439	4	3116.5283	3116.5265	R	C	260	290
PSM	THTQDAVPLTLGQEFSGYVQQVQYAMVR	5243	sp|P97807|FUMH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3767.14	70.33165	4	3165.558094	3165.555334	R	I	231	259
PSM	SYLENPAFMLLDLK	5244	sp|P53395|ODB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3795.14	71.1165	2	1652.844847	1652.848381	K	-	469	483
PSM	GLELYLDLMSQPCR	5245	sp|Q99L20|GSTT3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14	13-UNIMOD:4	ms_run[1]:scan=1.1.3656.15	67.21298	2	1693.8099	1693.8162	M	A	2	16
PSM	EFGIADPEEIMWFK	5246	sp|Q9R0H0|ACOX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3784.7	70.81647	2	1710.789647	1710.796345	R	K	76	90
PSM	TWEQDPDTFLIIIK	5247	sp|Q8QZS1|HIBCH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3726.8	69.16775	2	1717.899847	1717.892688	K	G	73	87
PSM	AGADIIITYFAPQLLK	5248	sp|P10518|HEM2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3815.15	71.67005	2	1732.970647	1732.976358	R	W	310	326
PSM	LTSLVPFVDAFQLER	5249	sp|P23116|EIF3A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3789.14	70.94835	2	1733.921447	1733.935222	R	A	455	470
PSM	GDFVTSFYWPWQTK	5250	sp|Q8VDQ1|PTGR2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3782.11	70.75819	2	1760.818847	1760.819858	K	A	93	107
PSM	FALITWIGEDVSGLQR	5251	sp|Q9CQI6|COTL1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3791.5	70.99609	3	1803.944171	1803.951935	K	A	76	92
PSM	NAPAIIFIDELDAIAPK	5252	sp|Q01853|TERA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3834.8	72.1981	2	1809.985247	1809.987651	K	R	296	313
PSM	DGLLDVVEALQSPLVDK	5253	sp|Q9QYR9|ACOT2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3902.2	74.06942	3	1809.966971	1809.972395	K	K	328	345
PSM	YSLEYYMGLAEELVR	5254	sp|Q05920|PYC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3852.9	72.71159	2	1834.882247	1834.881137	K	A	718	733
PSM	QTAVSVENFIAELLPDK	5255	sp|Q3UPH1|PRRC1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3849.9	72.6272	2	1872.974447	1872.983294	K	W	324	341
PSM	AIVDCIISIIEENSESK	5256	sp|Q9QZE5|COPG1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	5-UNIMOD:4	ms_run[1]:scan=1.1.3874.3	73.30927	3	1918.947071	1918.955759	R	E	416	433
PSM	FWITNGPDADILVVYAK	5257	sp|Q9JHI5|IVD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3740.17	69.56602	2	1920.994047	1920.998551	K	T	195	212
PSM	LLIVSNPVDILTYVAWK	5258	sp|P06151|LDHA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3881.13	73.5169	2	1943.104247	1943.113186	K	I	133	150
PSM	LSVGLEDEQDLLEDLDR	5259	sp|Q8VCN5|CGL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3665.21	67.46532	2	1957.943447	1957.948031	R	A	375	392
PSM	ATENDIYNFFSPLNPVR	5260	sp|O35737|HNRH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3736.6	69.44234	3	1995.966371	1995.969041	R	V	300	317
PSM	FYPEDVAEELIQDITQK	5261	sp|P26040|EZRI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3898.4	73.9609	3	2036.996171	2036.994253	K	L	84	101
PSM	GVGAAATAVTQALNELLQHVK	5262	sp|P26039|TLN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3812.8	71.58076	3	2090.145971	2090.148403	R	A	766	787
PSM	SLTIQPDPIVVPGDVVVSLEGK	5263	sp|Q60648|SAP3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3751.9	69.86525	3	2261.247071	2261.251865	K	T	50	72
PSM	QPVGVAAIITPWNFPSAMITR	5264	sp|Q8BWF0|SSDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3812.13	71.58493	3	2268.208271	2268.208894	K	K	181	202
PSM	VLLASPDLQEAVEEVLPTLKK	5265	sp|O35488|S27A2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3756.10	70.00993	3	2291.299871	2291.298815	K	D	154	175
PSM	DFTPAAQAAFQKVVAGVAAALAHK	5266	tr|A8DUK4|A8DUK4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3822.2	71.85387	4	2381.285294	2381.285565	K	Y	122	146
PSM	VDASVALLCDIQNTIINNLFR	5267	sp|Q9DBL1|ACDSB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	9-UNIMOD:4	ms_run[1]:scan=1.1.4120.2	77.6466	3	2388.243371	2388.247131	K	K	131	152
PSM	LVEGILHAPDAGWGNLVYVVNYPK	5268	sp|Q921F2|TADBP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3668.13	67.54189	3	2623.377671	2623.379859	R	D	56	80
PSM	LPDSVTFEEGALIEPLSVGIYACR	5269	sp|Q64442|DHSO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	23-UNIMOD:4	ms_run[1]:scan=1.1.3802.18	71.31631	3	2635.321271	2635.320355	K	R	143	167
PSM	ITFTGEADQAPGVEPGDIVLLLQEK	5270	sp|Q9QYJ0|DNJA2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3792.16	71.0333	3	2639.367671	2639.369414	R	E	231	256
PSM	TLFPGQGNNSYVFPGVALGVVACGLR	5271	sp|P06801|MAOX_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	23-UNIMOD:4	ms_run[1]:scan=1.1.3808.18	71.4786	3	2692.378571	2692.379542	R	H	446	472
PSM	NDANPETHAFVTSPEIVTALAIAGTLK	5272	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3775.15	70.56071	3	2779.444271	2779.439225	R	F	480	507
PSM	DIPNGATLLVGGFGLCGIPENLIGALLK	5273	sp|Q9D0K2|SCOT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	16-UNIMOD:4	ms_run[1]:scan=1.1.4072.3	77.11572	3	2821.546571	2821.541188	K	T	52	80
PSM	SPLMSEFQSQISSNPELAAIFESIQK	5274	sp|Q6ZQ38|CAND1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3861.5	72.95766	3	2880.433271	2880.421526	K	D	1192	1218
PSM	SITDIINIGIGGSDLGPLMVTEALKPYSK	5275	sp|P06745|G6PI_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3845.9	72.5127	3	3001.613171	3001.604576	K	G	148	177
PSM	CEFQDAYVLLSEK	5276	sp|P63038|CH60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.3806.7	71.4151	2	1583.7093	1583.7172	K	K	237	250
PSM	QRDYETATLSDIK	5277	sp|P57780|ACTN4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14	1-UNIMOD:28	ms_run[1]:scan=1.1.2670.19	39.51225	2	1521.7291	1521.7306	K	A	439	452
PSM	QVGYENAGTVEFLVDK	5278	tr|E9QPD7|E9QPD7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14	1-UNIMOD:28	ms_run[1]:scan=1.1.3617.13	66.08992	2	1750.8358	1750.8409	K	H	302	318
PSM	IHKPDPWLSEFLSQYR	5279	sp|Q9DBM2|ECHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14		ms_run[1]:scan=1.1.3188.6	54.03835	3	2015.0228	2015.0260	R	E	584	600
PSM	GVIDMGNSLIER	5280	sp|P16546|SPTN1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2994.12	48.60115	2	1302.652447	1302.660186	R	G	1608	1620
PSM	KGDIFLVR	5281	sp|Q01853|TERA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2310.11	29.53678	2	946.551647	946.560002	R	G	148	156
PSM	LCQLCPGCGCSSTQPFFGYVGAFK	5282	sp|Q921I1|TRFE_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	2-UNIMOD:4,5-UNIMOD:4,8-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.3509.17	63.02953	3	2741.196071	2740.190621	K	C	189	213
PSM	QEDFELLCPDGTR	5283	sp|Q921I1|TRFE_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14	1-UNIMOD:28,8-UNIMOD:4	ms_run[1]:scan=1.1.3509.10	63.02202	2	1561.6635	1561.6713	K	K	576	589
PSM	HWPFMVVNDAGRPK	5284	sp|P63017|HSP7C_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2619.4	38.07935	4	1652.810094	1652.824566	K	V	89	103
PSM	QHGIPIPVTPK	5285	sp|P16460|ASSY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14	1-UNIMOD:28	ms_run[1]:scan=1.1.2716.11	40.80222	2	1168.6513	1168.6599	K	S	166	177
PSM	ELEEARK	5286	sp|P26039|TLN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14		ms_run[1]:scan=1.1.1573.17	9.075316	2	873.4620	873.4551	R	K	2514	2521
PSM	EMSWIADTYASTIGHYDINAHACVTGKPISQGGIHGR	5287	sp|P26443|DHE3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14	23-UNIMOD:4	ms_run[1]:scan=1.1.3101.11	51.60227	6	4012.9042	4012.8942	R	I	232	269
PSM	QEYDESGPSIVHRK	5288	sp|P60710|ACTB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14	1-UNIMOD:28	ms_run[1]:scan=1.1.2175.17	25.81453	3	1626.7544	1626.7633	K	C	360	374
PSM	PTMADELYDQNYPIHSVEDR	5289	sp|Q9D964|GATM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2972.15	48.00315	3	2392.065071	2392.064140	K	H	216	236
PSM	SGNTPLDMNQFR	5290	sp|Q9DC50|OCTC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2694.16	40.17643	2	1378.620247	1378.629948	K	M	149	161
PSM	FYTEDGNWDLVGNNTPIFFIR	5291	sp|P24270|CATA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14		ms_run[1]:scan=1.1.3820.12	71.80883	3	2517.2000	2517.1960	K	D	136	157
PSM	YTMGDAPDFDR	5292	sp|P10649|GSTM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2617.11	38.03592	2	1286.516047	1286.523752	R	S	33	44
PSM	QKPEFLK	5293	sp|P10649|GSTM1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14	1-UNIMOD:28	ms_run[1]:scan=1.1.2320.8	29.81395	2	871.4725	871.4798	K	T	123	130
PSM	QLFHPEQLITGKEDAANNYAR	5294	sp|P68368|TBA4A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14	1-UNIMOD:28	ms_run[1]:scan=1.1.3115.18	51.99452	3	2397.1657	2397.1708	R	G	85	106
PSM	ILEEHSR	5295	sp|A2AUU0-5|METL8-5_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1663.15	11.56887	2	882.447447	882.455930	R	I	190	197
PSM	RTIQFVDWCPTGFK	5296	sp|P05214|TBA3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	9-UNIMOD:4	ms_run[1]:scan=1.1.3060.6	50.43408	3	1753.851971	1753.861011	K	V	339	353
PSM	YDSTHYK	5297	sp|Q9JII6|AK1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1631.4	10.67635	3	912.391271	912.397747	R	E	135	142
PSM	CATITPDEARVEEFK	5298	sp|P54071|IDHP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.2952.21	47.44633	2	1747.8057	1747.8082	K	L	113	128
PSM	CATITPDEAR	5299	sp|P54071|IDHP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.2591.7	37.31308	2	1115.4825	1115.4912	K	V	113	123
PSM	SEVTFTTPAVYIYTSGTTGLPK	5300	sp|O35488|S27A2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3522.16	63.39643	3	2332.180571	2332.183845	R	A	212	234
PSM	VNTNYRPGLPFSGQVLLVDEK	5301	sp|Q61838|PZP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3169.15	53.51913	3	2345.227571	2345.237946	K	G	354	375
PSM	HCVSAGEPINPEVMEQWR	5302	sp|Q3UNX5|ACSM3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	2-UNIMOD:4	ms_run[1]:scan=1.1.2893.16	45.79023	3	2138.970071	2137.967344	K	K	342	360
PSM	TLMSPLGITR	5303	sp|P07758|A1AT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2830.10	44.00572	2	1087.597047	1087.605965	K	I	319	329
PSM	ENGTITAANASTLNDGAAALVLMTAEAAQR	5304	sp|Q8QZT1|THIL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14		ms_run[1]:scan=1.1.3821.17	71.84015	3	2945.4632	2944.4552	K	L	271	301
PSM	ENGTITAANASTLNDGAAALVLMTAEAAQR	5305	sp|Q8QZT1|THIL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3843.21	72.4559	3	2945.447471	2944.456014	K	L	271	301
PSM	HSMNPFCEIAVEEAVR	5306	sp|Q9DCW4|ETFB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	7-UNIMOD:4	ms_run[1]:scan=1.1.3020.16	49.32537	2	1887.853247	1887.860753	K	L	36	52
PSM	MFCLQSSQALQVLENSLRK	5307	sp|Q9DCY0|KEG1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14	1-UNIMOD:1,3-UNIMOD:4	ms_run[1]:scan=1.1.3836.9	72.2482	3	2293.1530	2293.1553	-	H	1	20
PSM	RVHFLVDEGYEDR	5308	sp|Q60866|PTER_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2376.15	31.35512	3	1633.794071	1633.784869	R	I	280	293
PSM	VVDSLQLTGTKPVATPVDWK	5309	sp|O08709|PRDX6_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2981.12	48.24983	3	2153.164271	2153.173221	R	K	163	183
PSM	VPSENVLGEVGDGFK	5310	sp|P50544|ACADV_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3020.12	49.3187	2	1545.763247	1545.767488	K	V	318	333
PSM	MDDREDLVYQAK	5311	sp|P62259|1433E_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14	1-UNIMOD:1	ms_run[1]:scan=1.1.2693.18	40.14998	2	1523.6822	1523.6922	-	L	1	13
PSM	VDPVNFK	5312	tr|Q91VB8|Q91VB8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14		ms_run[1]:scan=1.1.2218.6	26.99738	2	817.4249	817.4329	R	L	94	101
PSM	ALEQFLQEYFDGNLK	5313	sp|P27773|PDIA3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3779.4	70.66738	3	1814.900471	1813.888666	K	R	348	363
PSM	IIPGFMCQGGDFTR	5314	sp|P17742|PPIA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	7-UNIMOD:4	ms_run[1]:scan=1.1.3108.15	51.7996	2	1597.731647	1597.738119	R	H	56	70
PSM	VGLAICYDMR	5315	sp|Q8VDK1|NIT1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	6-UNIMOD:4	ms_run[1]:scan=1.1.2885.8	45.55983	2	1196.566447	1196.568200	K	F	194	204
PSM	CLSAAEEK	5316	tr|D3Z2H9|D3Z2H9_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	1-UNIMOD:4	ms_run[1]:scan=1.1.1705.13	12.73777	2	906.416247	906.411683	K	Y	170	178
PSM	YPIEHGIITNWDDMEK	5317	sp|P62737|ACTA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	14-UNIMOD:35	ms_run[1]:scan=1.1.2722.15	40.97797	3	1975.894271	1975.898579	K	I	71	87
PSM	RHQSGGNFFEPTLLSNVTR	5318	sp|Q8BWF0|SSDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2802.5	43.20647	4	2159.080094	2159.087199	K	D	400	419
PSM	RHQSGGNFFEPTLLSNVTR	5319	sp|Q8BWF0|SSDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2804.19	43.27443	3	2159.081771	2159.087199	K	D	400	419
PSM	GFEEAVAAGAK	5320	sp|P38060|HMGCL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2290.16	28.98487	2	1049.519047	1048.518925	K	E	112	123
PSM	QLLTLSNELSQAR	5321	sp|P26040|EZRI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2926.16	46.72066	2	1471.790647	1471.799457	R	D	530	543
PSM	CQTTNICVPR	5322	sp|A2ARV4|LRP2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	1-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=1.1.2184.21	26.06847	2	1247.566647	1247.575077	K	A	2830	2840
PSM	LDTHPAMVTVLEMGAAR	5323	sp|Q9CQN1|TRAP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3072.7	50.77983	3	1811.904971	1810.906975	R	H	605	622
PSM	QIGENLIVPGGVK	5324	sp|O08553|DPYL2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2819.17	43.697	2	1322.750047	1322.755801	K	T	44	57
PSM	ADGELNVDSLITR	5325	sp|P62141|PP1B_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14	1-UNIMOD:1	ms_run[1]:scan=1.1.3563.7	64.56448	2	1443.7193	1443.7200	M	L	2	15
PSM	IFCCHGGLSPDLQSMEQIR	5326	sp|P62137|PP1A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	3-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=1.1.2969.14	47.92083	3	2248.029071	2247.023479	K	R	169	188
PSM	QRVEAEVGESLFQEAHEVVLK	5327	sp|Q99L20|GSTT3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14	1-UNIMOD:28	ms_run[1]:scan=1.1.3466.12	61.81163	3	2379.1966	2379.2065	R	A	196	217
PSM	AGLLEPEVFHLNPAR	5328	sp|P52825|CPT2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3057.9	50.35153	3	1661.879171	1661.888940	R	S	168	183
PSM	EEASDYLELDTIK	5329	sp|P08113|ENPL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3061.13	50.46883	2	1525.709047	1524.719535	K	N	253	266
PSM	LGAGYPMGPFELLDYVGLDTTK	5330	sp|Q61425|HCDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	7-UNIMOD:35	ms_run[1]:scan=1.1.3837.9	72.27793	3	2372.154671	2372.161001	K	F	250	272
PSM	TCLLIVFSK	5331	sp|P62746|RHOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	2-UNIMOD:4	ms_run[1]:scan=1.1.3174.3	53.6493	2	1079.595847	1079.604903	K	D	19	28
PSM	MAEHNLLLHLR	5332	sp|Q99KR3|LACB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2363.5	30.98893	3	1345.719971	1345.728875	K	K	256	267
PSM	QSDENLDLAR	5333	sp|Q8CGK3|LONM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2182.18	26.00898	2	1159.537647	1159.546930	R	A	462	472
PSM	LTLSCEEFIK	5334	sp|Q9DCM0|ETHE1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	5-UNIMOD:4	ms_run[1]:scan=1.1.2879.14	45.39898	2	1238.613647	1238.621675	R	V	215	225
PSM	FNGGGHINHTIFWTNLSPK	5335	sp|P09671|SODM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2925.7	46.68462	4	2139.063294	2139.065007	K	G	90	109
PSM	CVLIFGVPSR	5336	sp|P10518|HEM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.3848.2	72.58247	2	1129.5895	1129.5949	R	V	75	85
PSM	VADYIPQLAK	5337	sp|D3Z7P3|GLSK_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2726.6	41.08193	2	1117.632247	1116.617910	K	F	251	261
PSM	ASHLELNNGTK	5338	sp|P45376|ALDR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14	1-UNIMOD:1	ms_run[1]:scan=1.1.2191.21	26.26745	2	1224.5992	1224.6092	M	M	2	13
PSM	VNSFMSTLEK	5339	sp|P06728|APOA4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2639.14	38.64885	2	1154.553047	1154.564160	K	K	351	361
PSM	AEAGEGQKPSPAQLELR	5340	sp|Q8K183|PDXK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2257.19	28.07848	3	1779.909071	1779.911526	K	M	276	293
PSM	SLETSLVPLSDPK	5341	sp|Q9R0N0|GALK1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2959.13	47.63522	2	1384.738047	1384.744961	R	L	205	218
PSM	GAVYSFDPVGSYQR	5342	sp|O09061|PSB1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2890.17	45.70725	2	1545.723647	1544.725957	K	D	146	160
PSM	GWEEGVAQMSVGQR	5343	sp|P26883|FKB1A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2811.21	43.47102	2	1532.701847	1532.704176	R	A	59	73
PSM	DDGSAVIWVTFR	5344	sp|Q9CQI6|COTL1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3556.8	64.3674	2	1364.674247	1364.672465	R	Y	19	31
PSM	DLMVGDEASELR	5345	sp|P61161|ARP2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2844.12	44.40158	2	1333.614047	1333.618381	K	S	54	66
PSM	CGFSELYSWQR	5346	sp|Q8BIJ6|SYIM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.3688.3	68.1065	2	1414.5936	1414.5971	K	E	91	102
PSM	QATVGDVNTDRPGLLDLK	5347	sp|P31786|ACBP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2768.17	42.25483	3	1911.002771	1911.006155	K	G	34	52
PSM	NAQAIEDMVGYAQETQHEK	5348	sp|Q3TXS7|PSMD1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2842.20	44.353	3	2160.980471	2160.974597	K	I	525	544
PSM	ALQVELIPTGEIIR	5349	sp|Q9WTI7|MYO1C_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14	1-UNIMOD:1	ms_run[1]:scan=1.1.3835.8	72.21968	2	1592.9099	1592.9132	M	V	2	16
PSM	DFIYVSQDPK	5350	sp|Q99JY0|ECHB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2690.13	40.06242	2	1211.584047	1210.587004	R	D	340	350
PSM	QMVIDVLHPGK	5351	sp|P62849|RS24_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14	1-UNIMOD:28	ms_run[1]:scan=1.1.3206.7	54.55219	2	1219.6412	1218.6422	K	A	22	33
PSM	IQFHNVKPECLDAYNSLTEAVLPK	5352	sp|O55125|NIPS1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	10-UNIMOD:4	ms_run[1]:scan=1.1.3178.8	53.7653	4	2785.412894	2785.410902	K	L	74	98
PSM	VDVGGDK	5353	sp|Q62426|CYTB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1641.5	10.94837	2	688.332647	688.339169	K	C	57	64
PSM	LLDSSTVTHLFK	5354	sp|Q9QUM9|PSA6_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2919.3	46.5099	3	1359.733871	1359.739817	K	I	60	72
PSM	PCYATLFGPK	5355	sp|Q9DCT8|CRIP2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	2-UNIMOD:4	ms_run[1]:scan=1.1.2789.11	42.84458	2	1152.559847	1152.563767	K	G	56	66
PSM	QFEEIWER	5356	tr|E9PVU0|E9PVU0_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14	1-UNIMOD:28	ms_run[1]:scan=1.1.3615.2	66.02288	2	1118.4942	1118.5028	R	C	1229	1237
PSM	CLIEILASR	5357	sp|P14824|ANXA6_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.3886.2	73.62887	2	1056.5537	1056.5632	K	T	114	123
PSM	CVVALATDPNILNLSGK	5358	sp|Q99L04|DHRS1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.3865.12	73.07417	2	1766.9143	1766.9231	K	V	235	252
PSM	TSIEDQDELSSLLQVPLVAGTVNR	5359	sp|O55135|IF6_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3806.10	71.41843	3	2583.328571	2583.339176	K	G	165	189
PSM	LSVLGAITSVQQR	5360	sp|Q8BWY3|ERF1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3104.10	51.68457	2	1370.776847	1370.788164	R	L	69	82
PSM	QTVTVVPGGCFFASDDSFAMIR	5361	sp|Q9ESL0|SCO2B_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14	1-UNIMOD:28,10-UNIMOD:4	ms_run[1]:scan=1.1.3793.10	71.05655	3	2389.1322	2387.0922	K	G	367	389
PSM	ASALEQFVNSVR	5362	sp|O88543|CSN3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14	1-UNIMOD:1	ms_run[1]:scan=1.1.3843.4	72.44172	2	1361.6877	1361.6934	M	Q	2	14
PSM	LKGEATVSFDDPPSAK	5363	sp|P56959|FUS_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2291.12	29.00893	3	1661.830871	1660.830816	K	A	326	342
PSM	MVDVLGGR	5364	sp|Q9D531|NXNL2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=1.1.1690.15	12.32142	2	903.4485	903.4479	-	R	1	9
PSM	QEVEDSVTKLEETHK	5365	tr|E0CYI9|E0CYI9_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14	1-UNIMOD:1	ms_run[1]:scan=1.1.3780.14	70.70451	2	1813.8812	1812.8732	K	E	3	18
PSM	RSQTLSLSSGSTSR	5366	sp|Q80Z37|TOPRS_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14		ms_run[1]:scan=1.1.3020.8	49.31452	2	1465.7534	1465.7480	R	S	656	670
PSM	DHVGRNNGNGLVK	5367	sp|Q8R4X3|RBM12_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2775.18	42.45242	2	1378.718047	1378.706559	K	F	337	350
PSM	ILQALRR	5368	sp|Q06335|APLP2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2618.4	38.05213	2	868.563647	868.560670	R	Y	433	440
PSM	KEAEDVANEIK	5369	sp|Q8C9J3|SPEF2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14		ms_run[1]:scan=1.1.2637.13	38.59127	2	1244.6185	1244.6243	K	K	182	193
PSM	VASGTLISTVDR	5370	sp|P97458|PROP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14		ms_run[1]:scan=1.1.2631.12	38.42053	2	1217.6615	1217.6610	R	S	27	39
PSM	DQSAVVVQGLPEGVAFKHPEHYDLAT	5371	tr|G3UWV2|G3UWV2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14		ms_run[1]:scan=1.1.3098.19	51.52623	4	2807.4252	2806.3922	R	-	144	170
PSM	ELSEASK	5372	sp|Q8K0L3|ACSM2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1610.12	10.10152	2	761.375047	762.375949	R	Q	85	92
PSM	GTDGHTFR	5373	sp|Q9WUZ9|ENTP5_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1643.12	11.00955	2	888.408647	889.404229	K	S	261	269
PSM	KSDASLEVK	5374	sp|A2AG50|MA7D2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1648.20	11.15652	2	975.515047	975.523676	R	K	599	608
PSM	VASDIWK	5375	sp|Q8K327|CHAP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1682.11	12.09215	2	817.433447	817.433404	K	P	500	507
PSM	TQCALAASK	5376	sp|Q9EQH3|VPS35_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	3-UNIMOD:4	ms_run[1]:scan=1.1.1730.13	13.41735	2	947.474647	948.469866	R	L	651	660
PSM	VYGTVLSR	5377	sp|Q99K67|AASS_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2176.12	25.8378	2	894.492247	893.497067	K	H	260	268
PSM	TTANAIYCPPK	5378	sp|Q8BG32|PSD11_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	8-UNIMOD:4	ms_run[1]:scan=1.1.2183.20	26.03907	2	1233.590847	1234.601609	R	L	195	206
PSM	NVNIFK	5379	sp|P06151|LDHA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2225.4	27.18947	2	734.409647	733.412275	R	F	113	119
PSM	AGLGTGAAGGIGAGR	5380	sp|A0A087WPF7|AUTS2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2254.12	27.99547	2	1187.640847	1184.626184	R	T	28	43
PSM	TGTQYLLR	5381	sp|Q60854|SPB6_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2266.8	28.31763	2	951.513447	950.518531	K	T	84	92
PSM	NAFGAPLTK	5382	sp|Q07417|ACADS_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2275.9	28.56947	2	918.491447	917.497067	R	L	298	307
PSM	HSENILYVSSETIKK	5383	sp|Q91XE0|GLYAT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2316.18	29.70995	3	1745.922371	1746.915215	K	L	128	143
PSM	EITALAPSTMK	5384	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	10-UNIMOD:35	ms_run[1]:scan=1.1.2358.12	30.86533	2	1177.600447	1176.606025	K	I	316	327
PSM	LFNRASGV	5385	tr|Q8VFQ1|Q8VFQ1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2364.4	31.01553	2	861.461847	862.466101	R	-	302	310
PSM	LGPALATGNVVVMK	5386	sp|P47738|ALDH2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	13-UNIMOD:35	ms_run[1]:scan=1.1.2646.20	38.85295	2	1385.765447	1384.774822	K	V	198	212
PSM	VAFDFAAR	5387	sp|Q9D7B6|ACAD8_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2680.2	39.78183	2	896.449647	895.455202	K	E	49	57
PSM	KNELFSNL	5388	sp|P70441|NHRF1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2729.2	41.16092	2	963.504247	963.502546	K	-	348	356
PSM	LETISEDQLDLK	5389	tr|Q8BTS3|Q8BTS3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2810.18	43.44032	2	1401.721247	1402.719141	K	F	247	259
PSM	YAWVLDK	5390	sp|P10126|EF1A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2825.4	43.85807	2	894.469647	893.464704	K	L	56	63
PSM	HIDCASVYGNETEIGEALK	5391	sp|Q9JII6|AK1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	4-UNIMOD:4	ms_run[1]:scan=1.1.2897.14	45.89953	3	2105.958071	2104.973535	R	E	43	62
PSM	LGGSAVISLEGKPL	5392	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2987.8	48.41393	2	1339.763247	1339.771117	K	-	153	167
PSM	ISSVQSIVPALEIANAHR	5393	sp|P63038|CH60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3099.9	51.54555	3	1905.033371	1904.047960	K	K	251	269
PSM	GYENGNFVGPTIISNVKPSMTCYK	5394	sp|Q9EQ20|MMSA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	22-UNIMOD:4	ms_run[1]:scan=1.1.3135.20	52.56327	3	2676.252071	2675.272359	K	E	392	416
PSM	MELFLYFTSILQR	5395	tr|Q9WV19|Q9WV19_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	1-UNIMOD:35	ms_run[1]:scan=1.1.3188.17	54.04753	2	1674.847247	1675.864366	R	F	447	460
PSM	HLSVNDLPVGR	5396	sp|P20108|PRDX3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3467.2	61.83057	2	1207.647847	1205.651670	K	S	198	209
PSM	SLRPGVAIADFVIFPPR	5397	sp|O09173|HGD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3511.3	63.071	3	1855.040771	1854.051589	K	W	305	322