MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000349 -- main2
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20200417\20200417151800575569^127.0.0.1^jpost@jpost.jpost\Psearch.ProteinPilotExecV5\Data140714_Kuno33.pilotFin.txt
MTD	software[1]	[MS, MS:1000663, ProteinPilot, 5.0.0.0, 4767]
MTD	software[1]-setting	FASTA=uniprot_mouse_20200318.fasta
MTD	software[1]-setting	PARAGON_VERSION=5.0.0.0, 4767
MTD	software[1]-setting	UI_SAMPLE_TYPE=Identification
MTD	software[1]-setting	UI_CYS_ALKYLATION=Iodoacetamide
MTD	software[1]-setting	UI_DIGESTION=Trypsin + Lys C
MTD	software[1]-setting	UI_INSTRUMENT=TripleTOF 5600
MTD	software[1]-setting	UI_SEARCH_EFFORT=Thorough
MTD	software[1]-setting	UI_ID_FOCUS=Biological modifications
MTD	software[1]-setting	UI_MIN_UNUSED_PROTSCORE=0.0458
MTD	software[1]-setting	MSTOLERANCE=0.05
MTD	software[1]-setting	MSTOLERANCE_U=Daltons
MTD	software[1]-setting	MSMSTOLERANCE=0.1
MTD	software[1]-setting	MSMSTOLERANCE_U=Daltons
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.uniprot_mouse_20200318
MTD	software[2]-setting	CLE=[R]|{P},[K]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=100
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=1
MTD	software[3]	[MS, MS:1002251, Comet, 2015.02 rev. 0]
MTD	software[3]-setting	Taxon=userFasta.uniprot_mouse_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Oxidation (M)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=1
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[1]-site	M
MTD	variable_mod[1]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	tr|Q91VB8|Q91VB8_MOUSE	Isoform of P01942, GLOBIN domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Hba-a1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	63.0	null		0.27	63.0	4	2	1
PRT	sp|P01942|HBA_MOUSE	Hemoglobin subunit alpha OS=Mus musculus (Mouse) OX=10090 GN=Hba PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	59.0	null	105-UNIMOD:4,33-UNIMOD:35	0.64	59.0	59	7	1
PRT	sp|Q8K0L3|ACSM2_MOUSE	Acyl-coenzyme A synthetase ACSM2, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Acsm2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	50.0	null	174-UNIMOD:4,371-UNIMOD:4,92-UNIMOD:28,101-UNIMOD:4,236-UNIMOD:4,318-UNIMOD:35,207-UNIMOD:4,134-UNIMOD:35,140-UNIMOD:35	0.58	50.0	61	23	2
PRT	sp|P17182|ENOA_MOUSE	Alpha-enolase OS=Mus musculus (Mouse) OX=10090 GN=Eno1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	45.0	null	337-UNIMOD:4,339-UNIMOD:4,119-UNIMOD:4	0.54	45.0	40	18	2
PRT	sp|Q9JIL4|NHRF3_MOUSE	Na(+)/H(+) exchange regulatory cofactor NHE-RF3 OS=Mus musculus (Mouse) OX=10090 GN=Pdzk1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	44.0	null	455-UNIMOD:4,15-UNIMOD:28	0.33	44.0	18	13	8
PRT	sp|P52760|RIDA_MOUSE	2-iminobutanoate/2-iminopropanoate deaminase OS=Mus musculus (Mouse) OX=10090 GN=Rida PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	44.0	null	71-UNIMOD:4	0.88	44.0	18	8	1
PRT	sp|P60710|ACTB_MOUSE	Actin, cytoplasmic 1 OS=Mus musculus (Mouse) OX=10090 GN=Actb PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1000663, ProteinPilot, ]	44.0	null	360-UNIMOD:28,325-UNIMOD:35,2-UNIMOD:1,16-UNIMOD:35,17-UNIMOD:4,285-UNIMOD:4,285-UNIMOD:385	0.56	44.0	56	19	3
PRT	sp|Q91XE4|ACY3_MOUSE	N-acyl-aromatic-L-amino acid amidohydrolase (carboxylate-forming) OS=Mus musculus (Mouse) OX=10090 GN=Acy3 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	44.0	null	26-UNIMOD:4,25-UNIMOD:35,175-UNIMOD:4,73-UNIMOD:4,151-UNIMOD:4,2-UNIMOD:1,145-UNIMOD:28	0.55	44.0	26	13	3
PRT	tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE	Glyceraldehyde-3-phosphate dehydrogenase OS=Mus musculus (Mouse) OX=10090 GN=Gm10358 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	43.0	null	150-UNIMOD:4,154-UNIMOD:4,329-UNIMOD:35,128-UNIMOD:35	0.46	43.0	31	13	3
PRT	sp|P14152|MDHC_MOUSE	Malate dehydrogenase, cytoplasmic OS=Mus musculus (Mouse) OX=10090 GN=Mdh1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	43.0	null	137-UNIMOD:4,154-UNIMOD:4	0.40	43.0	30	14	4
PRT	sp|Q9R0P3|ESTD_MOUSE	S-formylglutathione hydrolase OS=Mus musculus (Mouse) OX=10090 GN=Esd PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	43.0	null	176-UNIMOD:4,181-UNIMOD:4,206-UNIMOD:4,11-UNIMOD:4	0.32	43.0	13	7	3
PRT	sp|P63038|CH60_MOUSE	60 kDa heat shock protein, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Hspd1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	43.0	null	237-UNIMOD:385,237-UNIMOD:4	0.39	43.0	34	19	8
PRT	tr|A8DUK4|A8DUK4_MOUSE	GLOBIN domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Hbb-bs PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	42.0	null	94-UNIMOD:4,110-UNIMOD:35	0.90	42.0	65	12	0
PRT	sp|Q9JII6|AK1A1_MOUSE	Aldo-keto reductase family 1 member A1 OS=Mus musculus (Mouse) OX=10090 GN=Akr1a1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	42.0	null	46-UNIMOD:4,2-UNIMOD:1,3-UNIMOD:1,288-UNIMOD:28	0.44	42.0	38	15	4
PRT	sp|Q9QXD6|F16P1_MOUSE	Fructose-1,6-bisphosphatase 1 OS=Mus musculus (Mouse) OX=10090 GN=Fbp1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	42.0	null	282-UNIMOD:4,39-UNIMOD:4,2-UNIMOD:1,249-UNIMOD:35,93-UNIMOD:4	0.64	42.0	38	17	4
PRT	sp|P17563|SBP1_MOUSE	Methanethiol oxidase OS=Mus musculus (Mouse) OX=10090 GN=Selenbp1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	42.0	null	268-UNIMOD:4,8-UNIMOD:4,80-UNIMOD:4,83-UNIMOD:4,412-UNIMOD:28,371-UNIMOD:4	0.52	42.0	42	19	5
PRT	sp|P47199|QOR_MOUSE	Quinone oxidoreductase OS=Mus musculus (Mouse) OX=10090 GN=Cryz PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	41.0	null	166-UNIMOD:4,45-UNIMOD:4,250-UNIMOD:4	0.42	41.0	20	11	4
PRT	sp|P07758|A1AT1_MOUSE	Alpha-1-antitrypsin 1-1 OS=Mus musculus (Mouse) OX=10090 GN=Serpina1a PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	41.0	null		0.32	41.0	17	10	5
PRT	sp|Q91Y97|ALDOB_MOUSE	Fructose-bisphosphate aldolase B OS=Mus musculus (Mouse) OX=10090 GN=Aldob PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	40.0	null	240-UNIMOD:4,40-UNIMOD:35,2-UNIMOD:1,251-UNIMOD:35	0.43	40.0	47	16	3
PRT	sp|Q64442|DHSO_MOUSE	Sorbitol dehydrogenase OS=Mus musculus (Mouse) OX=10090 GN=Sord PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	40.0	null	140-UNIMOD:4,301-UNIMOD:4,106-UNIMOD:4,45-UNIMOD:4	0.48	40.0	28	14	3
PRT	sp|P99029|PRDX5_MOUSE	Peroxiredoxin-5, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Prdx5 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	40.0	null	179-UNIMOD:35	0.32	40.0	26	7	1
PRT	sp|P08249|MDHM_MOUSE	Malate dehydrogenase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Mdh2 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	39.0	null	275-UNIMOD:4,285-UNIMOD:4	0.39	39.0	19	13	8
PRT	sp|O35215|DOPD_MOUSE	D-dopachrome decarboxylase OS=Mus musculus (Mouse) OX=10090 GN=Ddt PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	39.0	null	57-UNIMOD:4,24-UNIMOD:4	0.79	39.0	16	7	2
PRT	sp|Q99KP3|CRYL1_MOUSE	Lambda-crystallin homolog OS=Mus musculus (Mouse) OX=10090 GN=Cryl1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	39.0	null	125-UNIMOD:4	0.28	39.0	15	7	2
PRT	sp|Q9DCW4|ETFB_MOUSE	Electron transfer flavoprotein subunit beta OS=Mus musculus (Mouse) OX=10090 GN=Etfb PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	39.0	null	42-UNIMOD:4,66-UNIMOD:4,71-UNIMOD:4	0.51	39.0	23	11	4
PRT	sp|Q68FD5|CLH1_MOUSE	Clathrin heavy chain 1 OS=Mus musculus (Mouse) OX=10090 GN=Cltc PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	39.0	null	491-UNIMOD:4,151-UNIMOD:4,870-UNIMOD:4,824-UNIMOD:4,918-UNIMOD:4,459-UNIMOD:4,682-UNIMOD:4,736-UNIMOD:4,1257-UNIMOD:4,1260-UNIMOD:4,617-UNIMOD:4,753-UNIMOD:4	0.31	39.0	57	39	24
PRT	sp|P21550|ENOB_MOUSE	Beta-enolase OS=Mus musculus (Mouse) OX=10090 GN=Eno3 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	39.0	null	357-UNIMOD:4	0.04	39.0	4	1	0
PRT	sp|P16125|LDHB_MOUSE	L-lactate dehydrogenase B chain OS=Mus musculus (Mouse) OX=10090 GN=Ldhb PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	38.0	null	234-UNIMOD:35	0.35	38.0	19	11	6
PRT	sp|P07724|ALBU_MOUSE	Serum albumin OS=Mus musculus (Mouse) OX=10090 GN=Alb PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	38.0	null	269-UNIMOD:4,270-UNIMOD:4,277-UNIMOD:4,77-UNIMOD:4,86-UNIMOD:4,289-UNIMOD:4,591-UNIMOD:4,114-UNIMOD:4,115-UNIMOD:4,288-UNIMOD:35,500-UNIMOD:4,501-UNIMOD:4,461-UNIMOD:4,462-UNIMOD:4,416-UNIMOD:4,302-UNIMOD:4,303-UNIMOD:4,148-UNIMOD:4,500-UNIMOD:385,99-UNIMOD:4,58-UNIMOD:4,125-UNIMOD:4,118-UNIMOD:28,461-UNIMOD:385,58-UNIMOD:385,485-UNIMOD:4,201-UNIMOD:4	0.55	38.0	91	35	8
PRT	sp|Q99LC5|ETFA_MOUSE	Electron transfer flavoprotein subunit alpha, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Etfa PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	38.0	null	53-UNIMOD:4,102-UNIMOD:28,109-UNIMOD:4,155-UNIMOD:4,68-UNIMOD:4	0.35	38.0	17	9	4
PRT	sp|Q9DBM2|ECHP_MOUSE	Peroxisomal bifunctional enzyme OS=Mus musculus (Mouse) OX=10090 GN=Ehhadh PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	38.0	null	17-UNIMOD:4,618-UNIMOD:4,231-UNIMOD:4	0.42	38.0	38	25	14
PRT	sp|Q64433|CH10_MOUSE	10 kDa heat shock protein, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Hspe1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	37.0	null	2-UNIMOD:1	0.79	37.0	13	8	4
PRT	sp|P00329|ADH1_MOUSE	Alcohol dehydrogenase 1 OS=Mus musculus (Mouse) OX=10090 GN=Adh1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	37.0	null	241-UNIMOD:4,171-UNIMOD:4,175-UNIMOD:4	0.30	37.0	20	10	4
PRT	sp|Q91V76|CK054_MOUSE	Ester hydrolase C11orf54 homolog OS=Mus musculus (Mouse) OX=10090 GN=MGI:1918234 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	37.0	null	226-UNIMOD:4,140-UNIMOD:4,38-UNIMOD:4	0.39	37.0	14	9	4
PRT	sp|Q64516|GLPK_MOUSE	Glycerol kinase OS=Mus musculus (Mouse) OX=10090 GN=Gk PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	37.0	null	289-UNIMOD:4,293-UNIMOD:4,67-UNIMOD:4	0.29	37.0	26	15	7
PRT	sp|P63101|1433Z_MOUSE	14-3-3 protein zeta/delta OS=Mus musculus (Mouse) OX=10090 GN=Ywhaz PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	36.0	null	25-UNIMOD:4	0.32	36.0	11	7	3
PRT	sp|Q9WUM5|SUCA_MOUSE	Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Suclg1 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	36.0	null	172-UNIMOD:4,181-UNIMOD:4,67-UNIMOD:28,60-UNIMOD:4	0.39	36.0	20	10	6
PRT	sp|P38647|GRP75_MOUSE	Stress-70 protein, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Hspa9 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	36.0	null	608-UNIMOD:4,366-UNIMOD:4	0.38	36.0	39	21	12
PRT	sp|P63017|HSP7C_MOUSE	Heat shock cognate 71 kDa protein OS=Mus musculus (Mouse) OX=10090 GN=Hspa8 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	36.0	null	17-UNIMOD:4,603-UNIMOD:4,61-UNIMOD:35,549-UNIMOD:35	0.32	36.0	33	18	10
PRT	sp|Q9DCY0|KEG1_MOUSE	Glycine N-acyltransferase-like protein Keg1 OS=Mus musculus (Mouse) OX=10090 GN=Keg1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	36.0	null	99-UNIMOD:28,239-UNIMOD:28,130-UNIMOD:4,136-UNIMOD:4	0.43	36.0	17	11	7
PRT	sp|P09411|PGK1_MOUSE	Phosphoglycerate kinase 1 OS=Mus musculus (Mouse) OX=10090 GN=Pgk1 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	35.0	null	367-UNIMOD:4,379-UNIMOD:4,380-UNIMOD:4,316-UNIMOD:4,176-UNIMOD:35	0.29	35.0	17	8	3
PRT	sp|P10639|THIO_MOUSE	Thioredoxin OS=Mus musculus (Mouse) OX=10090 GN=Txn PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	35.0	null	46-UNIMOD:4	0.43	35.0	8	4	0
PRT	sp|P09671|SODM_MOUSE	Superoxide dismutase [Mn], mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Sod2 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	35.0	null		0.35	35.0	14	8	4
PRT	sp|Q05920|PYC_MOUSE	Pyruvate carboxylase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Pc PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	35.0	null	131-UNIMOD:4,301-UNIMOD:28,752-UNIMOD:4,739-UNIMOD:4,372-UNIMOD:4,376-UNIMOD:4,663-UNIMOD:4,56-UNIMOD:4	0.35	35.0	57	34	16
PRT	sp|Q9CQN1|TRAP1_MOUSE	Heat shock protein 75 kDa, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Trap1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	35.0	null		0.12	35.0	8	6	5
PRT	sp|P97328|KHK_MOUSE	Ketohexokinase OS=Mus musculus (Mouse) OX=10090 GN=Khk PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	35.0	null	47-UNIMOD:4,282-UNIMOD:4	0.12	35.0	6	4	2
PRT	sp|Q8VC30|TKFC_MOUSE	Triokinase/FMN cyclase OS=Mus musculus (Mouse) OX=10090 GN=Tkfc PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	35.0	null	155-UNIMOD:4	0.28	35.0	16	11	7
PRT	sp|P08228|SODC_MOUSE	Superoxide dismutase [Cu-Zn] OS=Mus musculus (Mouse) OX=10090 GN=Sod1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34.0	null		0.45	34.0	14	7	3
PRT	tr|A6ZI47|A6ZI47_MOUSE	Fructose-bisphosphate aldolase OS=Mus musculus (Mouse) OX=10090 GN=Aldoart2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	34.0	null	2-UNIMOD:1	0.08	34.0	4	2	0
PRT	sp|Q9D172|GAL3A_MOUSE	Glutamine amidotransferase-like class 1 domain-containing protein 3A, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Gatd3a PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34.0	null		0.21	34.0	7	4	2
PRT	sp|Q9Z2I8|SUCB2_MOUSE	Succinate--CoA ligase [GDP-forming] subunit beta, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Suclg2 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34.0	null	256-UNIMOD:4,208-UNIMOD:35	0.35	34.0	20	12	6
PRT	sp|P06801|MAOX_MOUSE	NADP-dependent malic enzyme OS=Mus musculus (Mouse) OX=10090 GN=Me1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34.0	null	415-UNIMOD:4,420-UNIMOD:4,240-UNIMOD:4	0.23	34.0	11	10	9
PRT	sp|Q61425|HCDH_MOUSE	Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Hadh PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34.0	null	201-UNIMOD:4	0.29	34.0	16	9	4
PRT	sp|P17751|TPIS_MOUSE	Triosephosphate isomerase OS=Mus musculus (Mouse) OX=10090 GN=Tpi1 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34.0	null	268-UNIMOD:4,177-UNIMOD:4,117-UNIMOD:4	0.48	34.0	34	12	2
PRT	sp|P11930|NUD19_MOUSE	Nucleoside diphosphate-linked moiety X motif 19 OS=Mus musculus (Mouse) OX=10090 GN=Nudt19 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34.0	null	259-UNIMOD:4	0.30	34.0	14	7	3
PRT	sp|Q8QZT1|THIL_MOUSE	Acetyl-CoA acetyltransferase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Acat1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33.0	null	193-UNIMOD:4,363-UNIMOD:35	0.30	33.0	20	10	3
PRT	sp|Q00623|APOA1_MOUSE	Apolipoprotein A-I OS=Mus musculus (Mouse) OX=10090 GN=Apoa1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33.0	null		0.30	33.0	9	7	5
PRT	sp|Q99KI0|ACON_MOUSE	Aconitate hydratase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Aco2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	33.0	null	448-UNIMOD:4,451-UNIMOD:4,592-UNIMOD:385,592-UNIMOD:4,385-UNIMOD:4,126-UNIMOD:4,34-UNIMOD:35	0.44	33.0	58	30	11
PRT	sp|P09103|PDIA1_MOUSE	Protein disulfide-isomerase OS=Mus musculus (Mouse) OX=10090 GN=P4hb PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33.0	null	314-UNIMOD:4	0.23	33.0	15	10	6
PRT	sp|P54071|IDHP_MOUSE	Isocitrate dehydrogenase [NADP], mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Idh2 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33.0	null	402-UNIMOD:4,308-UNIMOD:4,113-UNIMOD:4,411-UNIMOD:35,418-UNIMOD:4	0.36	33.0	26	15	6
PRT	sp|Q9Z0S1|BPNT1_MOUSE	3'(2'),5'-bisphosphate nucleotidase 1 OS=Mus musculus (Mouse) OX=10090 GN=Bpnt1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	33.0	null	249-UNIMOD:4,243-UNIMOD:4,206-UNIMOD:4,2-UNIMOD:1,28-UNIMOD:385,28-UNIMOD:4	0.47	33.0	21	11	4
PRT	sp|Q7TNG8|LDHD_MOUSE	Probable D-lactate dehydrogenase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Ldhd PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	33.0	null	439-UNIMOD:4,369-UNIMOD:4,287-UNIMOD:4,63-UNIMOD:4,451-UNIMOD:28	0.38	33.0	28	15	5
PRT	sp|P16627|HS71L_MOUSE	Heat shock 70 kDa protein 1-like OS=Mus musculus (Mouse) OX=10090 GN=Hspa1l PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33.0	null		0.12	33.0	11	6	3
PRT	sp|P05213|TBA1B_MOUSE	Tubulin alpha-1B chain OS=Mus musculus (Mouse) OX=10090 GN=Tuba1b PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33.0	null	295-UNIMOD:4,315-UNIMOD:4,316-UNIMOD:4,347-UNIMOD:4,313-UNIMOD:35	0.35	33.0	28	13	6
PRT	sp|Q9EQ20|MMSA_MOUSE	Methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Aldh6a1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33.0	null	86-UNIMOD:4,149-UNIMOD:4,368-UNIMOD:4,317-UNIMOD:4,413-UNIMOD:4,79-UNIMOD:35	0.50	33.0	42	23	8
PRT	sp|P10649|GSTM1_MOUSE	Glutathione S-transferase Mu 1 OS=Mus musculus (Mouse) OX=10090 GN=Gstm1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	3-UNIMOD:35,19-UNIMOD:35,123-UNIMOD:28	0.53	32.0	22	13	6
PRT	sp|P50247|SAHH_MOUSE	Adenosylhomocysteinase OS=Mus musculus (Mouse) OX=10090 GN=Ahcy PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	79-UNIMOD:4,195-UNIMOD:4,2-UNIMOD:1,228-UNIMOD:4	0.42	32.0	28	17	9
PRT	sp|Q60866|PTER_MOUSE	Phosphotriesterase-related protein OS=Mus musculus (Mouse) OX=10090 GN=Pter PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	196-UNIMOD:4,164-UNIMOD:385,164-UNIMOD:4,172-UNIMOD:4	0.33	32.0	11	8	5
PRT	sp|Q8CHT0|AL4A1_MOUSE	Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Aldh4a1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	296-UNIMOD:28,94-UNIMOD:4	0.23	32.0	18	11	5
PRT	sp|Q9D0F9|PGM1_MOUSE	Phosphoglucomutase-1 OS=Mus musculus (Mouse) OX=10090 GN=Pgm1 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32.0	null	374-UNIMOD:4	0.14	32.0	6	6	6
PRT	sp|P56480|ATPB_MOUSE	ATP synthase subunit beta, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Atp5f1b PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32.0	null		0.30	32.0	13	11	9
PRT	sp|P10126|EF1A1_MOUSE	Elongation factor 1-alpha 1 OS=Mus musculus (Mouse) OX=10090 GN=Eef1a1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	411-UNIMOD:4	0.31	32.0	30	12	3
PRT	sp|Q3UNZ8|QORL2_MOUSE	Quinone oxidoreductase-like protein 2 OS=Mus musculus (Mouse) OX=10090 GN=Cryzl2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32.0	null	61-UNIMOD:4,71-UNIMOD:4,32-UNIMOD:4	0.25	32.0	10	7	4
PRT	sp|P45952|ACADM_MOUSE	Medium-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Acadm PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32.0	null		0.40	32.0	26	16	11
PRT	sp|P16460|ASSY_MOUSE	Argininosuccinate synthase OS=Mus musculus (Mouse) OX=10090 GN=Ass1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	331-UNIMOD:4,166-UNIMOD:28,132-UNIMOD:4,161-UNIMOD:35	0.36	32.0	41	17	5
PRT	sp|Q8VCR7|ABHEB_MOUSE	Protein ABHD14B OS=Mus musculus (Mouse) OX=10090 GN=Abhd14b PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32.0	null	190-UNIMOD:4	0.42	32.0	9	6	3
PRT	sp|Q9JLJ2|AL9A1_MOUSE	4-trimethylaminobutyraldehyde dehydrogenase OS=Mus musculus (Mouse) OX=10090 GN=Aldh9a1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32.0	null	220-UNIMOD:4,45-UNIMOD:4,74-UNIMOD:4,484-UNIMOD:4	0.32	32.0	25	13	4
PRT	sp|P14206|RSSA_MOUSE	40S ribosomal protein SA OS=Mus musculus (Mouse) OX=10090 GN=Rpsa PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32.0	null	148-UNIMOD:4,163-UNIMOD:4	0.31	32.0	8	6	4
PRT	sp|P97816|S100G_MOUSE	Protein S100-G OS=Mus musculus (Mouse) OX=10090 GN=S100g PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32.0	null		0.33	32.0	9	3	1
PRT	sp|P62259|1433E_MOUSE	14-3-3 protein epsilon OS=Mus musculus (Mouse) OX=10090 GN=Ywhae PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	97-UNIMOD:4,98-UNIMOD:4,1-UNIMOD:1	0.49	32.0	15	10	6
PRT	sp|Q9Z2V4|PCKGC_MOUSE	Phosphoenolpyruvate carboxykinase, cytosolic [GTP] OS=Mus musculus (Mouse) OX=10090 GN=Pck1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	192-UNIMOD:4,198-UNIMOD:4,192-UNIMOD:385,399-UNIMOD:4,288-UNIMOD:4	0.23	32.0	20	11	5
PRT	sp|Q8CG76|ARK72_MOUSE	Aflatoxin B1 aldehyde reductase member 2 OS=Mus musculus (Mouse) OX=10090 GN=Akr7a2 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	164-UNIMOD:4,222-UNIMOD:4	0.31	32.0	19	10	4
PRT	sp|P68372|TBB4B_MOUSE	Tubulin beta-4B chain OS=Mus musculus (Mouse) OX=10090 GN=Tubb4b PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32.0	null	354-UNIMOD:4,164-UNIMOD:35,303-UNIMOD:4	0.35	32.0	38	11	2
PRT	sp|Q9DC50|OCTC_MOUSE	Peroxisomal carnitine O-octanoyltransferase OS=Mus musculus (Mouse) OX=10090 GN=Crot PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32.0	null	188-UNIMOD:4,196-UNIMOD:4,437-UNIMOD:4,438-UNIMOD:4,458-UNIMOD:4	0.22	32.0	14	10	7
PRT	sp|P68368|TBA4A_MOUSE	Tubulin alpha-4A chain OS=Mus musculus (Mouse) OX=10090 GN=Tuba4a PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32.0	null		0.08	32.0	5	3	2
PRT	sp|O08749|DLDH_MOUSE	Dihydrolipoyl dehydrogenase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Dld PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32.0	null	484-UNIMOD:4	0.27	32.0	20	12	5
PRT	sp|P07759|SPA3K_MOUSE	Serine protease inhibitor A3K OS=Mus musculus (Mouse) OX=10090 GN=Serpina3k PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32.0	null	260-UNIMOD:4,283-UNIMOD:35	0.29	32.0	23	11	3
PRT	sp|P00342|LDHC_MOUSE	L-lactate dehydrogenase C chain OS=Mus musculus (Mouse) OX=10090 GN=Ldhc PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31.0	null	163-UNIMOD:4	0.07	31.0	7	2	0
PRT	sp|P99024|TBB5_MOUSE	Tubulin beta-5 chain OS=Mus musculus (Mouse) OX=10090 GN=Tubb5 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31.0	null	12-UNIMOD:4	0.07	31.0	5	3	1
PRT	sp|P51174|ACADL_MOUSE	Long-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Acadl PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31.0	null	351-UNIMOD:4	0.30	31.0	19	12	8
PRT	sp|Q9D964|GATM_MOUSE	Glycine amidinotransferase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Gatm PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31.0	null	407-UNIMOD:4,410-UNIMOD:4	0.27	31.0	17	10	5
PRT	sp|Q9D8N0|EF1G_MOUSE	Elongation factor 1-gamma OS=Mus musculus (Mouse) OX=10090 GN=Eef1g PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	2-UNIMOD:1	0.13	31.0	7	4	1
PRT	sp|P10630|IF4A2_MOUSE	Eukaryotic initiation factor 4A-II OS=Mus musculus (Mouse) OX=10090 GN=Eif4a2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.12	31.0	5	4	3
PRT	sp|P35979|RL12_MOUSE	60S ribosomal protein L12 OS=Mus musculus (Mouse) OX=10090 GN=Rpl12 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31.0	null	141-UNIMOD:4	0.26	31.0	3	3	3
PRT	sp|P40142|TKT_MOUSE	Transketolase OS=Mus musculus (Mouse) OX=10090 GN=Tkt PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	1-UNIMOD:1	0.31	31.0	22	15	9
PRT	sp|P09041|PGK2_MOUSE	Phosphoglycerate kinase 2 OS=Mus musculus (Mouse) OX=10090 GN=Pgk2 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.15	31.0	14	5	1
PRT	sp|Q9R0H0|ACOX1_MOUSE	Peroxisomal acyl-coenzyme A oxidase 1 OS=Mus musculus (Mouse) OX=10090 GN=Acox1 PE=1 SV=5	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31.0	null	559-UNIMOD:4,531-UNIMOD:4,297-UNIMOD:4	0.35	31.0	25	18	11
PRT	sp|Q922D8|C1TC_MOUSE	C-1-tetrahydrofolate synthase, cytoplasmic OS=Mus musculus (Mouse) OX=10090 GN=Mthfd1 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31.0	null	195-UNIMOD:4,863-UNIMOD:4,408-UNIMOD:4	0.20	31.0	17	14	11
PRT	sp|P61205|ARF3_MOUSE	ADP-ribosylation factor 3 OS=Mus musculus (Mouse) OX=10090 GN=Arf3 PE=2 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31.0	null	22-UNIMOD:35	0.24	31.0	5	4	3
PRT	sp|Q8BH00|AL8A1_MOUSE	2-aminomuconic semialdehyde dehydrogenase OS=Mus musculus (Mouse) OX=10090 GN=Aldh8a1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31.0	null	271-UNIMOD:4,287-UNIMOD:4,289-UNIMOD:4	0.26	31.0	12	8	4
PRT	sp|P05202|AATM_MOUSE	Aspartate aminotransferase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Got2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	187-UNIMOD:4,295-UNIMOD:4,174-UNIMOD:35,339-UNIMOD:28	0.37	31.0	25	15	8
PRT	sp|Q07417|ACADS_MOUSE	Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Acads PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31.0	null	289-UNIMOD:4,246-UNIMOD:4	0.34	31.0	15	11	7
PRT	sp|Q61133|GSTT2_MOUSE	Glutathione S-transferase theta-2 OS=Mus musculus (Mouse) OX=10090 GN=Gstt2 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31.0	null	50-UNIMOD:4	0.28	31.0	10	5	2
PRT	sp|Q8R0Y6|AL1L1_MOUSE	Cytosolic 10-formyltetrahydrofolate dehydrogenase OS=Mus musculus (Mouse) OX=10090 GN=Aldh1l1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	404-UNIMOD:4,238-UNIMOD:4,587-UNIMOD:4,152-UNIMOD:4,17-UNIMOD:4,662-UNIMOD:4	0.40	31.0	33	26	19
PRT	sp|P50544|ACADV_MOUSE	Very long-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Acadvl PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.19	31.0	11	8	5
PRT	sp|P20108|PRDX3_MOUSE	Thioredoxin-dependent peroxide reductase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Prdx3 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31.0	null	230-UNIMOD:4	0.27	31.0	7	4	1
PRT	sp|P70296|PEBP1_MOUSE	Phosphatidylethanolamine-binding protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Pebp1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31.0	null	168-UNIMOD:4,133-UNIMOD:4	0.55	31.0	11	7	4
PRT	sp|Q91WR5|AK1CL_MOUSE	Aldo-keto reductase family 1 member C21 OS=Mus musculus (Mouse) OX=10090 GN=Akr1c21 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1000663, ProteinPilot, ]	31.0	null	145-UNIMOD:4,87-UNIMOD:4,188-UNIMOD:4,193-UNIMOD:4	0.34	31.0	19	9	5
PRT	sp|P32020|NLTP_MOUSE	Non-specific lipid-transfer protein OS=Mus musculus (Mouse) OX=10090 GN=Scp2 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1000663, ProteinPilot, ]	31.0	null	495-UNIMOD:4	0.15	31.0	11	7	3
PRT	sp|P26350|PTMA_MOUSE	Prothymosin alpha OS=Mus musculus (Mouse) OX=10090 GN=Ptma PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	31.0	null	2-UNIMOD:1	0.27	31.0	5	3	2
PRT	sp|P31786|ACBP_MOUSE	Acyl-CoA-binding protein OS=Mus musculus (Mouse) OX=10090 GN=Dbi PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	31.0	null	34-UNIMOD:28,2-UNIMOD:1	0.49	31.0	8	4	2
PRT	sp|Q8BVI4|DHPR_MOUSE	Dihydropteridine reductase OS=Mus musculus (Mouse) OX=10090 GN=Qdpr PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30.0	null	158-UNIMOD:4,82-UNIMOD:4	0.36	30.0	8	6	4
PRT	sp|Q9CR57|RL14_MOUSE	60S ribosomal protein L14 OS=Mus musculus (Mouse) OX=10090 GN=Rpl14 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30.0	null		0.06	30.0	1	1	1
PRT	sp|Q99MZ7|PECR_MOUSE	Peroxisomal trans-2-enoyl-CoA reductase OS=Mus musculus (Mouse) OX=10090 GN=Pecr PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30.0	null		0.32	30.0	10	6	2
PRT	sp|P24270|CATA_MOUSE	Catalase OS=Mus musculus (Mouse) OX=10090 GN=Cat PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	30.0	null	425-UNIMOD:4,232-UNIMOD:4,377-UNIMOD:4,2-UNIMOD:1,460-UNIMOD:4	0.40	30.0	31	19	8
PRT	sp|Q9CQ62|DECR_MOUSE	2,4-dienoyl-CoA reductase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Decr1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	30.0	null	86-UNIMOD:4,116-UNIMOD:385,116-UNIMOD:4	0.36	30.0	11	9	7
PRT	sp|Q8R164|BPHL_MOUSE	Valacyclovir hydrolase OS=Mus musculus (Mouse) OX=10090 GN=Bphl PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30.0	null	234-UNIMOD:4,225-UNIMOD:4	0.30	30.0	11	6	2
PRT	sp|P11499|HS90B_MOUSE	Heat shock protein HSP 90-beta OS=Mus musculus (Mouse) OX=10090 GN=Hsp90ab1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	30.0	null	564-UNIMOD:4	0.18	30.0	21	12	5
PRT	sp|P56389|CDD_MOUSE	Cytidine deaminase OS=Mus musculus (Mouse) OX=10090 GN=Cda PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	30.0	null	53-UNIMOD:4,59-UNIMOD:4,65-UNIMOD:4,2-UNIMOD:1,8-UNIMOD:4	0.35	30.0	5	3	1
PRT	sp|P35700|PRDX1_MOUSE	Peroxiredoxin-1 OS=Mus musculus (Mouse) OX=10090 GN=Prdx1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	30.0	null	71-UNIMOD:4,83-UNIMOD:4,141-UNIMOD:28	0.60	30.0	27	12	3
PRT	sp|O08997|ATOX1_MOUSE	Copper transport protein ATOX1 OS=Mus musculus (Mouse) OX=10090 GN=Atox1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30.0	null		0.34	30.0	3	2	1
PRT	sp|Q9DBF1|AL7A1_MOUSE	Alpha-aminoadipic semialdehyde dehydrogenase OS=Mus musculus (Mouse) OX=10090 GN=Aldh7a1 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	30.0	null	70-UNIMOD:4,522-UNIMOD:4	0.28	30.0	16	11	7
PRT	sp|P62075|TIM13_MOUSE	Mitochondrial import inner membrane translocase subunit Tim13 OS=Mus musculus (Mouse) OX=10090 GN=Timm13 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30.0	null		0.16	30.0	1	1	1
PRT	sp|P28271|ACOC_MOUSE	Cytoplasmic aconitate hydratase OS=Mus musculus (Mouse) OX=10090 GN=Aco1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30.0	null	118-UNIMOD:4,50-UNIMOD:4,165-UNIMOD:4,369-UNIMOD:4,370-UNIMOD:4	0.24	30.0	18	17	16
PRT	sp|Q9D6Y7|MSRA_MOUSE	Mitochondrial peptide methionine sulfoxide reductase OS=Mus musculus (Mouse) OX=10090 GN=Msra PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30.0	null		0.28	30.0	8	5	2
PRT	sp|P57780|ACTN4_MOUSE	Alpha-actinin-4 OS=Mus musculus (Mouse) OX=10090 GN=Actn4 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1000663, ProteinPilot, ]	30.0	null		0.26	30.0	29	19	11
PRT	sp|Q9R0P5|DEST_MOUSE	Destrin OS=Mus musculus (Mouse) OX=10090 GN=Dstn PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	30.0	null	2-UNIMOD:1,12-UNIMOD:4,39-UNIMOD:4,147-UNIMOD:4,46-UNIMOD:4	0.47	30.0	13	7	3
PRT	sp|Q91XE0|GLYAT_MOUSE	Glycine N-acyltransferase OS=Mus musculus (Mouse) OX=10090 GN=Glyat PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	30.0	null	86-UNIMOD:4,100-UNIMOD:28,208-UNIMOD:4	0.43	30.0	20	9	3
PRT	sp|Q8R0F8|FAHD1_MOUSE	Acylpyruvase FAHD1, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Fahd1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30.0	null		0.14	30.0	3	2	1
PRT	sp|P18760|COF1_MOUSE	Cofilin-1 OS=Mus musculus (Mouse) OX=10090 GN=Cfl1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30.0	null	139-UNIMOD:4	0.42	30.0	9	5	2
PRT	sp|Q9JHI5|IVD_MOUSE	Isovaleryl-CoA dehydrogenase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Ivd PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29.0	null	252-UNIMOD:4,259-UNIMOD:4,348-UNIMOD:4	0.33	29.0	25	14	5
PRT	sp|Q99L13|3HIDH_MOUSE	3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Hibadh PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29.0	null	74-UNIMOD:4	0.30	29.0	9	7	5
PRT	sp|P97807|FUMH_MOUSE	Fumarate hydratase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Fh PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	29.0	null		0.27	29.0	20	13	6
PRT	sp|P47738|ALDH2_MOUSE	Aldehyde dehydrogenase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Aldh2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	29.0	null	388-UNIMOD:4,68-UNIMOD:4,210-UNIMOD:35	0.25	29.0	14	10	5
PRT	sp|P08113|ENPL_MOUSE	Endoplasmin OS=Mus musculus (Mouse) OX=10090 GN=Hsp90b1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29.0	null		0.12	29.0	10	9	8
PRT	sp|P47791|GSHR_MOUSE	Glutathione reductase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Gsr PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29.0	null	80-UNIMOD:4,85-UNIMOD:4	0.14	29.0	6	4	2
PRT	sp|Q8BWT1|THIM_MOUSE	3-ketoacyl-CoA thiolase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Acaa2 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29.0	null	116-UNIMOD:4,128-UNIMOD:4	0.42	29.0	18	12	9
PRT	sp|Q80W22|THNS2_MOUSE	Threonine synthase-like 2 OS=Mus musculus (Mouse) OX=10090 GN=Thnsl2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29.0	null	280-UNIMOD:4,303-UNIMOD:4	0.21	29.0	10	7	5
PRT	sp|P58252|EF2_MOUSE	Elongation factor 2 OS=Mus musculus (Mouse) OX=10090 GN=Eef2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	29.0	null	591-UNIMOD:4,651-UNIMOD:4,693-UNIMOD:4,728-UNIMOD:385,728-UNIMOD:4,41-UNIMOD:4	0.22	29.0	23	16	12
PRT	sp|Q60597|ODO1_MOUSE	2-oxoglutarate dehydrogenase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Ogdh PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29.0	null	956-UNIMOD:4,566-UNIMOD:4	0.15	29.0	16	13	10
PRT	sp|Q99LB7|SARDH_MOUSE	Sarcosine dehydrogenase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Sardh PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29.0	null	236-UNIMOD:4	0.15	29.0	15	11	7
PRT	sp|Q00897|A1AT4_MOUSE	Alpha-1-antitrypsin 1-4 OS=Mus musculus (Mouse) OX=10090 GN=Serpina1d PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29.0	null		0.05	29.0	1	1	1
PRT	sp|Q62468|VILI_MOUSE	Villin-1 OS=Mus musculus (Mouse) OX=10090 GN=Vil1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	29.0	null	624-UNIMOD:4,285-UNIMOD:4,553-UNIMOD:4,554-UNIMOD:4,558-UNIMOD:4,134-UNIMOD:4	0.39	29.0	40	27	15
PRT	tr|Q80X68|Q80X68_MOUSE	Citrate synthase OS=Mus musculus (Mouse) OX=10090 GN=Csl PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29.0	null	211-UNIMOD:4	0.08	29.0	5	3	2
PRT	sp|P97494|GSH1_MOUSE	Glutamate--cysteine ligase catalytic subunit OS=Mus musculus (Mouse) OX=10090 GN=Gclc PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	29.0	null	142-UNIMOD:4,295-UNIMOD:4	0.15	29.0	9	7	5
PRT	sp|P11352|GPX1_MOUSE	Glutathione peroxidase 1 OS=Mus musculus (Mouse) OX=10090 GN=Gpx1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29.0	null	154-UNIMOD:4	0.33	29.0	9	5	2
PRT	sp|Q8BMF4|ODP2_MOUSE	Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Dlat PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29.0	null	290-UNIMOD:4,483-UNIMOD:4	0.19	29.0	13	9	6
PRT	sp|Q9DBJ1|PGAM1_MOUSE	Phosphoglycerate mutase 1 OS=Mus musculus (Mouse) OX=10090 GN=Pgam1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29.0	null	55-UNIMOD:4	0.36	29.0	12	6	1
PRT	sp|P49935|CATH_MOUSE	Pro-cathepsin H OS=Mus musculus (Mouse) OX=10090 GN=Ctsh PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29.0	null		0.05	29.0	2	1	0
PRT	sp|P06745|G6PI_MOUSE	Glucose-6-phosphate isomerase OS=Mus musculus (Mouse) OX=10090 GN=Gpi PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29.0	null		0.27	29.0	16	11	7
PRT	tr|E9QN99|E9QN99_MOUSE	Isoform of Q8VCR7, AB hydrolase-1 domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Abhd14b PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	null	2-UNIMOD:1	0.06	29.0	2	1	0
PRT	sp|Q8K386|RAB15_MOUSE	Ras-related protein Rab-15 OS=Mus musculus (Mouse) OX=10090 GN=Rab15 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29.0	null		0.06	29.0	3	1	0
PRT	sp|Q9CPY7|AMPL_MOUSE	Cytosol aminopeptidase OS=Mus musculus (Mouse) OX=10090 GN=Lap3 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28.0	null	462-UNIMOD:4,313-UNIMOD:4,129-UNIMOD:4	0.35	28.0	23	15	9
PRT	sp|Q99LX0|PARK7_MOUSE	Protein/nucleic acid deglycase DJ-1 OS=Mus musculus (Mouse) OX=10090 GN=Park7 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28.0	null	46-UNIMOD:4	0.42	28.0	9	8	7
PRT	sp|Q60605|MYL6_MOUSE	Myosin light polypeptide 6 OS=Mus musculus (Mouse) OX=10090 GN=Myl6 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28.0	null	32-UNIMOD:4	0.26	28.0	5	3	1
PRT	sp|P15532|NDKA_MOUSE	Nucleoside diphosphate kinase A OS=Mus musculus (Mouse) OX=10090 GN=Nme1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28.0	null	90-UNIMOD:35,109-UNIMOD:4	0.38	28.0	14	5	0
PRT	sp|Q9Z2I9|SUCB1_MOUSE	Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Sucla2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28.0	null	430-UNIMOD:4,152-UNIMOD:4,158-UNIMOD:4,384-UNIMOD:4,270-UNIMOD:4	0.23	28.0	13	10	7
PRT	sp|O09173|HGD_MOUSE	Homogentisate 1,2-dioxygenase OS=Mus musculus (Mouse) OX=10090 GN=Hgd PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28.0	null	14-UNIMOD:4,416-UNIMOD:4,418-UNIMOD:4,138-UNIMOD:4	0.26	28.0	18	8	3
PRT	sp|P07901|HS90A_MOUSE	Heat shock protein HSP 90-alpha OS=Mus musculus (Mouse) OX=10090 GN=Hsp90aa1 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28.0	null	598-UNIMOD:4,599-UNIMOD:4,530-UNIMOD:4	0.28	28.0	34	18	6
PRT	sp|Q01853|TERA_MOUSE	Transitional endoplasmic reticulum ATPase OS=Mus musculus (Mouse) OX=10090 GN=Vcp PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28.0	null	535-UNIMOD:4,69-UNIMOD:4,77-UNIMOD:4,522-UNIMOD:4	0.22	28.0	19	13	7
PRT	sp|Q8VDK1|NIT1_MOUSE	Deaminated glutathione amidase OS=Mus musculus (Mouse) OX=10090 GN=Nit1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28.0	null	247-UNIMOD:4,255-UNIMOD:4,63-UNIMOD:4	0.09	28.0	3	2	1
PRT	sp|O88844|IDHC_MOUSE	Isocitrate dehydrogenase [NADP] cytoplasmic OS=Mus musculus (Mouse) OX=10090 GN=Idh1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28.0	null	269-UNIMOD:4,73-UNIMOD:4,379-UNIMOD:4	0.41	28.0	23	15	9
PRT	sp|Q99MN9|PCCB_MOUSE	Propionyl-CoA carboxylase beta chain, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Pccb PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28.0	null	271-UNIMOD:4	0.22	28.0	11	9	7
PRT	sp|O35488|S27A2_MOUSE	Very long-chain acyl-CoA synthetase OS=Mus musculus (Mouse) OX=10090 GN=Slc27a2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	28.0	null	427-UNIMOD:4,301-UNIMOD:4,146-UNIMOD:4,149-UNIMOD:4,150-UNIMOD:4	0.25	28.0	20	13	6
PRT	sp|P17742|PPIA_MOUSE	Peptidyl-prolyl cis-trans isomerase A OS=Mus musculus (Mouse) OX=10090 GN=Ppia PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28.0	null	62-UNIMOD:4,161-UNIMOD:4,115-UNIMOD:4	0.56	28.0	14	7	2
PRT	sp|O88958|GNPI1_MOUSE	Glucosamine-6-phosphate isomerase 1 OS=Mus musculus (Mouse) OX=10090 GN=Gnpda1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28.0	null	239-UNIMOD:4	0.18	28.0	6	4	2
PRT	sp|P06151|LDHA_MOUSE	L-lactate dehydrogenase A chain OS=Mus musculus (Mouse) OX=10090 GN=Ldha PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	28.0	null	54-UNIMOD:35,233-UNIMOD:28,84-UNIMOD:4	0.31	28.0	17	10	5
PRT	tr|F6WHQ7|F6WHQ7_MOUSE	Isoform of P10649, Glutathione S-transferase Mu 1 (Fragment) OS=Mus musculus (Mouse) OX=10090 GN=Gstm1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28.0	null	56-UNIMOD:4	0.08	28.0	2	1	0
PRT	sp|P42932|TCPQ_MOUSE	T-complex protein 1 subunit theta OS=Mus musculus (Mouse) OX=10090 GN=Cct8 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28.0	null		0.10	28.0	8	4	2
PRT	sp|P20065-2|TYB4-2_MOUSE	Isoform of P20065, Isoform Short of Thymosin beta-4 OS=Mus musculus (Mouse) OX=10090 GN=Tmsb4x PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	null	2-UNIMOD:1	0.27	28.0	2	1	0
PRT	sp|P35505|FAAA_MOUSE	Fumarylacetoacetase OS=Mus musculus (Mouse) OX=10090 GN=Fah PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27.0	null	396-UNIMOD:4,315-UNIMOD:4,408-UNIMOD:4	0.24	27.0	16	8	1
PRT	sp|P40936|INMT_MOUSE	Indolethylamine N-methyltransferase OS=Mus musculus (Mouse) OX=10090 GN=Inmt PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1000663, ProteinPilot, ]	27.0	null	231-UNIMOD:4	0.23	27.0	12	6	3
PRT	sp|Q9D0K2|SCOT1_MOUSE	Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Oxct1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27.0	null	111-UNIMOD:35,456-UNIMOD:4,235-UNIMOD:4	0.28	27.0	18	13	10
PRT	sp|P16331|PH4H_MOUSE	Phenylalanine-4-hydroxylase OS=Mus musculus (Mouse) OX=10090 GN=Pah PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	27.0	null	357-UNIMOD:4,2-UNIMOD:1,445-UNIMOD:4	0.27	27.0	11	9	7
PRT	sp|Q8K157|GALM_MOUSE	Aldose 1-epimerase OS=Mus musculus (Mouse) OX=10090 GN=Galm PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.09	27.0	4	2	0
PRT	sp|Q91X52|DCXR_MOUSE	L-xylulose reductase OS=Mus musculus (Mouse) OX=10090 GN=Dcxr PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27.0	null	100-UNIMOD:4	0.21	27.0	6	4	2
PRT	sp|P42125|ECI1_MOUSE	Enoyl-CoA delta isomerase 1, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Eci1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.24	27.0	7	5	3
PRT	sp|P52480|KPYM_MOUSE	Pyruvate kinase PKM OS=Mus musculus (Mouse) OX=10090 GN=Pkm PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	27.0	null	31-UNIMOD:4,49-UNIMOD:4	0.35	27.0	20	14	8
PRT	sp|Q8BFR5|EFTU_MOUSE	Elongation factor Tu, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Tufm PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.25	27.0	9	9	9
PRT	sp|P70670|NACAM_MOUSE	Nascent polypeptide-associated complex subunit alpha, muscle-specific form OS=Mus musculus (Mouse) OX=10090 GN=Naca PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.01	27.0	3	2	1
PRT	sp|Q9D826|SOX_MOUSE	Peroxisomal sarcosine oxidase OS=Mus musculus (Mouse) OX=10090 GN=Pipox PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	27.0	null	163-UNIMOD:4,170-UNIMOD:4,71-UNIMOD:4,299-UNIMOD:4,113-UNIMOD:28	0.28	27.0	12	8	4
PRT	sp|Q9EQH3|VPS35_MOUSE	Vacuolar protein sorting-associated protein 35 OS=Mus musculus (Mouse) OX=10090 GN=Vps35 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.05	27.0	3	3	3
PRT	sp|Q3UNX5|ACSM3_MOUSE	Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Acsm3 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27.0	null	109-UNIMOD:4	0.23	27.0	15	12	9
PRT	sp|P26443|DHE3_MOUSE	Glutamate dehydrogenase 1, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Glud1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	27.0	null	376-UNIMOD:4,172-UNIMOD:4,172-UNIMOD:385	0.27	27.0	21	13	7
PRT	sp|O09174|AMACR_MOUSE	Alpha-methylacyl-CoA racemase OS=Mus musculus (Mouse) OX=10090 GN=Amacr PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1000663, ProteinPilot, ]	27.0	null		0.23	27.0	9	6	3
PRT	tr|Q6PDB7|Q6PDB7_MOUSE	Carboxylic ester hydrolase OS=Mus musculus (Mouse) OX=10090 GN=Ces2b PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|Q99PT1|GDIR1_MOUSE	Rho GDP-dissociation inhibitor 1 OS=Mus musculus (Mouse) OX=10090 GN=Arhgdia PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.13	27.0	4	2	0
PRT	sp|P62962|PROF1_MOUSE	Profilin-1 OS=Mus musculus (Mouse) OX=10090 GN=Pfn1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	27.0	null	128-UNIMOD:385,128-UNIMOD:4	0.49	27.0	12	6	3
PRT	sp|Q61838|PZP_MOUSE	Pregnancy zone protein OS=Mus musculus (Mouse) OX=10090 GN=Pzp PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	27.0	null	1339-UNIMOD:4	0.12	27.0	15	13	11
PRT	tr|A6ZI46|A6ZI46_MOUSE	Fructose-bisphosphate aldolase OS=Mus musculus (Mouse) OX=10090 GN=Aldoart1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27.0	null	394-UNIMOD:4,295-UNIMOD:4	0.29	27.0	14	10	6
PRT	sp|Q9D2G2|ODO2_MOUSE	Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Dlst PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.22	27.0	12	8	4
PRT	sp|Q921I1|TRFE_MOUSE	Serotransferrin OS=Mus musculus (Mouse) OX=10090 GN=Tf PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26.0	null	386-UNIMOD:4,395-UNIMOD:4,260-UNIMOD:4,350-UNIMOD:4,597-UNIMOD:4,692-UNIMOD:4,363-UNIMOD:4	0.31	26.0	24	19	14
PRT	sp|P00920|CAH2_MOUSE	Carbonic anhydrase 2 OS=Mus musculus (Mouse) OX=10090 GN=Ca2 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	26.0	null	2-UNIMOD:1	0.47	26.0	14	9	4
PRT	sp|P63158|HMGB1_MOUSE	High mobility group protein B1 OS=Mus musculus (Mouse) OX=10090 GN=Hmgb1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.12	26.0	2	2	2
PRT	sp|Q9D051|ODPB_MOUSE	Pyruvate dehydrogenase E1 component subunit beta, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Pdhb PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	26.0	null		0.24	26.0	8	6	4
PRT	sp|P61957|SUMO2_MOUSE	Small ubiquitin-related modifier 2 OS=Mus musculus (Mouse) OX=10090 GN=Sumo2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.14	26.0	2	1	0
PRT	sp|Q99NB1|ACS2L_MOUSE	Acetyl-coenzyme A synthetase 2-like, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Acss1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26.0	null	235-UNIMOD:4,86-UNIMOD:4	0.16	26.0	11	9	7
PRT	sp|P70441|NHRF1_MOUSE	Na(+)/H(+) exchange regulatory cofactor NHE-RF1 OS=Mus musculus (Mouse) OX=10090 GN=Slc9a3r1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	26.0	null	206-UNIMOD:28,2-UNIMOD:1	0.28	26.0	10	7	5
PRT	sp|P26039|TLN1_MOUSE	Talin-1 OS=Mus musculus (Mouse) OX=10090 GN=Tln1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26.0	null	956-UNIMOD:4	0.04	26.0	9	8	7
PRT	sp|Q9WVL0|MAAI_MOUSE	Maleylacetoacetate isomerase OS=Mus musculus (Mouse) OX=10090 GN=Gstz1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.18	26.0	4	3	2
PRT	sp|Q8BH95|ECHM_MOUSE	Enoyl-CoA hydratase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Echs1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26.0	null	225-UNIMOD:4	0.11	26.0	4	3	2
PRT	sp|P70349|HINT1_MOUSE	Histidine triad nucleotide-binding protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Hint1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	26.0	null	84-UNIMOD:4,38-UNIMOD:385,38-UNIMOD:4	0.61	26.0	6	5	4
PRT	sp|P57776|EF1D_MOUSE	Elongation factor 1-delta OS=Mus musculus (Mouse) OX=10090 GN=Eef1d PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	26.0	null	2-UNIMOD:1	0.21	26.0	4	4	4
PRT	sp|Q78JT3|3HAO_MOUSE	3-hydroxyanthranilate 3,4-dioxygenase OS=Mus musculus (Mouse) OX=10090 GN=Haao PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.21	26.0	7	5	3
PRT	sp|Q91WG0|EST2C_MOUSE	Acylcarnitine hydrolase OS=Mus musculus (Mouse) OX=10090 GN=Ces2c PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26.0	null	282-UNIMOD:4	0.05	26.0	3	2	1
PRT	sp|P12658|CALB1_MOUSE	Calbindin OS=Mus musculus (Mouse) OX=10090 GN=Calb1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26.0	null	100-UNIMOD:4	0.32	26.0	14	7	2
PRT	sp|Q9Z2U1|PSA5_MOUSE	Proteasome subunit alpha type-5 OS=Mus musculus (Mouse) OX=10090 GN=Psma5 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.18	26.0	3	3	3
PRT	sp|P19157|GSTP1_MOUSE	Glutathione S-transferase P 1 OS=Mus musculus (Mouse) OX=10090 GN=Gstp1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.16	26.0	3	2	1
PRT	sp|Q9CQV8|1433B_MOUSE	14-3-3 protein beta/alpha OS=Mus musculus (Mouse) OX=10090 GN=Ywhab PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.16	26.0	4	3	2
PRT	sp|Q9R1P0|PSA4_MOUSE	Proteasome subunit alpha type-4 OS=Mus musculus (Mouse) OX=10090 GN=Psma4 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26.0	null	163-UNIMOD:4	0.07	26.0	1	1	1
PRT	sp|P62245|RS15A_MOUSE	40S ribosomal protein S15a OS=Mus musculus (Mouse) OX=10090 GN=Rps15a PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.34	26.0	6	4	3
PRT	sp|A2AQ07|TBB1_MOUSE	Tubulin beta-1 chain OS=Mus musculus (Mouse) OX=10090 GN=Tubb1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.07	26.0	14	4	1
PRT	sp|Q91YI0|ARLY_MOUSE	Argininosuccinate lyase OS=Mus musculus (Mouse) OX=10090 GN=Asl PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26.0	null	256-UNIMOD:35	0.31	26.0	19	13	8
PRT	sp|Q93092|TALDO_MOUSE	Transaldolase OS=Mus musculus (Mouse) OX=10090 GN=Taldo1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26.0	null	250-UNIMOD:4	0.31	26.0	14	11	9
PRT	sp|Q62433|NDRG1_MOUSE	Protein NDRG1 OS=Mus musculus (Mouse) OX=10090 GN=Ndrg1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26.0	null	289-UNIMOD:4	0.16	26.0	5	4	3
PRT	sp|Q9CWS0|DDAH1_MOUSE	N(G),N(G)-dimethylarginine dimethylaminohydrolase 1 OS=Mus musculus (Mouse) OX=10090 GN=Ddah1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	26.0	null	274-UNIMOD:4,275-UNIMOD:4,2-UNIMOD:1	0.27	26.0	7	6	5
PRT	sp|Q9JHW2|NIT2_MOUSE	Omega-amidase NIT2 OS=Mus musculus (Mouse) OX=10090 GN=Nit2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26.0	null	146-UNIMOD:4	0.31	26.0	9	7	5
PRT	sp|P34914|HYES_MOUSE	Bifunctional epoxide hydrolase 2 OS=Mus musculus (Mouse) OX=10090 GN=Ephx2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26.0	null	230-UNIMOD:4	0.28	26.0	16	10	5
PRT	sp|Q9DCM2|GSTK1_MOUSE	Glutathione S-transferase kappa 1 OS=Mus musculus (Mouse) OX=10090 GN=Gstk1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26.0	null	176-UNIMOD:4	0.14	26.0	2	2	2
PRT	sp|P61979|HNRPK_MOUSE	Heterogeneous nuclear ribonucleoprotein K OS=Mus musculus (Mouse) OX=10090 GN=Hnrnpk PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26.0	null	184-UNIMOD:4,185-UNIMOD:4	0.21	26.0	10	7	5
PRT	sp|P08905|LYZ2_MOUSE	Lysozyme C-2 OS=Mus musculus (Mouse) OX=10090 GN=Lyz2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26.0	null	95-UNIMOD:4,99-UNIMOD:4,113-UNIMOD:4	0.23	26.0	4	2	1
PRT	sp|O70250|PGAM2_MOUSE	Phosphoglycerate mutase 2 OS=Mus musculus (Mouse) OX=10090 GN=Pgam2 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.22	25.0	9	5	2
PRT	sp|P63323|RS12_MOUSE	40S ribosomal protein S12 OS=Mus musculus (Mouse) OX=10090 GN=Rps12 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25.0	null	106-UNIMOD:4,108-UNIMOD:4	0.08	25.0	1	1	1
PRT	sp|Q64105|SPRE_MOUSE	Sepiapterin reductase OS=Mus musculus (Mouse) OX=10090 GN=Spr PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25.0	null	235-UNIMOD:4	0.29	25.0	10	6	2
PRT	sp|P56395|CYB5_MOUSE	Cytochrome b5 OS=Mus musculus (Mouse) OX=10090 GN=Cyb5a PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.41	25.0	7	4	2
PRT	sp|P29758|OAT_MOUSE	Ornithine aminotransferase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Oat PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25.0	null	150-UNIMOD:4	0.14	25.0	6	4	2
PRT	sp|Q9D6R2|IDH3A_MOUSE	Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Idh3a PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	25.0	null	351-UNIMOD:4,359-UNIMOD:4,331-UNIMOD:4,215-UNIMOD:385,215-UNIMOD:4,222-UNIMOD:4	0.33	25.0	12	10	8
PRT	sp|P0DP26|CALM1_MOUSE	Calmodulin-1 OS=Mus musculus (Mouse) OX=10090 GN=Calm1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.27	25.0	7	4	2
PRT	sp|Q3UPL0|SC31A_MOUSE	Protein transport protein Sec31A OS=Mus musculus (Mouse) OX=10090 GN=Sec31a PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|P62754|RS6_MOUSE	40S ribosomal protein S6 OS=Mus musculus (Mouse) OX=10090 GN=Rps6 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25.0	null	12-UNIMOD:4	0.10	25.0	2	2	2
PRT	sp|P55264|ADK_MOUSE	Adenosine kinase OS=Mus musculus (Mouse) OX=10090 GN=Adk PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	25.0	null	159-UNIMOD:4,105-UNIMOD:4,2-UNIMOD:1,352-UNIMOD:4	0.18	25.0	5	5	5
PRT	sp|Q91VM9|IPYR2_MOUSE	Inorganic pyrophosphatase 2, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Ppa2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25.0	null	156-UNIMOD:4,157-UNIMOD:4,166-UNIMOD:4	0.26	25.0	9	6	4
PRT	sp|P04117|FABP4_MOUSE	Fatty acid-binding protein, adipocyte OS=Mus musculus (Mouse) OX=10090 GN=Fabp4 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	25.0	null	118-UNIMOD:4	0.38	25.0	7	5	3
PRT	sp|P37804|TAGL_MOUSE	Transgelin OS=Mus musculus (Mouse) OX=10090 GN=Tagln PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.22	25.0	4	4	4
PRT	sp|P62702|RS4X_MOUSE	40S ribosomal protein S4, X isoform OS=Mus musculus (Mouse) OX=10090 GN=Rps4x PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25.0	null	181-UNIMOD:4	0.10	25.0	2	2	2
PRT	sp|Q00898|A1AT5_MOUSE	Alpha-1-antitrypsin 1-5 OS=Mus musculus (Mouse) OX=10090 GN=Serpina1e PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.07	25.0	5	2	0
PRT	sp|O55137|ACOT1_MOUSE	Acyl-coenzyme A thioesterase 1 OS=Mus musculus (Mouse) OX=10090 GN=Acot1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25.0	null	14-UNIMOD:4	0.12	25.0	6	4	2
PRT	sp|P51660|DHB4_MOUSE	Peroxisomal multifunctional enzyme type 2 OS=Mus musculus (Mouse) OX=10090 GN=Hsd17b4 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25.0	null	175-UNIMOD:4	0.09	25.0	5	5	5
PRT	sp|P97493|THIOM_MOUSE	Thioredoxin, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Txn2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25.0	null	90-UNIMOD:4,93-UNIMOD:4	0.13	25.0	1	1	1
PRT	sp|Q01768|NDKB_MOUSE	Nucleoside diphosphate kinase B OS=Mus musculus (Mouse) OX=10090 GN=Nme2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	null	145-UNIMOD:4	0.16	24.0	3	2	1
PRT	sp|P47963|RL13_MOUSE	60S ribosomal protein L13 OS=Mus musculus (Mouse) OX=10090 GN=Rpl13 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.11	24.0	2	2	2
PRT	sp|Q9DCG6|PBLD1_MOUSE	Phenazine biosynthesis-like domain-containing protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Pbld1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.14	24.0	5	3	1
PRT	sp|Q8BTM8|FLNA_MOUSE	Filamin-A OS=Mus musculus (Mouse) OX=10090 GN=Flna PE=1 SV=5	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	null	1018-UNIMOD:4	0.02	24.0	4	4	4
PRT	sp|Q60865|CAPR1_MOUSE	Caprin-1 OS=Mus musculus (Mouse) OX=10090 GN=Caprin1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|P26883|FKB1A_MOUSE	Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Mus musculus (Mouse) OX=10090 GN=Fkbp1a PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null		0.13	24.0	2	1	0
PRT	sp|P38060|HMGCL_MOUSE	Hydroxymethylglutaryl-CoA lyase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Hmgcl PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	null	141-UNIMOD:4,170-UNIMOD:4,174-UNIMOD:4	0.12	24.0	3	3	3
PRT	sp|P63005|LIS1_MOUSE	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Mus musculus (Mouse) OX=10090 GN=Pafah1b1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|O35855|BCAT2_MOUSE	Branched-chain-amino-acid aminotransferase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Bcat2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.06	24.0	2	2	2
PRT	sp|Q8VCN5|CGL_MOUSE	Cystathionine gamma-lyase OS=Mus musculus (Mouse) OX=10090 GN=Cth PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	null	108-UNIMOD:4,171-UNIMOD:4	0.25	24.0	8	7	6
PRT	sp|P35980|RL18_MOUSE	60S ribosomal protein L18 OS=Mus musculus (Mouse) OX=10090 GN=Rpl18 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.13	24.0	3	2	1
PRT	sp|Q3ULD5|MCCB_MOUSE	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Mccc2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	null	267-UNIMOD:4,431-UNIMOD:4	0.15	24.0	7	6	5
PRT	sp|P29699|FETUA_MOUSE	Alpha-2-HS-glycoprotein OS=Mus musculus (Mouse) OX=10090 GN=Ahsg PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	null	336-UNIMOD:4	0.11	24.0	2	2	2
PRT	sp|Q91Z53|GRHPR_MOUSE	Glyoxylate reductase/hydroxypyruvate reductase OS=Mus musculus (Mouse) OX=10090 GN=Grhpr PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	null	288-UNIMOD:4	0.15	24.0	8	4	1
PRT	tr|A0A0J9YTU1|A0A0J9YTU1_MOUSE	Isoform of P97328, PfkB domain-containing protein (Fragment) OS=Mus musculus (Mouse) OX=10090 GN=Khk PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.05	24.0	2	1	0
PRT	sp|P98078|DAB2_MOUSE	Disabled homolog 2 OS=Mus musculus (Mouse) OX=10090 GN=Dab2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.08	24.0	7	5	3
PRT	sp|P35486|ODPA_MOUSE	Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Pdha1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	null	261-UNIMOD:4,91-UNIMOD:4,94-UNIMOD:4,100-UNIMOD:4,101-UNIMOD:4,218-UNIMOD:4,222-UNIMOD:4,41-UNIMOD:4	0.36	24.0	15	12	10
PRT	sp|Q61316|HSP74_MOUSE	Heat shock 70 kDa protein 4 OS=Mus musculus (Mouse) OX=10090 GN=Hspa4 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	24.0	null		0.07	24.0	4	4	4
PRT	sp|Q61598|GDIB_MOUSE	Rab GDP dissociation inhibitor beta OS=Mus musculus (Mouse) OX=10090 GN=Gdi2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	null	202-UNIMOD:4,203-UNIMOD:4,414-UNIMOD:4,282-UNIMOD:4	0.38	24.0	18	13	9
PRT	sp|Q9D0S9|HINT2_MOUSE	Histidine triad nucleotide-binding protein 2, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Hint2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	null	75-UNIMOD:4	0.47	24.0	10	5	1
PRT	sp|P63242|IF5A1_MOUSE	Eukaryotic translation initiation factor 5A-1 OS=Mus musculus (Mouse) OX=10090 GN=Eif5a PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	null	73-UNIMOD:4	0.20	24.0	5	2	0
PRT	sp|Q4FZG7|TI8AB_MOUSE	Putative mitochondrial import inner membrane translocase subunit Tim8 A-B OS=Mus musculus (Mouse) OX=10090 GN=Timm8a2 PE=3 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.12	24.0	1	1	1
PRT	sp|O08709|PRDX6_MOUSE	Peroxiredoxin-6 OS=Mus musculus (Mouse) OX=10090 GN=Prdx6 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.46	24.0	12	9	6
PRT	sp|P48722|HS74L_MOUSE	Heat shock 70 kDa protein 4L OS=Mus musculus (Mouse) OX=10090 GN=Hspa4l PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	null	376-UNIMOD:4,380-UNIMOD:4	0.02	24.0	2	1	0
PRT	sp|P09405|NUCL_MOUSE	Nucleolin OS=Mus musculus (Mouse) OX=10090 GN=Ncl PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.08	24.0	6	5	4
PRT	sp|Q9JLT4|TRXR2_MOUSE	Thioredoxin reductase 2, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Txnrd2 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	null	86-UNIMOD:4,91-UNIMOD:4	0.06	24.0	2	2	2
PRT	sp|Q6ZQM8|UD17C_MOUSE	UDP-glucuronosyltransferase 1-7C OS=Mus musculus (Mouse) OX=10090 GN=Ugt1a7c PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.09	24.0	4	3	2
PRT	sp|Q03265|ATPA_MOUSE	ATP synthase subunit alpha, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Atp5f1a PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	null	244-UNIMOD:4	0.23	24.0	12	10	8
PRT	sp|P17225|PTBP1_MOUSE	Polypyrimidine tract-binding protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Ptbp1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	null	249-UNIMOD:4,250-UNIMOD:4	0.12	24.0	4	4	4
PRT	sp|Q91VA0|ACSM1_MOUSE	Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Acsm1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	null	208-UNIMOD:4	0.15	24.0	7	6	5
PRT	sp|Q8R146|APEH_MOUSE	Acylamino-acid-releasing enzyme OS=Mus musculus (Mouse) OX=10090 GN=Apeh PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	24.0	null	292-UNIMOD:385,292-UNIMOD:4,303-UNIMOD:4,682-UNIMOD:28	0.23	24.0	15	11	8
PRT	sp|O88569|ROA2_MOUSE	Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Mus musculus (Mouse) OX=10090 GN=Hnrnpa2b1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.14	24.0	5	4	3
PRT	sp|Q02053|UBA1_MOUSE	Ubiquitin-like modifier-activating enzyme 1 OS=Mus musculus (Mouse) OX=10090 GN=Uba1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	24.0	null	234-UNIMOD:4,375-UNIMOD:28	0.09	24.0	6	6	6
PRT	sp|Q8BVE3|VATH_MOUSE	V-type proton ATPase subunit H OS=Mus musculus (Mouse) OX=10090 GN=Atp6v1h PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.09	24.0	3	3	3
PRT	sp|Q9CPU0|LGUL_MOUSE	Lactoylglutathione lyase OS=Mus musculus (Mouse) OX=10090 GN=Glo1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	null	139-UNIMOD:4	0.15	24.0	3	2	1
PRT	sp|Q3TNA1|XYLB_MOUSE	Xylulose kinase OS=Mus musculus (Mouse) OX=10090 GN=Xylb PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	23.0	null	24-UNIMOD:385,24-UNIMOD:4,25-UNIMOD:4,368-UNIMOD:4	0.16	23.0	12	9	7
PRT	sp|Q76MZ3|2AAA_MOUSE	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Mus musculus (Mouse) OX=10090 GN=Ppp2r1a PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.04	23.0	2	2	2
PRT	sp|P13707|GPDA_MOUSE	Glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic OS=Mus musculus (Mouse) OX=10090 GN=Gpd1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	23.0	null	162-UNIMOD:4,168-UNIMOD:4,102-UNIMOD:4,341-UNIMOD:385,341-UNIMOD:4	0.33	23.0	17	13	9
PRT	sp|P70694|DHB5_MOUSE	Estradiol 17 beta-dehydrogenase 5 OS=Mus musculus (Mouse) OX=10090 GN=Akr1c6 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.06	23.0	6	3	1
PRT	sp|Q8K1Z0|COQ9_MOUSE	Ubiquinone biosynthesis protein COQ9, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Coq9 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.11	23.0	2	2	2
PRT	sp|Q9Z1Q5|CLIC1_MOUSE	Chloride intracellular channel protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Clic1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	null	178-UNIMOD:4,191-UNIMOD:4,24-UNIMOD:4,223-UNIMOD:4	0.43	23.0	14	8	3
PRT	sp|P68254|1433T_MOUSE	14-3-3 protein theta OS=Mus musculus (Mouse) OX=10090 GN=Ywhaq PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	null	134-UNIMOD:4,25-UNIMOD:4	0.20	23.0	7	4	1
PRT	sp|P17156|HSP72_MOUSE	Heat shock-related 70 kDa protein 2 OS=Mus musculus (Mouse) OX=10090 GN=Hspa2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.06	23.0	5	3	1
PRT	sp|P62897|CYC_MOUSE	Cytochrome c, somatic OS=Mus musculus (Mouse) OX=10090 GN=Cycs PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.26	23.0	2	2	2
PRT	tr|B1AQW2|B1AQW2_MOUSE	Isoform of P10637, Microtubule-associated protein OS=Mus musculus (Mouse) OX=10090 GN=Mapt PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.06	23.0	1	1	1
PRT	sp|P97823|LYPA1_MOUSE	Acyl-protein thioesterase 1 OS=Mus musculus (Mouse) OX=10090 GN=Lypla1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.10	23.0	4	2	1
PRT	sp|Q7TMM9|TBB2A_MOUSE	Tubulin beta-2A chain OS=Mus musculus (Mouse) OX=10090 GN=Tubb2a PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.03	23.0	2	1	0
PRT	sp|Q8VDD5|MYH9_MOUSE	Myosin-9 OS=Mus musculus (Mouse) OX=10090 GN=Myh9 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.04	23.0	5	5	5
PRT	sp|P05201|AATC_MOUSE	Aspartate aminotransferase, cytoplasmic OS=Mus musculus (Mouse) OX=10090 GN=Got1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.16	23.0	9	6	3
PRT	sp|Q91VI7|RINI_MOUSE	Ribonuclease inhibitor OS=Mus musculus (Mouse) OX=10090 GN=Rnh1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	null	204-UNIMOD:4,211-UNIMOD:4,33-UNIMOD:4,129-UNIMOD:4,137-UNIMOD:4	0.11	23.0	5	4	3
PRT	sp|O09172|GSH0_MOUSE	Glutamate--cysteine ligase regulatory subunit OS=Mus musculus (Mouse) OX=10090 GN=Gclm PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.20	23.0	5	4	3
PRT	sp|Q91ZA3|PCCA_MOUSE	Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Pcca PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.13	23.0	8	7	6
PRT	sp|P61458|PHS_MOUSE	Pterin-4-alpha-carbinolamine dehydratase OS=Mus musculus (Mouse) OX=10090 GN=Pcbd1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.45	23.0	6	4	2
PRT	sp|P62814|VATB2_MOUSE	V-type proton ATPase subunit B, brain isoform OS=Mus musculus (Mouse) OX=10090 GN=Atp6v1b2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	null	112-UNIMOD:4	0.20	23.0	12	9	8
PRT	sp|Q61207|SAP_MOUSE	Prosaposin OS=Mus musculus (Mouse) OX=10090 GN=Psap PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	null	240-UNIMOD:4,94-UNIMOD:4,106-UNIMOD:4,63-UNIMOD:4,66-UNIMOD:4	0.08	23.0	7	4	1
PRT	sp|Q99K67|AASS_MOUSE	Alpha-aminoadipic semialdehyde synthase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Aass PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	null	342-UNIMOD:4,765-UNIMOD:4	0.10	23.0	7	7	7
PRT	sp|P62827|RAN_MOUSE	GTP-binding nuclear protein Ran OS=Mus musculus (Mouse) OX=10090 GN=Ran PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	23.0	null	2-UNIMOD:1	0.16	23.0	4	3	2
PRT	sp|Q9CZ42|NNRD_MOUSE	ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Mus musculus (Mouse) OX=10090 GN=Naxd PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|A2ARV4|LRP2_MOUSE	Low-density lipoprotein receptor-related protein 2 OS=Mus musculus (Mouse) OX=10090 GN=Lrp2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	null	190-UNIMOD:4,195-UNIMOD:4	0.03	23.0	12	10	8
PRT	sp|Q9WUR9|KAD4_MOUSE	Adenylate kinase 4, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Ak4 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.24	23.0	6	4	2
PRT	sp|Q64462|CP4B1_MOUSE	Cytochrome P450 4B1 OS=Mus musculus (Mouse) OX=10090 GN=Cyp4b1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	23.0	null	453-UNIMOD:4,470-UNIMOD:4,250-UNIMOD:4	0.26	23.0	15	12	10
PRT	sp|Q8BWF0|SSDH_MOUSE	Succinate-semialdehyde dehydrogenase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Aldh5a1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	null	328-UNIMOD:4,330-UNIMOD:4,81-UNIMOD:4	0.09	23.0	5	4	3
PRT	sp|Q5U5V2|HYKK_MOUSE	Hydroxylysine kinase OS=Mus musculus (Mouse) OX=10090 GN=Hykk PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	23.0	null	2-UNIMOD:1,102-UNIMOD:4	0.27	23.0	13	9	5
PRT	sp|P16675|PPGB_MOUSE	Lysosomal protective protein OS=Mus musculus (Mouse) OX=10090 GN=Ctsa PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.09	23.0	4	3	2
PRT	sp|Q6ZQ38|CAND1_MOUSE	Cullin-associated NEDD8-dissociated protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Cand1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|P50516|VATA_MOUSE	V-type proton ATPase catalytic subunit A OS=Mus musculus (Mouse) OX=10090 GN=Atp6v1a PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.21	23.0	14	12	10
PRT	sp|Q99LB2|DHRS4_MOUSE	Dehydrogenase/reductase SDR family member 4 OS=Mus musculus (Mouse) OX=10090 GN=Dhrs4 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	null	89-UNIMOD:4,210-UNIMOD:4	0.27	23.0	7	5	3
PRT	sp|Q9DAW9|CNN3_MOUSE	Calponin-3 OS=Mus musculus (Mouse) OX=10090 GN=Cnn3 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	null	59-UNIMOD:4	0.04	23.0	1	1	1
PRT	sp|P45376|ALDR_MOUSE	Aldo-keto reductase family 1 member B1 OS=Mus musculus (Mouse) OX=10090 GN=Akr1b1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	23.0	null	2-UNIMOD:1,45-UNIMOD:4,299-UNIMOD:4,304-UNIMOD:4,81-UNIMOD:4,200-UNIMOD:4	0.37	23.0	16	12	8
PRT	sp|Q91YR1|TWF1_MOUSE	Twinfilin-1 OS=Mus musculus (Mouse) OX=10090 GN=Twf1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	23.0	null	2-UNIMOD:1	0.08	23.0	2	2	2
PRT	sp|Q8VDG5|PPCS_MOUSE	Phosphopantothenate--cysteine ligase OS=Mus musculus (Mouse) OX=10090 GN=Ppcs PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.05	23.0	1	1	1
PRT	sp|O55029|COPB2_MOUSE	Coatomer subunit beta' OS=Mus musculus (Mouse) OX=10090 GN=Copb2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|P10648|GSTA2_MOUSE	Glutathione S-transferase A2 OS=Mus musculus (Mouse) OX=10090 GN=Gsta2 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	22.0	null	2-UNIMOD:1	0.11	22.0	2	2	2
PRT	sp|Q9D3D9|ATPD_MOUSE	ATP synthase subunit delta, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Atp5f1d PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.09	22.0	1	1	1
PRT	sp|Q9DBP5|KCY_MOUSE	UMP-CMP kinase OS=Mus musculus (Mouse) OX=10090 GN=Cmpk1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.31	22.0	7	6	5
PRT	tr|D3Z5G7|D3Z5G7_MOUSE	Carboxylic ester hydrolase OS=Mus musculus (Mouse) OX=10090 GN=Ces1b PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.04	22.0	2	2	2
PRT	sp|Q61171|PRDX2_MOUSE	Peroxiredoxin-2 OS=Mus musculus (Mouse) OX=10090 GN=Prdx2 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	22.0	null	2-UNIMOD:1	0.30	22.0	10	5	0
PRT	sp|Q9DCU9|HOGA1_MOUSE	4-hydroxy-2-oxoglutarate aldolase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Hoga1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.06	22.0	2	2	2
PRT	sp|Q60692|PSB6_MOUSE	Proteasome subunit beta type-6 OS=Mus musculus (Mouse) OX=10090 GN=Psmb6 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.10	22.0	3	2	1
PRT	sp|Q8K0E8|FIBB_MOUSE	Fibrinogen beta chain OS=Mus musculus (Mouse) OX=10090 GN=Fgb PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|Q8K4Z3|NNRE_MOUSE	NAD(P)H-hydrate epimerase OS=Mus musculus (Mouse) OX=10090 GN=Naxe PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	null	152-UNIMOD:4	0.06	22.0	1	1	1
PRT	sp|P16546|SPTN1_MOUSE	Spectrin alpha chain, non-erythrocytic 1 OS=Mus musculus (Mouse) OX=10090 GN=Sptan1 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.10	22.0	24	21	18
PRT	sp|P70290|EM55_MOUSE	55 kDa erythrocyte membrane protein OS=Mus musculus (Mouse) OX=10090 GN=Mpp1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null	242-UNIMOD:4	0.05	22.0	1	1	1
PRT	sp|Q99KR3|LACB2_MOUSE	Endoribonuclease LACTB2 OS=Mus musculus (Mouse) OX=10090 GN=Lactb2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	22.0	null	100-UNIMOD:4,21-UNIMOD:4,2-UNIMOD:1	0.38	22.0	15	9	4
PRT	sp|Q9CWF2|TBB2B_MOUSE	Tubulin beta-2B chain OS=Mus musculus (Mouse) OX=10090 GN=Tubb2b PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|Q9DBE0|CSAD_MOUSE	Cysteine sulfinic acid decarboxylase OS=Mus musculus (Mouse) OX=10090 GN=Csad PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	22.0	null	44-UNIMOD:4,328-UNIMOD:4,54-UNIMOD:28	0.20	22.0	12	9	7
PRT	sp|Q9QZ88|VPS29_MOUSE	Vacuolar protein sorting-associated protein 29 OS=Mus musculus (Mouse) OX=10090 GN=Vps29 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null	36-UNIMOD:4,41-UNIMOD:4	0.14	22.0	2	2	2
PRT	sp|P62960|YBOX1_MOUSE	Y-box-binding protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Ybx1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.06	22.0	1	1	1
PRT	sp|P80313|TCPH_MOUSE	T-complex protein 1 subunit eta OS=Mus musculus (Mouse) OX=10090 GN=Cct7 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q62261|SPTB2_MOUSE	Spectrin beta chain, non-erythrocytic 1 OS=Mus musculus (Mouse) OX=10090 GN=Sptbn1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null	2261-UNIMOD:4,1389-UNIMOD:4	0.11	22.0	22	21	20
PRT	sp|Q99L47|F10A1_MOUSE	Hsc70-interacting protein OS=Mus musculus (Mouse) OX=10090 GN=St13 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.08	22.0	4	3	2
PRT	sp|P61922|GABT_MOUSE	4-aminobutyrate aminotransferase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Abat PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null	321-UNIMOD:4,334-UNIMOD:4,224-UNIMOD:4	0.18	22.0	9	7	5
PRT	sp|Q9R1P4|PSA1_MOUSE	Proteasome subunit alpha type-1 OS=Mus musculus (Mouse) OX=10090 GN=Psma1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.11	22.0	2	2	2
PRT	tr|E9Q6L7|E9Q6L7_MOUSE	Glutathione S-transferase OS=Mus musculus (Mouse) OX=10090 GN=Gm10639 PE=3 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.24	22.0	9	6	3
PRT	tr|A0A087WP24|A0A087WP24_MOUSE	Isoform of Q8VCR7, AB hydrolase-1 domain-containing protein (Fragment) OS=Mus musculus (Mouse) OX=10090 GN=Abhd14b PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.07	22.0	1	1	1
PRT	sp|Q9DB29|IAH1_MOUSE	Isoamyl acetate-hydrolyzing esterase 1 homolog OS=Mus musculus (Mouse) OX=10090 GN=Iah1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	22.0	null	47-UNIMOD:4,137-UNIMOD:4	0.20	22.0	6	4	2
PRT	sp|O35381|AN32A_MOUSE	Acidic leucine-rich nuclear phosphoprotein 32 family member A OS=Mus musculus (Mouse) OX=10090 GN=Anp32a PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null	123-UNIMOD:4	0.26	22.0	5	5	5
PRT	sp|Q91WU0|CES1F_MOUSE	Carboxylesterase 1F OS=Mus musculus (Mouse) OX=10090 GN=Ces1f PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	22.0	null	273-UNIMOD:4,284-UNIMOD:4,287-UNIMOD:28	0.20	22.0	10	8	6
PRT	sp|P16332|MUTA_MOUSE	Methylmalonyl-CoA mutase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Mmut PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.05	22.0	3	3	3
PRT	sp|O35943|FRDA_MOUSE	Frataxin, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Fxn PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.06	22.0	1	1	1
PRT	sp|A2BIM8|MUP18_MOUSE	Major urinary protein 18 OS=Mus musculus (Mouse) OX=10090 GN=Mup18 PE=3 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null	157-UNIMOD:4	0.40	22.0	11	7	4
PRT	sp|Q60932|VDAC1_MOUSE	Voltage-dependent anion-selective channel protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Vdac1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.10	22.0	2	2	2
PRT	sp|Q80X90|FLNB_MOUSE	Filamin-B OS=Mus musculus (Mouse) OX=10090 GN=Flnb PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null	1434-UNIMOD:4	0.01	22.0	2	2	2
PRT	sp|P25444|RS2_MOUSE	40S ribosomal protein S2 OS=Mus musculus (Mouse) OX=10090 GN=Rps2 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.09	22.0	2	2	2
PRT	sp|O35643|AP1B1_MOUSE	AP-1 complex subunit beta-1 OS=Mus musculus (Mouse) OX=10090 GN=Ap1b1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null	241-UNIMOD:4,95-UNIMOD:4	0.06	22.0	5	5	5
PRT	sp|P46412|GPX3_MOUSE	Glutathione peroxidase 3 OS=Mus musculus (Mouse) OX=10090 GN=Gpx3 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null	156-UNIMOD:4	0.14	22.0	4	2	1
PRT	sp|P99027|RLA2_MOUSE	60S acidic ribosomal protein P2 OS=Mus musculus (Mouse) OX=10090 GN=Rplp2 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.15	22.0	3	1	0
PRT	sp|P20029|BIP_MOUSE	Endoplasmic reticulum chaperone BiP OS=Mus musculus (Mouse) OX=10090 GN=Hspa5 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.16	22.0	9	7	5
PRT	sp|P30681|HMGB2_MOUSE	High mobility group protein B2 OS=Mus musculus (Mouse) OX=10090 GN=Hmgb2 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null	23-UNIMOD:4	0.06	22.0	1	1	1
PRT	sp|Q9WVA4|TAGL2_MOUSE	Transgelin-2 OS=Mus musculus (Mouse) OX=10090 GN=Tagln2 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.19	22.0	6	3	1
PRT	sp|Q60928|GGT1_MOUSE	Glutathione hydrolase 1 proenzyme OS=Mus musculus (Mouse) OX=10090 GN=Ggt1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.05	22.0	2	2	2
PRT	sp|P49722|PSA2_MOUSE	Proteasome subunit alpha type-2 OS=Mus musculus (Mouse) OX=10090 GN=Psma2 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.06	22.0	1	1	1
PRT	tr|D3Z298|D3Z298_MOUSE	Carboxylic ester hydrolase OS=Mus musculus (Mouse) OX=10090 GN=Ces1h PE=3 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.02	22.0	2	1	0
PRT	sp|Q9R0M5|TPK1_MOUSE	Thiamin pyrophosphokinase 1 OS=Mus musculus (Mouse) OX=10090 GN=Tpk1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null	20-UNIMOD:4	0.06	22.0	2	1	0
PRT	tr|G3X9G9|G3X9G9_MOUSE	Methyltransferase-like 7A3 OS=Mus musculus (Mouse) OX=10090 GN=Mettl7a3 PE=4 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null	79-UNIMOD:4,96-UNIMOD:4	0.12	22.0	4	2	0
PRT	sp|P26040|EZRI_MOUSE	Ezrin OS=Mus musculus (Mouse) OX=10090 GN=Ezr PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1000663, ProteinPilot, ]	22.0	null		0.15	22.0	14	9	5
PRT	tr|A0A0A6YW67|A0A0A6YW67_MOUSE	Predicted pseudogene 8797 OS=Mus musculus (Mouse) OX=10090 GN=Gm8797 PE=4 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.22	22.0	2	1	0
PRT	sp|Q8JZZ0|UD3A2_MOUSE	UDP-glucuronosyltransferase 3A2 OS=Mus musculus (Mouse) OX=10090 GN=Ugt3a2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null	120-UNIMOD:4	0.12	22.0	5	5	5
PRT	sp|Q8VCM7|FIBG_MOUSE	Fibrinogen gamma chain OS=Mus musculus (Mouse) OX=10090 GN=Fgg PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null	160-UNIMOD:4,164-UNIMOD:4,33-UNIMOD:4,34-UNIMOD:4	0.14	22.0	4	4	4
PRT	sp|Q60759|GCDH_MOUSE	Glutaryl-CoA dehydrogenase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Gcdh PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	22.0	null	228-UNIMOD:4,232-UNIMOD:4,176-UNIMOD:4	0.16	22.0	4	4	4
PRT	sp|P27773|PDIA3_MOUSE	Protein disulfide-isomerase A3 OS=Mus musculus (Mouse) OX=10090 GN=Pdia3 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null	85-UNIMOD:4,92-UNIMOD:4	0.29	22.0	15	12	9
PRT	sp|Q9WTP6|KAD2_MOUSE	Adenylate kinase 2, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Ak2 PE=1 SV=5	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	22.0	null	40-UNIMOD:4,42-UNIMOD:4	0.32	22.0	6	6	6
PRT	sp|O88587|COMT_MOUSE	Catechol O-methyltransferase OS=Mus musculus (Mouse) OX=10090 GN=Comt PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.12	22.0	2	2	2
PRT	sp|P51855|GSHB_MOUSE	Glutathione synthetase OS=Mus musculus (Mouse) OX=10090 GN=Gss PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	22.0	null	2-UNIMOD:1	0.23	22.0	12	11	10
PRT	sp|Q9WVM8|AADAT_MOUSE	Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Aadat PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.18	22.0	7	6	5
PRT	sp|Q8CAY6|THIC_MOUSE	Acetyl-CoA acetyltransferase, cytosolic OS=Mus musculus (Mouse) OX=10090 GN=Acat2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	null	360-UNIMOD:4	0.09	22.0	2	2	2
PRT	sp|P15626|GSTM2_MOUSE	Glutathione S-transferase Mu 2 OS=Mus musculus (Mouse) OX=10090 GN=Gstm2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.07	22.0	2	1	0
PRT	sp|P16045|LEG1_MOUSE	Galectin-1 OS=Mus musculus (Mouse) OX=10090 GN=Lgals1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	21.0	null	2-UNIMOD:1,3-UNIMOD:4,17-UNIMOD:4,61-UNIMOD:4,43-UNIMOD:4	0.42	21.0	4	4	4
PRT	sp|Q11136|PEPD_MOUSE	Xaa-Pro dipeptidase OS=Mus musculus (Mouse) OX=10090 GN=Pepd PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null	158-UNIMOD:4	0.02	21.0	1	1	1
PRT	sp|Q64436|ATP4A_MOUSE	Potassium-transporting ATPase alpha chain 1 OS=Mus musculus (Mouse) OX=10090 GN=Atp4a PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|O35945|AL1A7_MOUSE	Aldehyde dehydrogenase, cytosolic 1 OS=Mus musculus (Mouse) OX=10090 GN=Aldh1a7 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.02	21.0	1	1	0
PRT	sp|Q9D0J8|PTMS_MOUSE	Parathymosin OS=Mus musculus (Mouse) OX=10090 GN=Ptms PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.25	21.0	5	3	2
PRT	sp|Q8R1G2|CMBL_MOUSE	Carboxymethylenebutenolidase homolog OS=Mus musculus (Mouse) OX=10090 GN=Cmbl PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null	198-UNIMOD:4	0.09	21.0	2	2	2
PRT	sp|P27659|RL3_MOUSE	60S ribosomal protein L3 OS=Mus musculus (Mouse) OX=10090 GN=Rpl3 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.03	21.0	1	1	1
PRT	tr|D3Z2H9|D3Z2H9_MOUSE	Tropomyosin 3, related sequence 7 OS=Mus musculus (Mouse) OX=10090 GN=Tpm3-rs7 PE=3 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.28	21.0	10	8	6
PRT	sp|P62281|RS11_MOUSE	40S ribosomal protein S11 OS=Mus musculus (Mouse) OX=10090 GN=Rps11 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	21.0	null	60-UNIMOD:4,2-UNIMOD:1,131-UNIMOD:4	0.37	21.0	5	5	5
PRT	sp|P80314|TCPB_MOUSE	T-complex protein 1 subunit beta OS=Mus musculus (Mouse) OX=10090 GN=Cct2 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null	289-UNIMOD:4	0.07	21.0	4	3	2
PRT	sp|O55234|PSB5_MOUSE	Proteasome subunit beta type-5 OS=Mus musculus (Mouse) OX=10090 GN=Psmb5 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.15	21.0	4	3	2
PRT	sp|Q9CR51|VATG1_MOUSE	V-type proton ATPase subunit G 1 OS=Mus musculus (Mouse) OX=10090 GN=Atp6v1g1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.10	21.0	2	1	0
PRT	tr|E9Q0S6|E9Q0S6_MOUSE	Tensin 1 OS=Mus musculus (Mouse) OX=10090 GN=Tns1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q6IRU2|TPM4_MOUSE	Tropomyosin alpha-4 chain OS=Mus musculus (Mouse) OX=10090 GN=Tpm4 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.14	21.0	3	3	3
PRT	sp|Q9DCT1|AKCL2_MOUSE	1,5-anhydro-D-fructose reductase OS=Mus musculus (Mouse) OX=10090 GN=Akr1e2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.03	21.0	5	1	0
PRT	tr|E9Q7L0|E9Q7L0_MOUSE	Transket_pyr domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Ogdhl PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null	513-UNIMOD:4	0.04	21.0	4	4	4
PRT	sp|Q9CQX8|RT36_MOUSE	28S ribosomal protein S36, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Mrps36 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.25	21.0	2	1	0
PRT	sp|P67984|RL22_MOUSE	60S ribosomal protein L22 OS=Mus musculus (Mouse) OX=10090 GN=Rpl22 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.20	21.0	3	2	1
PRT	sp|P48758|CBR1_MOUSE	Carbonyl reductase [NADPH] 1 OS=Mus musculus (Mouse) OX=10090 GN=Cbr1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	21.0	null	2-UNIMOD:1	0.24	21.0	5	5	5
PRT	sp|P61982|1433G_MOUSE	14-3-3 protein gamma OS=Mus musculus (Mouse) OX=10090 GN=Ywhag PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	21.0	null	2-UNIMOD:1	0.26	21.0	6	6	6
PRT	sp|Q9DCM0|ETHE1_MOUSE	Persulfide dioxygenase ETHE1, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Ethe1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null	98-UNIMOD:4,170-UNIMOD:4	0.22	21.0	6	5	4
PRT	sp|P29595|NEDD8_MOUSE	NEDD8 OS=Mus musculus (Mouse) OX=10090 GN=Nedd8 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.19	21.0	1	1	1
PRT	sp|Q8K009|AL1L2_MOUSE	Mitochondrial 10-formyltetrahydrofolate dehydrogenase OS=Mus musculus (Mouse) OX=10090 GN=Aldh1l2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null	728-UNIMOD:4	0.06	21.0	6	5	4
PRT	sp|Q9CXN7|PBLD2_MOUSE	Phenazine biosynthesis-like domain-containing protein 2 OS=Mus musculus (Mouse) OX=10090 GN=Pbld2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null	24-UNIMOD:4	0.11	21.0	5	3	1
PRT	sp|Q2TPA8|HSDL2_MOUSE	Hydroxysteroid dehydrogenase-like protein 2 OS=Mus musculus (Mouse) OX=10090 GN=Hsdl2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null	11-UNIMOD:4	0.03	21.0	2	1	0
PRT	sp|Q9CZN7|GLYM_MOUSE	Serine hydroxymethyltransferase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Shmt2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null	91-UNIMOD:4,80-UNIMOD:4	0.15	21.0	8	7	6
PRT	sp|P15105|GLNA_MOUSE	Glutamine synthetase OS=Mus musculus (Mouse) OX=10090 GN=Glul PE=1 SV=6	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	21.0	null	346-UNIMOD:4,2-UNIMOD:1,183-UNIMOD:4,269-UNIMOD:4	0.20	21.0	8	6	4
PRT	sp|Q8VCA8|SCRN2_MOUSE	Secernin-2 OS=Mus musculus (Mouse) OX=10090 GN=Scrn2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null	59-UNIMOD:4,277-UNIMOD:4	0.18	21.0	7	5	3
PRT	sp|O08553|DPYL2_MOUSE	Dihydropyrimidinase-related protein 2 OS=Mus musculus (Mouse) OX=10090 GN=Dpysl2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.08	21.0	4	3	2
PRT	sp|Q9WVE8|PACN2_MOUSE	Protein kinase C and casein kinase substrate in neurons protein 2 OS=Mus musculus (Mouse) OX=10090 GN=Pacsin2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null	465-UNIMOD:4	0.08	21.0	3	3	3
PRT	sp|Q9QUM9|PSA6_MOUSE	Proteasome subunit alpha type-6 OS=Mus musculus (Mouse) OX=10090 GN=Psma6 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null	78-UNIMOD:4	0.12	21.0	2	2	2
PRT	sp|P62746|RHOB_MOUSE	Rho-related GTP-binding protein RhoB OS=Mus musculus (Mouse) OX=10090 GN=Rhob PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null	20-UNIMOD:4	0.05	21.0	1	1	1
PRT	sp|Q9R0N0|GALK1_MOUSE	Galactokinase OS=Mus musculus (Mouse) OX=10090 GN=Galk1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|Q8BP67|RL24_MOUSE	60S ribosomal protein L24 OS=Mus musculus (Mouse) OX=10090 GN=Rpl24 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.09	21.0	2	1	0
PRT	sp|G5E8K5|ANK3_MOUSE	Ankyrin-3 OS=Mus musculus (Mouse) OX=10090 GN=Ank3 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|P28474|ADHX_MOUSE	Alcohol dehydrogenase class-3 OS=Mus musculus (Mouse) OX=10090 GN=Adh5 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	21.0	null	170-UNIMOD:4,174-UNIMOD:4,2-UNIMOD:1	0.21	21.0	8	7	6
PRT	sp|Q3UGR5|HDHD2_MOUSE	Haloacid dehalogenase-like hydrolase domain-containing protein 2 OS=Mus musculus (Mouse) OX=10090 GN=Hdhd2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.05	21.0	1	1	1
PRT	sp|P14869|RLA0_MOUSE	60S acidic ribosomal protein P0 OS=Mus musculus (Mouse) OX=10090 GN=Rplp0 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null	27-UNIMOD:4	0.15	21.0	4	4	4
PRT	sp|Q8BH86|GLUCM_MOUSE	D-glutamate cyclase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Dglucy PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null	97-UNIMOD:4	0.12	21.0	5	5	5
PRT	sp|Q3TLP5|ECHD2_MOUSE	Enoyl-CoA hydratase domain-containing protein 2, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Echdc2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null	95-UNIMOD:4	0.21	21.0	5	4	3
PRT	tr|A0A5F8MPY2|A0A5F8MPY2_MOUSE	Uncharacterized protein OS=Mus musculus (Mouse) OX=10090 GN=ENSMUSG00000118552 PE=3 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.55	21.0	3	3	3
PRT	sp|P68369|TBA1A_MOUSE	Tubulin alpha-1A chain OS=Mus musculus (Mouse) OX=10090 GN=Tuba1a PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	null	85-UNIMOD:28	0.05	21.0	1	1	1
PRT	sp|P05214|TBA3_MOUSE	Tubulin alpha-3 chain OS=Mus musculus (Mouse) OX=10090 GN=Tuba3a PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null	347-UNIMOD:4	0.03	21.0	3	2	1
PRT	sp|Q8JZN5|ACAD9_MOUSE	Complex I assembly factor ACAD9, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Acad9 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|Q9DBK0|ACO12_MOUSE	Acetyl-coenzyme A thioesterase OS=Mus musculus (Mouse) OX=10090 GN=Acot12 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null	540-UNIMOD:4	0.06	21.0	2	2	2
PRT	sp|P46656|ADX_MOUSE	Adrenodoxin, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Fdx1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.05	21.0	1	1	1
PRT	sp|P62196|PRS8_MOUSE	26S proteasome regulatory subunit 8 OS=Mus musculus (Mouse) OX=10090 GN=Psmc5 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|P10605|CATB_MOUSE	Cathepsin B OS=Mus musculus (Mouse) OX=10090 GN=Ctsb PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null	93-UNIMOD:4,211-UNIMOD:4,319-UNIMOD:4	0.25	20.0	8	6	4
PRT	tr|A0A0R4J083|A0A0R4J083_MOUSE	Isoform of P51174, Long-chain-specific acyl-CoA dehydrogenase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Acadl PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	20.0	null	96-UNIMOD:28	0.05	20.0	3	2	1
PRT	sp|Q9CQR4|ACO13_MOUSE	Acyl-coenzyme A thioesterase 13 OS=Mus musculus (Mouse) OX=10090 GN=Acot13 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.08	20.0	2	1	0
PRT	sp|Q99JW2|ACY1_MOUSE	Aminoacylase-1 OS=Mus musculus (Mouse) OX=10090 GN=Acy1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null	23-UNIMOD:4	0.16	20.0	6	5	4
PRT	sp|P28738|KIF5C_MOUSE	Kinesin heavy chain isoform 5C OS=Mus musculus (Mouse) OX=10090 GN=Kif5c PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.03	20.0	2	2	2
PRT	sp|Q3UZZ6|ST1D1_MOUSE	Sulfotransferase 1 family member D1 OS=Mus musculus (Mouse) OX=10090 GN=Sult1d1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.25	20.0	10	6	2
PRT	sp|Q9CQ60|6PGL_MOUSE	6-phosphogluconolactonase OS=Mus musculus (Mouse) OX=10090 GN=Pgls PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null	236-UNIMOD:4	0.17	20.0	3	3	3
PRT	sp|Q9D1A2|CNDP2_MOUSE	Cytosolic non-specific dipeptidase OS=Mus musculus (Mouse) OX=10090 GN=Cndp2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.25	20.0	10	9	8
PRT	sp|Q8BMS1|ECHA_MOUSE	Trifunctional enzyme subunit alpha, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Hadha PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.06	20.0	3	3	3
PRT	sp|Q9DCQ2|ASPD_MOUSE	Putative L-aspartate dehydrogenase OS=Mus musculus (Mouse) OX=10090 GN=Aspdh PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|Q3UFF7|LYPL1_MOUSE	Lysophospholipase-like protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Lyplal1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	20.0	null	2-UNIMOD:1	0.17	20.0	3	3	3
PRT	sp|P62717|RL18A_MOUSE	60S ribosomal protein L18a OS=Mus musculus (Mouse) OX=10090 GN=Rpl18a PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null	109-UNIMOD:4,64-UNIMOD:4	0.16	20.0	2	2	2
PRT	sp|Q9QYB1|CLIC4_MOUSE	Chloride intracellular channel protein 4 OS=Mus musculus (Mouse) OX=10090 GN=Clic4 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null	35-UNIMOD:4,234-UNIMOD:4	0.29	20.0	9	6	3
PRT	sp|Q91X72|HEMO_MOUSE	Hemopexin OS=Mus musculus (Mouse) OX=10090 GN=Hpx PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null	199-UNIMOD:4,406-UNIMOD:4	0.10	20.0	5	4	3
PRT	sp|P13020|GELS_MOUSE	Gelsolin OS=Mus musculus (Mouse) OX=10090 GN=Gsn PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.03	20.0	2	2	2
PRT	sp|Q60668|HNRPD_MOUSE	Heterogeneous nuclear ribonucleoprotein D0 OS=Mus musculus (Mouse) OX=10090 GN=Hnrnpd PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.04	20.0	2	1	0
PRT	sp|Q9QXG4|ACSA_MOUSE	Acetyl-coenzyme A synthetase, cytoplasmic OS=Mus musculus (Mouse) OX=10090 GN=Acss2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null	104-UNIMOD:4	0.05	20.0	3	3	3
PRT	sp|P97372|PSME2_MOUSE	Proteasome activator complex subunit 2 OS=Mus musculus (Mouse) OX=10090 GN=Psme2 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.06	20.0	1	1	1
PRT	sp|Q9EQ06|DHB11_MOUSE	Estradiol 17-beta-dehydrogenase 11 OS=Mus musculus (Mouse) OX=10090 GN=Hsd17b11 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|P62267|RS23_MOUSE	40S ribosomal protein S23 OS=Mus musculus (Mouse) OX=10090 GN=Rps23 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.08	20.0	1	1	1
PRT	sp|P59999|ARPC4_MOUSE	Actin-related protein 2/3 complex subunit 4 OS=Mus musculus (Mouse) OX=10090 GN=Arpc4 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.20	20.0	4	3	2
PRT	sp|Q3UP75|UD3A1_MOUSE	UDP-glucuronosyltransferase 3A1 OS=Mus musculus (Mouse) OX=10090 GN=Ugt3a1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.02	20.0	2	1	0
PRT	sp|P46664|PURA2_MOUSE	Adenylosuccinate synthetase isozyme 2 OS=Mus musculus (Mouse) OX=10090 GN=Adss2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null	58-UNIMOD:4	0.06	20.0	2	2	2
PRT	sp|P61089|UBE2N_MOUSE	Ubiquitin-conjugating enzyme E2 N OS=Mus musculus (Mouse) OX=10090 GN=Ube2n PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.29	20.0	4	3	2
PRT	tr|Q80X81|Q80X81_MOUSE	Acetyl-Coenzyme A acetyltransferase 3 OS=Mus musculus (Mouse) OX=10090 GN=Acat3 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null	65-UNIMOD:4,360-UNIMOD:4	0.15	20.0	3	3	3
PRT	tr|Q91WT7|Q91WT7_MOUSE	Aldo_ket_red domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Akr1c14 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null	145-UNIMOD:4	0.10	20.0	2	2	2
PRT	sp|P47754|CAZA2_MOUSE	F-actin-capping protein subunit alpha-2 OS=Mus musculus (Mouse) OX=10090 GN=Capza2 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	20.0	null	2-UNIMOD:1	0.17	20.0	3	3	3
PRT	sp|Q8BGA8|ACSM5_MOUSE	Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Acsm5 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null	342-UNIMOD:4	0.08	20.0	3	3	3
PRT	sp|P47962|RL5_MOUSE	60S ribosomal protein L5 OS=Mus musculus (Mouse) OX=10090 GN=Rpl5 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.08	20.0	2	2	2
PRT	sp|Q571I9|A16A1_MOUSE	Aldehyde dehydrogenase family 16 member A1 OS=Mus musculus (Mouse) OX=10090 GN=Aldh16a1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q80XR2|AT2C1_MOUSE	Calcium-transporting ATPase type 2C member 1 OS=Mus musculus (Mouse) OX=10090 GN=Atp2c1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null	436-UNIMOD:35	0.02	20.0	1	1	1
PRT	sp|P14211|CALR_MOUSE	Calreticulin OS=Mus musculus (Mouse) OX=10090 GN=Calr PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null	105-UNIMOD:4	0.15	19.0	9	7	6
PRT	sp|P02802|MT1_MOUSE	Metallothionein-1 OS=Mus musculus (Mouse) OX=10090 GN=Mt1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null	33-UNIMOD:4,34-UNIMOD:4,36-UNIMOD:4,37-UNIMOD:4,41-UNIMOD:4	0.21	19.0	1	1	1
PRT	sp|O35660|GSTM6_MOUSE	Glutathione S-transferase Mu 6 OS=Mus musculus (Mouse) OX=10090 GN=Gstm6 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null	87-UNIMOD:4	0.10	19.0	4	3	2
PRT	sp|Q5FWK3|RHG01_MOUSE	Rho GTPase-activating protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Arhgap1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.07	19.0	3	3	3
PRT	sp|P48036|ANXA5_MOUSE	Annexin A5 OS=Mus musculus (Mouse) OX=10090 GN=Anxa5 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null	314-UNIMOD:4	0.13	19.0	5	4	3
PRT	sp|Q91X91|NADC_MOUSE	Nicotinate-nucleotide pyrophosphorylase [carboxylating] OS=Mus musculus (Mouse) OX=10090 GN=Qprt PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	19.0	null	159-UNIMOD:4,111-UNIMOD:385,111-UNIMOD:4	0.19	19.0	4	4	4
PRT	sp|P62908|RS3_MOUSE	40S ribosomal protein S3 OS=Mus musculus (Mouse) OX=10090 GN=Rps3 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null	134-UNIMOD:4,97-UNIMOD:4	0.23	19.0	7	5	3
PRT	tr|Q91VA7|Q91VA7_MOUSE	Isocitrate dehydrogenase [NAD] subunit, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Idh3b PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.32	19.0	9	9	9
PRT	sp|Q8VCT4|CES1D_MOUSE	Carboxylesterase 1D OS=Mus musculus (Mouse) OX=10090 GN=Ces1d PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.11	19.0	6	5	4
PRT	sp|Q9QXN5|MIOX_MOUSE	Inositol oxygenase OS=Mus musculus (Mouse) OX=10090 GN=Miox PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	19.0	null		0.09	19.0	4	2	0
PRT	sp|Q9CZU6|CISY_MOUSE	Citrate synthase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Cs PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.06	19.0	5	3	1
PRT	sp|Q6P069|SORCN_MOUSE	Sorcin OS=Mus musculus (Mouse) OX=10090 GN=Sri PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null	162-UNIMOD:4,163-UNIMOD:4	0.17	19.0	3	3	3
PRT	sp|P35278|RAB5C_MOUSE	Ras-related protein Rab-5C OS=Mus musculus (Mouse) OX=10090 GN=Rab5c PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.17	19.0	3	3	3
PRT	tr|E9Q453|E9Q453_MOUSE	Isoform of P58771, Tropomyosin alpha-1 chain OS=Mus musculus (Mouse) OX=10090 GN=Tpm1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.05	19.0	1	1	1
PRT	sp|Q99020|ROAA_MOUSE	Heterogeneous nuclear ribonucleoprotein A/B OS=Mus musculus (Mouse) OX=10090 GN=Hnrnpab PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null	104-UNIMOD:4	0.14	19.0	3	3	3
PRT	sp|P40124|CAP1_MOUSE	Adenylyl cyclase-associated protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Cap1 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null	92-UNIMOD:4	0.06	19.0	2	2	2
PRT	sp|Q9D7B6|ACAD8_MOUSE	Isobutyryl-CoA dehydrogenase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Acad8 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q9Z1Z0|USO1_MOUSE	General vesicular transport factor p115 OS=Mus musculus (Mouse) OX=10090 GN=Uso1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null	802-UNIMOD:4	0.03	19.0	2	2	2
PRT	sp|Q7TPR4|ACTN1_MOUSE	Alpha-actinin-1 OS=Mus musculus (Mouse) OX=10090 GN=Actn1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null	480-UNIMOD:4	0.04	19.0	3	3	3
PRT	sp|Q62093|SRSF2_MOUSE	Serine/arginine-rich splicing factor 2 OS=Mus musculus (Mouse) OX=10090 GN=Srsf2 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.04	19.0	1	1	1
PRT	sp|Q8R4N0|CLYBL_MOUSE	Citramalyl-CoA lyase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Clybl PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.09	19.0	3	3	3
PRT	sp|P60843|IF4A1_MOUSE	Eukaryotic initiation factor 4A-I OS=Mus musculus (Mouse) OX=10090 GN=Eif4a1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.06	19.0	2	2	2
PRT	tr|A0A3B2W820|A0A3B2W820_MOUSE	Isoform of P53026, 60S ribosomal protein L10a OS=Mus musculus (Mouse) OX=10090 GN=Rpl10a PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null	66-UNIMOD:4,74-UNIMOD:4	0.14	19.0	1	1	1
PRT	sp|Q9CXW4|RL11_MOUSE	60S ribosomal protein L11 OS=Mus musculus (Mouse) OX=10090 GN=Rpl11 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.06	19.0	1	1	1
PRT	tr|A0A087WPX1|A0A087WPX1_MOUSE	Isoform of Q99JW2, Aminoacylase-1 (Fragment) OS=Mus musculus (Mouse) OX=10090 GN=Acy1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.09	19.0	1	1	1
PRT	sp|Q9R0Y5|KAD1_MOUSE	Adenylate kinase isoenzyme 1 OS=Mus musculus (Mouse) OX=10090 GN=Ak1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.07	19.0	1	1	1
PRT	sp|O08756|HCD2_MOUSE	3-hydroxyacyl-CoA dehydrogenase type-2 OS=Mus musculus (Mouse) OX=10090 GN=Hsd17b10 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null	58-UNIMOD:4	0.25	19.0	7	5	4
PRT	sp|Q9CWM4|PFD1_MOUSE	Prefoldin subunit 1 OS=Mus musculus (Mouse) OX=10090 GN=Pfdn1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.10	19.0	1	1	1
PRT	sp|Q9QUI0|RHOA_MOUSE	Transforming protein RhoA OS=Mus musculus (Mouse) OX=10090 GN=Rhoa PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null	159-UNIMOD:4	0.07	19.0	1	1	1
PRT	sp|P80315|TCPD_MOUSE	T-complex protein 1 subunit delta OS=Mus musculus (Mouse) OX=10090 GN=Cct4 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.04	19.0	2	2	2
PRT	sp|Q8BL66|EEA1_MOUSE	Early endosome antigen 1 OS=Mus musculus (Mouse) OX=10090 GN=Eea1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|P30416|FKBP4_MOUSE	Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Mus musculus (Mouse) OX=10090 GN=Fkbp4 PE=1 SV=5	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null	342-UNIMOD:4,396-UNIMOD:4	0.12	19.0	5	5	5
PRT	tr|A2BIN1|A2BIN1_MOUSE	Lipocln_cytosolic_FA-bd_dom domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Mup10 PE=2 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.07	19.0	1	1	1
PRT	sp|Q99JY0|ECHB_MOUSE	Trifunctional enzyme subunit beta, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Hadhb PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.07	19.0	3	3	3
PRT	sp|P50431|GLYC_MOUSE	Serine hydroxymethyltransferase, cytosolic OS=Mus musculus (Mouse) OX=10090 GN=Shmt1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null	374-UNIMOD:4,378-UNIMOD:4	0.05	19.0	2	2	2
PRT	sp|P16858|G3P_MOUSE	Glyceraldehyde-3-phosphate dehydrogenase OS=Mus musculus (Mouse) OX=10090 GN=Gapdh PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	19.0	null	245-UNIMOD:4,262-UNIMOD:28,22-UNIMOD:4	0.13	19.0	6	4	1
PRT	sp|Q9Z204|HNRPC_MOUSE	Heterogeneous nuclear ribonucleoproteins C1/C2 OS=Mus musculus (Mouse) OX=10090 GN=Hnrnpc PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.04	19.0	1	1	1
PRT	sp|Q9JMA1|UBP14_MOUSE	Ubiquitin carboxyl-terminal hydrolase 14 OS=Mus musculus (Mouse) OX=10090 GN=Usp14 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q99K51|PLST_MOUSE	Plastin-3 OS=Mus musculus (Mouse) OX=10090 GN=Pls3 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|P68040|RACK1_MOUSE	Receptor of activated protein C kinase 1 OS=Mus musculus (Mouse) OX=10090 GN=Rack1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null	240-UNIMOD:4,182-UNIMOD:4,153-UNIMOD:4	0.26	19.0	8	6	4
PRT	sp|Q61699|HS105_MOUSE	Heat shock protein 105 kDa OS=Mus musculus (Mouse) OX=10090 GN=Hsph1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.03	19.0	2	2	2
PRT	sp|O88990|ACTN3_MOUSE	Alpha-actinin-3 OS=Mus musculus (Mouse) OX=10090 GN=Actn3 PE=2 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null	345-UNIMOD:4,167-UNIMOD:4,54-UNIMOD:4	0.06	19.0	5	5	5
PRT	sp|Q99KQ4|NAMPT_MOUSE	Nicotinamide phosphoribosyltransferase OS=Mus musculus (Mouse) OX=10090 GN=Nampt PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	19.0	null		0.10	19.0	5	4	3
PRT	sp|P68373|TBA1C_MOUSE	Tubulin alpha-1C chain OS=Mus musculus (Mouse) OX=10090 GN=Tuba1c PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null	295-UNIMOD:4	0.06	19.0	2	1	0
PRT	tr|E9PVU0|E9PVU0_MOUSE	Isoform of Q64331, Unconventional myosin-VI OS=Mus musculus (Mouse) OX=10090 GN=Myo6 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null	362-UNIMOD:4	0.02	19.0	1	1	1
PRT	sp|Q6P1B1|XPP1_MOUSE	Xaa-Pro aminopeptidase 1 OS=Mus musculus (Mouse) OX=10090 GN=Xpnpep1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.09	19.0	5	4	3
PRT	sp|P21107-2|TPM3-2_MOUSE	Isoform of P21107, Isoform 2 of Tropomyosin alpha-3 chain OS=Mus musculus (Mouse) OX=10090 GN=Tpm3 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	null	2-UNIMOD:1	0.05	19.0	1	1	1
PRT	sp|Q8QZS1|HIBCH_MOUSE	3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Hibch PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	19.0	null		0.07	19.0	2	2	2
PRT	sp|O55125|NIPS1_MOUSE	Protein NipSnap homolog 1 OS=Mus musculus (Mouse) OX=10090 GN=Nipsnap1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null	83-UNIMOD:4	0.17	19.0	3	3	3
PRT	sp|P50518|VATE1_MOUSE	V-type proton ATPase subunit E 1 OS=Mus musculus (Mouse) OX=10090 GN=Atp6v1e1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	19.0	null	2-UNIMOD:1	0.12	19.0	3	3	3
PRT	sp|Q9JMD3|STA10_MOUSE	START domain-containing protein 10 OS=Mus musculus (Mouse) OX=10090 GN=Stard10 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null	181-UNIMOD:4	0.09	19.0	2	2	2
PRT	sp|P23927|CRYAB_MOUSE	Alpha-crystallin B chain OS=Mus musculus (Mouse) OX=10090 GN=Cryab PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.05	18.0	1	1	1
PRT	sp|P09813|APOA2_MOUSE	Apolipoprotein A-II OS=Mus musculus (Mouse) OX=10090 GN=Apoa2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.10	18.0	1	1	1
PRT	sp|Q9EPL9|ACOX3_MOUSE	Peroxisomal acyl-coenzyme A oxidase 3 OS=Mus musculus (Mouse) OX=10090 GN=Acox3 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.08	18.0	4	4	4
PRT	sp|Q60870|REEP5_MOUSE	Receptor expression-enhancing protein 5 OS=Mus musculus (Mouse) OX=10090 GN=Reep5 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.06	18.0	1	1	1
PRT	sp|P22599|A1AT2_MOUSE	Alpha-1-antitrypsin 1-2 OS=Mus musculus (Mouse) OX=10090 GN=Serpina1b PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.09	18.0	3	3	3
PRT	sp|P62830|RL23_MOUSE	60S ribosomal protein L23 OS=Mus musculus (Mouse) OX=10090 GN=Rpl23 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.08	18.0	1	1	1
PRT	sp|P11679|K2C8_MOUSE	Keratin, type II cytoskeletal 8 OS=Mus musculus (Mouse) OX=10090 GN=Krt8 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.09	18.0	4	4	4
PRT	sp|Q8QZY1|EIF3L_MOUSE	Eukaryotic translation initiation factor 3 subunit L OS=Mus musculus (Mouse) OX=10090 GN=Eif3l PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.06	18.0	3	3	3
PRT	sp|Q91VW3|SH3L3_MOUSE	SH3 domain-binding glutamic acid-rich-like protein 3 OS=Mus musculus (Mouse) OX=10090 GN=Sh3bgrl3 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.12	18.0	1	1	1
PRT	sp|P23953|EST1C_MOUSE	Carboxylesterase 1C OS=Mus musculus (Mouse) OX=10090 GN=Ces1c PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.02	18.0	1	1	1
PRT	sp|P56375|ACYP2_MOUSE	Acylphosphatase-2 OS=Mus musculus (Mouse) OX=10090 GN=Acyp2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.24	18.0	2	2	2
PRT	sp|P62242|RS8_MOUSE	40S ribosomal protein S8 OS=Mus musculus (Mouse) OX=10090 GN=Rps8 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.11	18.0	4	2	0
PRT	sp|Q91XF0|PNPO_MOUSE	Pyridoxine-5'-phosphate oxidase OS=Mus musculus (Mouse) OX=10090 GN=Pnpo PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.04	18.0	1	1	1
PRT	sp|P83917|CBX1_MOUSE	Chromobox protein homolog 1 OS=Mus musculus (Mouse) OX=10090 GN=Cbx1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.06	18.0	1	1	1
PRT	sp|P26041|MOES_MOUSE	Moesin OS=Mus musculus (Mouse) OX=10090 GN=Msn PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1000663, ProteinPilot, ]	18.0	null		0.09	18.0	6	5	4
PRT	sp|Q8BMC1|VATG3_MOUSE	V-type proton ATPase subunit G 3 OS=Mus musculus (Mouse) OX=10090 GN=Atp6v1g3 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.10	18.0	1	1	1
PRT	sp|P62889|RL30_MOUSE	60S ribosomal protein L30 OS=Mus musculus (Mouse) OX=10090 GN=Rpl30 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null	85-UNIMOD:4	0.17	18.0	2	1	0
PRT	sp|Q64331|MYO6_MOUSE	Unconventional myosin-VI OS=Mus musculus (Mouse) OX=10090 GN=Myo6 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null	1010-UNIMOD:4	0.01	18.0	1	1	1
PRT	sp|P26043|RADI_MOUSE	Radixin OS=Mus musculus (Mouse) OX=10090 GN=Rdx PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.02	18.0	1	1	1
PRT	sp|P17427|AP2A2_MOUSE	AP-2 complex subunit alpha-2 OS=Mus musculus (Mouse) OX=10090 GN=Ap2a2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null	396-UNIMOD:4	0.04	18.0	4	4	4
PRT	sp|O70435|PSA3_MOUSE	Proteasome subunit alpha type-3 OS=Mus musculus (Mouse) OX=10090 GN=Psma3 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.05	18.0	2	1	0
PRT	sp|Q9Z0J0|NPC2_MOUSE	NPC intracellular cholesterol transporter 2 OS=Mus musculus (Mouse) OX=10090 GN=Npc2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null	42-UNIMOD:4,47-UNIMOD:4,99-UNIMOD:4	0.18	18.0	2	2	2
PRT	sp|Q68FL4|SAHH3_MOUSE	Putative adenosylhomocysteinase 3 OS=Mus musculus (Mouse) OX=10090 GN=Ahcyl2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null	400-UNIMOD:4	0.06	18.0	3	3	3
PRT	sp|Q8VCC2|EST1_MOUSE	Liver carboxylesterase 1 OS=Mus musculus (Mouse) OX=10090 GN=Ces1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.02	18.0	2	1	0
PRT	sp|Q91V92|ACLY_MOUSE	ATP-citrate synthase OS=Mus musculus (Mouse) OX=10090 GN=Acly PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null	20-UNIMOD:4	0.02	18.0	2	2	2
PRT	sp|Q9WUZ9|ENTP5_MOUSE	Ectonucleoside triphosphate diphosphohydrolase 5 OS=Mus musculus (Mouse) OX=10090 GN=Entpd5 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.03	18.0	2	1	0
PRT	sp|Q9CWH6|PSMA8_MOUSE	Proteasome subunit alpha type-8 OS=Mus musculus (Mouse) OX=10090 GN=Psma8 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.11	18.0	3	2	1
PRT	sp|Q91WT9|CBS_MOUSE	Cystathionine beta-synthase OS=Mus musculus (Mouse) OX=10090 GN=Cbs PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.02	18.0	1	1	1
PRT	sp|P46638|RB11B_MOUSE	Ras-related protein Rab-11B OS=Mus musculus (Mouse) OX=10090 GN=Rab11b PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	18.0	null	2-UNIMOD:1	0.17	18.0	5	3	1
PRT	sp|Q60648|SAP3_MOUSE	Ganglioside GM2 activator OS=Mus musculus (Mouse) OX=10090 GN=Gm2a PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.16	18.0	5	3	1
PRT	sp|P18242|CATD_MOUSE	Cathepsin D OS=Mus musculus (Mouse) OX=10090 GN=Ctsd PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null	288-UNIMOD:4	0.08	18.0	2	2	2
PRT	sp|Q9WTP7|KAD3_MOUSE	GTP:AMP phosphotransferase AK3, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Ak3 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null	85-UNIMOD:4	0.21	18.0	6	4	3
PRT	tr|F6RWR5|F6RWR5_MOUSE	Glutathione S-transferase pi 3 OS=Mus musculus (Mouse) OX=10090 GN=Gstp3 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.06	18.0	1	1	1
PRT	sp|Q9WV92|E41L3_MOUSE	Band 4.1-like protein 3 OS=Mus musculus (Mouse) OX=10090 GN=Epb41l3 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.01	18.0	1	1	1
PRT	sp|P07309|TTHY_MOUSE	Transthyretin OS=Mus musculus (Mouse) OX=10090 GN=Ttr PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.10	18.0	1	1	1
PRT	sp|P97371|PSME1_MOUSE	Proteasome activator complex subunit 1 OS=Mus musculus (Mouse) OX=10090 GN=Psme1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.09	18.0	2	2	2
PRT	sp|Q9CY64|BIEA_MOUSE	Biliverdin reductase A OS=Mus musculus (Mouse) OX=10090 GN=Blvra PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.10	18.0	2	2	2
PRT	sp|Q64727|VINC_MOUSE	Vinculin OS=Mus musculus (Mouse) OX=10090 GN=Vcl PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.06	18.0	5	5	5
PRT	sp|O35658|C1QBP_MOUSE	Complement component 1 Q subcomponent-binding protein, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=C1qbp PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.09	18.0	3	2	1
PRT	sp|Q9DCD0|6PGD_MOUSE	6-phosphogluconate dehydrogenase, decarboxylating OS=Mus musculus (Mouse) OX=10090 GN=Pgd PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null	170-UNIMOD:4,171-UNIMOD:4	0.12	18.0	4	4	4
PRT	sp|P17879|HS71B_MOUSE	Heat shock 70 kDa protein 1B OS=Mus musculus (Mouse) OX=10090 GN=Hspa1b PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.05	18.0	3	2	1
PRT	sp|P62737|ACTA_MOUSE	Actin, aortic smooth muscle OS=Mus musculus (Mouse) OX=10090 GN=Acta2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null	84-UNIMOD:35	0.10	18.0	2	2	2
PRT	sp|P49312|ROA1_MOUSE	Heterogeneous nuclear ribonucleoprotein A1 OS=Mus musculus (Mouse) OX=10090 GN=Hnrnpa1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.03	18.0	2	1	0
PRT	sp|P51881|ADT2_MOUSE	ADP/ATP translocase 2 OS=Mus musculus (Mouse) OX=10090 GN=Slc25a5 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.05	18.0	1	1	1
PRT	sp|Q9JJI8|RL38_MOUSE	60S ribosomal protein L38 OS=Mus musculus (Mouse) OX=10090 GN=Rpl38 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.16	18.0	1	1	1
PRT	sp|Q9D8E6|RL4_MOUSE	60S ribosomal protein L4 OS=Mus musculus (Mouse) OX=10090 GN=Rpl4 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.03	18.0	1	1	1
PRT	sp|Q9D6Y9|GLGB_MOUSE	1,4-alpha-glucan-branching enzyme OS=Mus musculus (Mouse) OX=10090 GN=Gbe1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.02	18.0	1	1	1
PRT	sp|Q3TW96|UAP1L_MOUSE	UDP-N-acetylhexosamine pyrophosphorylase-like protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Uap1l1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.06	18.0	2	2	2
PRT	sp|O88696|CLPP_MOUSE	ATP-dependent Clp protease proteolytic subunit, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Clpp PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.13	18.0	2	2	2
PRT	sp|Q8VCH0|THIKB_MOUSE	3-ketoacyl-CoA thiolase B, peroxisomal OS=Mus musculus (Mouse) OX=10090 GN=Acaa1b PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null	123-UNIMOD:4	0.04	18.0	1	1	1
PRT	sp|Q9CZ44|NSF1C_MOUSE	NSFL1 cofactor p47 OS=Mus musculus (Mouse) OX=10090 GN=Nsfl1c PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.04	18.0	1	1	1
PRT	sp|O55060|TPMT_MOUSE	Thiopurine S-methyltransferase OS=Mus musculus (Mouse) OX=10090 GN=Tpmt PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.08	18.0	2	2	2
PRT	sp|Q02819|NUCB1_MOUSE	Nucleobindin-1 OS=Mus musculus (Mouse) OX=10090 GN=Nucb1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.05	18.0	2	2	2
PRT	sp|Q571E4|GALNS_MOUSE	N-acetylgalactosamine-6-sulfatase OS=Mus musculus (Mouse) OX=10090 GN=Galns PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.03	18.0	1	1	1
PRT	sp|P32848|PRVA_MOUSE	Parvalbumin alpha OS=Mus musculus (Mouse) OX=10090 GN=Pvalb PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.14	18.0	1	1	1
PRT	sp|Q91ZJ5|UGPA_MOUSE	UTP--glucose-1-phosphate uridylyltransferase OS=Mus musculus (Mouse) OX=10090 GN=Ugp2 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.03	18.0	1	1	1
PRT	sp|P50396|GDIA_MOUSE	Rab GDP dissociation inhibitor alpha OS=Mus musculus (Mouse) OX=10090 GN=Gdi1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null	317-UNIMOD:4	0.10	18.0	3	3	3
PRT	sp|Q9Z2X1|HNRPF_MOUSE	Heterogeneous nuclear ribonucleoprotein F OS=Mus musculus (Mouse) OX=10090 GN=Hnrnpf PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	18.0	null		0.11	18.0	4	3	2
PRT	sp|P05064|ALDOA_MOUSE	Fructose-bisphosphate aldolase A OS=Mus musculus (Mouse) OX=10090 GN=Aldoa PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	null		0.04	18.0	1	1	1
PRT	tr|E9PV38|E9PV38_MOUSE	Carboxylic ester hydrolase OS=Mus musculus (Mouse) OX=10090 GN=Ces2g PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.11	18.0	5	4	3
PRT	sp|Q9DCS2|MTL26_MOUSE	Methyltransferase-like 26 OS=Mus musculus (Mouse) OX=10090 GN=Mettl26 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	18.0	null	162-UNIMOD:385,162-UNIMOD:4	0.17	18.0	3	3	3
PRT	sp|Q9CPV4|GLOD4_MOUSE	Glyoxalase domain-containing protein 4 OS=Mus musculus (Mouse) OX=10090 GN=Glod4 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null	206-UNIMOD:4	0.13	18.0	3	3	3
PRT	sp|P24527|LKHA4_MOUSE	Leukotriene A-4 hydrolase OS=Mus musculus (Mouse) OX=10090 GN=Lta4h PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.02	18.0	1	1	1
PRT	sp|P14131|RS16_MOUSE	40S ribosomal protein S16 OS=Mus musculus (Mouse) OX=10090 GN=Rps16 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null	25-UNIMOD:4	0.22	18.0	3	3	3
PRT	sp|O88533|DDC_MOUSE	Aromatic-L-amino-acid decarboxylase OS=Mus musculus (Mouse) OX=10090 GN=Ddc PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.06	18.0	2	2	2
PRT	sp|P55302|AMRP_MOUSE	Alpha-2-macroglobulin receptor-associated protein OS=Mus musculus (Mouse) OX=10090 GN=Lrpap1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.05	18.0	1	1	1
PRT	sp|P63028|TCTP_MOUSE	Translationally-controlled tumor protein OS=Mus musculus (Mouse) OX=10090 GN=Tpt1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.13	18.0	2	2	2
PRT	sp|P84089|ERH_MOUSE	Enhancer of rudimentary homolog OS=Mus musculus (Mouse) OX=10090 GN=Erh PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	null	2-UNIMOD:1	0.12	18.0	2	1	0
PRT	sp|P70174|HRH1_MOUSE	Histamine H1 receptor OS=Mus musculus (Mouse) OX=10090 GN=Hrh1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.02	18.0	1	1	1
PRT	sp|Q924M7|MPI_MOUSE	Mannose-6-phosphate isomerase OS=Mus musculus (Mouse) OX=10090 GN=Mpi PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.04	18.0	1	1	1
PRT	sp|P85094|ISC2A_MOUSE	Isochorismatase domain-containing protein 2A OS=Mus musculus (Mouse) OX=10090 GN=Isoc2a PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null	136-UNIMOD:4	0.12	17.0	2	2	2
PRT	sp|P62874|GBB1_MOUSE	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Mus musculus (Mouse) OX=10090 GN=Gnb1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.03	17.0	1	1	1
PRT	sp|P61255|RL26_MOUSE	60S ribosomal protein L26 OS=Mus musculus (Mouse) OX=10090 GN=Rpl26 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.06	17.0	1	1	1
PRT	sp|P70695|F16P2_MOUSE	Fructose-1,6-bisphosphatase isozyme 2 OS=Mus musculus (Mouse) OX=10090 GN=Fbp2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|P28825|MEP1A_MOUSE	Meprin A subunit alpha OS=Mus musculus (Mouse) OX=10090 GN=Mep1a PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.07	17.0	4	4	4
PRT	sp|P34884|MIF_MOUSE	Macrophage migration inhibitory factor OS=Mus musculus (Mouse) OX=10090 GN=Mif PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.07	17.0	1	1	1
PRT	sp|P14069|S10A6_MOUSE	Protein S100-A6 OS=Mus musculus (Mouse) OX=10090 GN=S100a6 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.10	17.0	1	1	1
PRT	sp|Q61646|HPT_MOUSE	Haptoglobin OS=Mus musculus (Mouse) OX=10090 GN=Hp PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null	86-UNIMOD:4,90-UNIMOD:4	0.04	17.0	1	1	1
PRT	sp|Q149F3|ERF3B_MOUSE	Eukaryotic peptide chain release factor GTP-binding subunit ERF3B OS=Mus musculus (Mouse) OX=10090 GN=Gspt2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null	586-UNIMOD:4	0.01	17.0	1	1	1
PRT	sp|Q99KB8|GLO2_MOUSE	Hydroxyacylglutathione hydrolase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Hagh PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.04	17.0	1	1	1
PRT	sp|Q9CQI6|COTL1_MOUSE	Coactosin-like protein OS=Mus musculus (Mouse) OX=10090 GN=Cotl1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.34	17.0	5	5	5
PRT	sp|Q00724|RET4_MOUSE	Retinol-binding protein 4 OS=Mus musculus (Mouse) OX=10090 GN=Rbp4 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null	178-UNIMOD:4	0.05	17.0	1	1	1
PRT	sp|Q9QYJ0|DNJA2_MOUSE	DnaJ homolog subfamily A member 2 OS=Mus musculus (Mouse) OX=10090 GN=Dnaja2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null	308-UNIMOD:4	0.02	17.0	1	1	1
PRT	sp|P13745|GSTA1_MOUSE	Glutathione S-transferase A1 OS=Mus musculus (Mouse) OX=10090 GN=Gsta1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.04	17.0	1	1	1
PRT	sp|P62918|RL8_MOUSE	60S ribosomal protein L8 OS=Mus musculus (Mouse) OX=10090 GN=Rpl8 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.05	17.0	1	1	1
PRT	sp|P97447|FHL1_MOUSE	Four and a half LIM domains protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Fhl1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null	36-UNIMOD:4,40-UNIMOD:4,43-UNIMOD:4	0.04	17.0	1	1	1
PRT	sp|Q9WUU7|CATZ_MOUSE	Cathepsin Z OS=Mus musculus (Mouse) OX=10090 GN=Ctsz PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null	172-UNIMOD:4,175-UNIMOD:4	0.08	17.0	2	2	2
PRT	sp|Q9CQM9|GLRX3_MOUSE	Glutaredoxin-3 OS=Mus musculus (Mouse) OX=10090 GN=Glrx3 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.04	17.0	1	1	1
PRT	sp|P40336|VP26A_MOUSE	Vacuolar protein sorting-associated protein 26A OS=Mus musculus (Mouse) OX=10090 GN=Vps26a PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.04	17.0	1	1	1
PRT	sp|Q6ZWV7|RL35_MOUSE	60S ribosomal protein L35 OS=Mus musculus (Mouse) OX=10090 GN=Rpl35 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.09	17.0	1	1	1
PRT	sp|O88951|LIN7B_MOUSE	Protein lin-7 homolog B OS=Mus musculus (Mouse) OX=10090 GN=Lin7b PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.05	17.0	1	1	1
PRT	sp|P19253|RL13A_MOUSE	60S ribosomal protein L13a OS=Mus musculus (Mouse) OX=10090 GN=Rpl13a PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	17.0	null	2-UNIMOD:1	0.12	17.0	3	2	1
PRT	tr|D3Z6I8|D3Z6I8_MOUSE	Isoform of P21107, Tropomyosin alpha-3 chain OS=Mus musculus (Mouse) OX=10090 GN=Tpm3 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.06	17.0	2	2	2
PRT	sp|Q8BFZ9|ERLN2_MOUSE	Erlin-2 OS=Mus musculus (Mouse) OX=10090 GN=Erlin2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.04	17.0	1	1	1
PRT	sp|O08677|KNG1_MOUSE	Kininogen-1 OS=Mus musculus (Mouse) OX=10090 GN=Kng1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null	339-UNIMOD:4	0.02	17.0	1	1	1
PRT	sp|Q3V0K9|PLSI_MOUSE	Plastin-1 OS=Mus musculus (Mouse) OX=10090 GN=Pls1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null	462-UNIMOD:4	0.08	17.0	4	3	2
PRT	sp|Q3THE2|ML12B_MOUSE	Myosin regulatory light chain 12B OS=Mus musculus (Mouse) OX=10090 GN=Myl12b PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.06	17.0	1	1	1
PRT	sp|Q921H8|THIKA_MOUSE	3-ketoacyl-CoA thiolase A, peroxisomal OS=Mus musculus (Mouse) OX=10090 GN=Acaa1a PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.04	17.0	1	1	1
PRT	sp|Q6IRU5|CLCB_MOUSE	Clathrin light chain B OS=Mus musculus (Mouse) OX=10090 GN=Cltb PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null	199-UNIMOD:4	0.09	17.0	2	2	2
PRT	sp|O70475|UGDH_MOUSE	UDP-glucose 6-dehydrogenase OS=Mus musculus (Mouse) OX=10090 GN=Ugdh PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null	276-UNIMOD:4,112-UNIMOD:4	0.10	17.0	4	4	4
PRT	sp|Q3U0V1|FUBP2_MOUSE	Far upstream element-binding protein 2 OS=Mus musculus (Mouse) OX=10090 GN=Khsrp PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|Q8CC88|VWA8_MOUSE	von Willebrand factor A domain-containing protein 8 OS=Mus musculus (Mouse) OX=10090 GN=Vwa8 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null	161-UNIMOD:4	0.03	17.0	5	5	5
PRT	sp|P62264|RS14_MOUSE	40S ribosomal protein S14 OS=Mus musculus (Mouse) OX=10090 GN=Rps14 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.17	17.0	2	2	2
PRT	sp|Q9DBL1|ACDSB_MOUSE	Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Acadsb PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null	261-UNIMOD:4	0.13	17.0	5	5	5
PRT	sp|O70456|1433S_MOUSE	14-3-3 protein sigma OS=Mus musculus (Mouse) OX=10090 GN=Sfn PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null	220-UNIMOD:35	0.11	17.0	5	3	1
PRT	sp|Q64471|GSTT1_MOUSE	Glutathione S-transferase theta-1 OS=Mus musculus (Mouse) OX=10090 GN=Gstt1 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.19	17.0	4	4	4
PRT	sp|P62852|RS25_MOUSE	40S ribosomal protein S25 OS=Mus musculus (Mouse) OX=10090 GN=Rps25 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.17	17.0	3	2	1
PRT	sp|P30115|GSTA3_MOUSE	Glutathione S-transferase A3 OS=Mus musculus (Mouse) OX=10090 GN=Gsta3 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	17.0	null	2-UNIMOD:1	0.14	17.0	3	3	3
PRT	sp|Q9EST5|AN32B_MOUSE	Acidic leucine-rich nuclear phosphoprotein 32 family member B OS=Mus musculus (Mouse) OX=10090 GN=Anp32b PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.04	17.0	1	1	1
PRT	sp|O55142|RL35A_MOUSE	60S ribosomal protein L35a OS=Mus musculus (Mouse) OX=10090 GN=Rpl35a PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.09	17.0	1	1	1
PRT	sp|P11983|TCPA_MOUSE	T-complex protein 1 subunit alpha OS=Mus musculus (Mouse) OX=10090 GN=Tcp1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.04	17.0	2	2	2
PRT	sp|Q78JN3|ECI3_MOUSE	Enoyl-CoA delta isomerase 3, peroxisomal OS=Mus musculus (Mouse) OX=10090 GN=Eci3 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.04	17.0	1	1	1
PRT	sp|P12970|RL7A_MOUSE	60S ribosomal protein L7a OS=Mus musculus (Mouse) OX=10090 GN=Rpl7a PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.10	17.0	2	2	2
PRT	sp|Q9CZ13|QCR1_MOUSE	Cytochrome b-c1 complex subunit 1, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Uqcrc1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null	410-UNIMOD:4,380-UNIMOD:4	0.07	17.0	2	2	2
PRT	sp|O35737|HNRH1_MOUSE	Heterogeneous nuclear ribonucleoprotein H OS=Mus musculus (Mouse) OX=10090 GN=Hnrnph1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.07	17.0	3	2	1
PRT	sp|Q9Z0N1|IF2G_MOUSE	Eukaryotic translation initiation factor 2 subunit 3, X-linked OS=Mus musculus (Mouse) OX=10090 GN=Eif2s3x PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null	434-UNIMOD:4	0.06	17.0	2	2	2
PRT	sp|Q99MR8|MCCA_MOUSE	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Mccc1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	17.0	null	505-UNIMOD:4	0.06	17.0	3	3	3
PRT	sp|Q9CQM5|TXD17_MOUSE	Thioredoxin domain-containing protein 17 OS=Mus musculus (Mouse) OX=10090 GN=Txndc17 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.17	17.0	2	2	2
PRT	sp|O70194|EIF3D_MOUSE	Eukaryotic translation initiation factor 3 subunit D OS=Mus musculus (Mouse) OX=10090 GN=Eif3d PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.04	17.0	2	2	2
PRT	sp|P01027|CO3_MOUSE	Complement C3 OS=Mus musculus (Mouse) OX=10090 GN=C3 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.02	17.0	2	2	2
PRT	sp|O88342|WDR1_MOUSE	WD repeat-containing protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Wdr1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.09	17.0	3	3	3
PRT	sp|Q91V41|RAB14_MOUSE	Ras-related protein Rab-14 OS=Mus musculus (Mouse) OX=10090 GN=Rab14 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.18	17.0	3	3	3
PRT	sp|P29387|GBB4_MOUSE	Guanine nucleotide-binding protein subunit beta-4 OS=Mus musculus (Mouse) OX=10090 GN=Gnb4 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.04	17.0	1	1	1
PRT	sp|Q3TXS7|PSMD1_MOUSE	26S proteasome non-ATPase regulatory subunit 1 OS=Mus musculus (Mouse) OX=10090 GN=Psmd1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.02	17.0	1	1	1
PRT	tr|D3Z7G8|D3Z7G8_MOUSE	Isoform of O88343, Band_3_cyto domain-containing protein (Fragment) OS=Mus musculus (Mouse) OX=10090 GN=Slc4a4 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.09	17.0	1	1	1
PRT	sp|P14148|RL7_MOUSE	60S ribosomal protein L7 OS=Mus musculus (Mouse) OX=10090 GN=Rpl7 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.04	17.0	1	1	1
PRT	sp|P70158|ASM3A_MOUSE	Acid sphingomyelinase-like phosphodiesterase 3a OS=Mus musculus (Mouse) OX=10090 GN=Smpdl3a PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.03	17.0	2	1	0
PRT	sp|Q922R8|PDIA6_MOUSE	Protein disulfide-isomerase A6 OS=Mus musculus (Mouse) OX=10090 GN=Pdia6 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.03	17.0	1	1	1
PRT	sp|Q8R519|ACMSD_MOUSE	2-amino-3-carboxymuconate-6-semialdehyde decarboxylase OS=Mus musculus (Mouse) OX=10090 GN=Acmsd PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null	53-UNIMOD:4	0.08	17.0	2	2	2
PRT	sp|Q6PB66|LPPRC_MOUSE	Leucine-rich PPR motif-containing protein, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Lrpprc PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null	929-UNIMOD:4	0.05	17.0	7	6	5
PRT	sp|Q99KJ8|DCTN2_MOUSE	Dynactin subunit 2 OS=Mus musculus (Mouse) OX=10090 GN=Dctn2 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.04	17.0	1	1	1
PRT	sp|Q9DCL9|PUR6_MOUSE	Multifunctional protein ADE2 OS=Mus musculus (Mouse) OX=10090 GN=Paics PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.08	17.0	2	2	2
PRT	sp|A2AUU0-5|METL8-5_MOUSE	Isoform of A2AUU0, Isoform 5 of mRNA N(3)-methylcytidine methyltransferase METTL8 OS=Mus musculus (Mouse) OX=10090 GN=Mettl8 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.04	17.0	1	1	1
PRT	sp|P60766|CDC42_MOUSE	Cell division control protein 42 homolog OS=Mus musculus (Mouse) OX=10090 GN=Cdc42 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	17.0	null	134-UNIMOD:28,18-UNIMOD:4	0.13	17.0	3	2	1
PRT	sp|Q6IRU5-2|CLCB-2_MOUSE	Isoform of Q6IRU5, Isoform 2 of Clathrin light chain B OS=Mus musculus (Mouse) OX=10090 GN=Cltb PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.04	17.0	1	1	1
PRT	sp|P10518|HEM2_MOUSE	Delta-aminolevulinic acid dehydratase OS=Mus musculus (Mouse) OX=10090 GN=Alad PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null	203-UNIMOD:4,75-UNIMOD:4	0.12	17.0	4	3	2
PRT	sp|Q9Z2Y8|PLPHP_MOUSE	Pyridoxal phosphate homeostasis protein OS=Mus musculus (Mouse) OX=10090 GN=Plpbp PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.11	17.0	2	2	2
PRT	sp|Q99LF4|RTCB_MOUSE	RNA-splicing ligase RtcB homolog OS=Mus musculus (Mouse) OX=10090 GN=Rtcb PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.06	17.0	3	3	3
PRT	sp|Q80W40|ACSM4_MOUSE	Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Acsm4 PE=2 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.06	17.0	1	1	1
PRT	sp|P97351|RS3A_MOUSE	40S ribosomal protein S3a OS=Mus musculus (Mouse) OX=10090 GN=Rps3a PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.11	16.0	3	3	3
PRT	sp|Q9D2R0|AACS_MOUSE	Acetoacetyl-CoA synthetase OS=Mus musculus (Mouse) OX=10090 GN=Aacs PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.05	16.0	4	4	4
PRT	sp|P62858|RS28_MOUSE	40S ribosomal protein S28 OS=Mus musculus (Mouse) OX=10090 GN=Rps28 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null	27-UNIMOD:4	0.30	16.0	2	2	2
PRT	sp|Q9R0X4|ACOT9_MOUSE	Acyl-coenzyme A thioesterase 9, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Acot9 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.03	16.0	1	1	1
PRT	tr|E9Q0F0|E9Q0F0_MOUSE	IF rod domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Krt78 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.01	16.0	1	1	1
PRT	sp|Q99JY9|ARP3_MOUSE	Actin-related protein 3 OS=Mus musculus (Mouse) OX=10090 GN=Actr3 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null	8-UNIMOD:4,12-UNIMOD:4,408-UNIMOD:4	0.14	16.0	5	4	3
PRT	sp|Q8VCT3|AMPB_MOUSE	Aminopeptidase B OS=Mus musculus (Mouse) OX=10090 GN=Rnpep PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.02	16.0	1	1	1
PRT	sp|P19096|FAS_MOUSE	Fatty acid synthase OS=Mus musculus (Mouse) OX=10090 GN=Fasn PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.00	16.0	1	1	1
PRT	sp|P50171|DHB8_MOUSE	Estradiol 17-beta-dehydrogenase 8 OS=Mus musculus (Mouse) OX=10090 GN=Hsd17b8 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.05	16.0	1	1	1
PRT	sp|O08638|MYH11_MOUSE	Myosin-11 OS=Mus musculus (Mouse) OX=10090 GN=Myh11 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.02	16.0	3	3	3
PRT	sp|P62082|RS7_MOUSE	40S ribosomal protein S7 OS=Mus musculus (Mouse) OX=10090 GN=Rps7 PE=2 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.05	16.0	1	1	1
PRT	tr|A9R9W0|A9R9W0_MOUSE	Lipocln_cytosolic_FA-bd_dom domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Mup15 PE=3 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null	156-UNIMOD:4	0.04	16.0	1	1	1
PRT	tr|E9Q616|E9Q616_MOUSE	PDZ domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Ahnak PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.03	16.0	2	2	2
PRT	sp|P80316|TCPE_MOUSE	T-complex protein 1 subunit epsilon OS=Mus musculus (Mouse) OX=10090 GN=Cct5 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.02	16.0	1	1	1
PRT	sp|Q8JZV9|BDH2_MOUSE	3-hydroxybutyrate dehydrogenase type 2 OS=Mus musculus (Mouse) OX=10090 GN=Bdh2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.08	16.0	2	2	2
PRT	sp|P86048|RL10L_MOUSE	60S ribosomal protein L10-like OS=Mus musculus (Mouse) OX=10090 GN=Rpl10l PE=2 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null	195-UNIMOD:4	0.05	16.0	1	1	1
PRT	tr|A0A2I3BPG9|A0A2I3BPG9_MOUSE	Ribosomal protein L36A, pseudogene 1 OS=Mus musculus (Mouse) OX=10090 GN=Rpl36a-ps1 PE=3 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null	72-UNIMOD:4,77-UNIMOD:4	0.09	16.0	1	1	1
PRT	sp|P41105|RL28_MOUSE	60S ribosomal protein L28 OS=Mus musculus (Mouse) OX=10090 GN=Rpl28 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	16.0	null	2-UNIMOD:1	0.17	16.0	2	2	2
PRT	sp|Q922B2|SYDC_MOUSE	Aspartate--tRNA ligase, cytoplasmic OS=Mus musculus (Mouse) OX=10090 GN=Dars1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.02	16.0	1	1	1
PRT	sp|P46471|PRS7_MOUSE	26S proteasome regulatory subunit 7 OS=Mus musculus (Mouse) OX=10090 GN=Psmc2 PE=1 SV=5	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null	236-UNIMOD:4	0.04	16.0	2	2	2
PRT	sp|Q8R050|ERF3A_MOUSE	Eukaryotic peptide chain release factor GTP-binding subunit ERF3A OS=Mus musculus (Mouse) OX=10090 GN=Gspt1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.01	16.0	1	1	1
PRT	sp|P61164|ACTZ_MOUSE	Alpha-centractin OS=Mus musculus (Mouse) OX=10090 GN=Actr1a PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.03	16.0	1	1	1
PRT	sp|P17710|HXK1_MOUSE	Hexokinase-1 OS=Mus musculus (Mouse) OX=10090 GN=Hk1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.01	16.0	1	1	1
PRT	sp|Q62159|RHOC_MOUSE	Rho-related GTP-binding protein RhoC OS=Mus musculus (Mouse) OX=10090 GN=Rhoc PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null	16-UNIMOD:4,107-UNIMOD:4	0.15	16.0	2	2	2
PRT	sp|P60764|RAC3_MOUSE	Ras-related C3 botulinum toxin substrate 3 OS=Mus musculus (Mouse) OX=10090 GN=Rac3 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null	157-UNIMOD:4,178-UNIMOD:4	0.15	16.0	3	3	3
PRT	sp|P60867|RS20_MOUSE	40S ribosomal protein S20 OS=Mus musculus (Mouse) OX=10090 GN=Rps20 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null	36-UNIMOD:4	0.17	16.0	2	2	2
PRT	sp|Q8K2B3|SDHA_MOUSE	Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Sdha PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null	89-UNIMOD:4,238-UNIMOD:4	0.09	16.0	4	4	4
PRT	sp|Q9DCC4|P5CR3_MOUSE	Pyrroline-5-carboxylate reductase 3 OS=Mus musculus (Mouse) OX=10090 GN=Pycr3 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null	266-UNIMOD:4	0.15	16.0	3	3	3
PRT	sp|O70492|SNX3_MOUSE	Sorting nexin-3 OS=Mus musculus (Mouse) OX=10090 GN=Snx3 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.06	16.0	1	1	1
PRT	sp|P99026|PSB4_MOUSE	Proteasome subunit beta type-4 OS=Mus musculus (Mouse) OX=10090 GN=Psmb4 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	16.0	null		0.07	16.0	2	2	2
PRT	sp|Q9QYC0|ADDA_MOUSE	Alpha-adducin OS=Mus musculus (Mouse) OX=10090 GN=Add1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.04	16.0	3	2	1
PRT	sp|P47757|CAPZB_MOUSE	F-actin-capping protein subunit beta OS=Mus musculus (Mouse) OX=10090 GN=Capzb PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.15	16.0	3	3	3
PRT	sp|O88456|CPNS1_MOUSE	Calpain small subunit 1 OS=Mus musculus (Mouse) OX=10090 GN=Capns1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null	145-UNIMOD:4	0.04	16.0	1	1	1
PRT	sp|P20152|VIME_MOUSE	Vimentin OS=Mus musculus (Mouse) OX=10090 GN=Vim PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.08	16.0	3	3	3
PRT	sp|P58044|IDI1_MOUSE	Isopentenyl-diphosphate Delta-isomerase 1 OS=Mus musculus (Mouse) OX=10090 GN=Idi1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.06	16.0	1	1	1
PRT	sp|Q9D8W5|PSD12_MOUSE	26S proteasome non-ATPase regulatory subunit 12 OS=Mus musculus (Mouse) OX=10090 GN=Psmd12 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.05	16.0	2	2	2
PRT	sp|Q8VEK3|HNRPU_MOUSE	Heterogeneous nuclear ribonucleoprotein U OS=Mus musculus (Mouse) OX=10090 GN=Hnrnpu PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.02	16.0	1	1	1
PRT	sp|P21614|VTDB_MOUSE	Vitamin D-binding protein OS=Mus musculus (Mouse) OX=10090 GN=Gc PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null	96-UNIMOD:4,111-UNIMOD:4,112-UNIMOD:4,220-UNIMOD:4	0.07	16.0	2	2	2
PRT	sp|Q8K010|OPLA_MOUSE	5-oxoprolinase OS=Mus musculus (Mouse) OX=10090 GN=Oplah PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	16.0	null	382-UNIMOD:4	0.05	16.0	5	4	3
PRT	sp|Q9CZM2|RL15_MOUSE	60S ribosomal protein L15 OS=Mus musculus (Mouse) OX=10090 GN=Rpl15 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.08	16.0	2	2	2
PRT	tr|A0A0N4SVP8|A0A0N4SVP8_MOUSE	Eukaryotic translation initiation factor 4A3-like 2 OS=Mus musculus (Mouse) OX=10090 GN=Eif4a3l2 PE=3 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.02	16.0	1	1	1
PRT	sp|Q9CZX8|RS19_MOUSE	40S ribosomal protein S19 OS=Mus musculus (Mouse) OX=10090 GN=Rps19 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	16.0	null		0.32	16.0	5	5	5
PRT	sp|O08585|CLCA_MOUSE	Clathrin light chain A OS=Mus musculus (Mouse) OX=10090 GN=Clta PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null	205-UNIMOD:4	0.11	16.0	4	3	2
PRT	sp|Q501J6|DDX17_MOUSE	Probable ATP-dependent RNA helicase DDX17 OS=Mus musculus (Mouse) OX=10090 GN=Ddx17 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.02	16.0	1	1	1
PRT	sp|P61161|ARP2_MOUSE	Actin-related protein 2 OS=Mus musculus (Mouse) OX=10090 GN=Actr2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.03	16.0	2	1	0
PRT	sp|Q6ZQI3|MLEC_MOUSE	Malectin OS=Mus musculus (Mouse) OX=10090 GN=Mlec PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.04	16.0	1	1	1
PRT	sp|Q3ULJ0|GPD1L_MOUSE	Glycerol-3-phosphate dehydrogenase 1-like protein OS=Mus musculus (Mouse) OX=10090 GN=Gpd1l PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null	9-UNIMOD:4	0.05	16.0	1	1	1
PRT	sp|Q9JHU4|DYHC1_MOUSE	Cytoplasmic dynein 1 heavy chain 1 OS=Mus musculus (Mouse) OX=10090 GN=Dync1h1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null	3710-UNIMOD:4,4568-UNIMOD:4	0.01	16.0	5	5	5
PRT	sp|Q8CGK3|LONM_MOUSE	Lon protease homolog, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Lonp1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.03	16.0	2	2	2
PRT	sp|P24369|PPIB_MOUSE	Peptidyl-prolyl cis-trans isomerase B OS=Mus musculus (Mouse) OX=10090 GN=Ppib PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.04	16.0	1	1	1
PRT	sp|P52825|CPT2_MOUSE	Carnitine O-palmitoyltransferase 2, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Cpt2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.04	16.0	3	2	1
PRT	sp|Q99L20|GSTT3_MOUSE	Glutathione S-transferase theta-3 OS=Mus musculus (Mouse) OX=10090 GN=Gstt3 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.09	16.0	1	1	1
PRT	sp|P62301|RS13_MOUSE	40S ribosomal protein S13 OS=Mus musculus (Mouse) OX=10090 GN=Rps13 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.09	16.0	1	1	1
PRT	sp|Q91YP3|DEOC_MOUSE	Deoxyribose-phosphate aldolase OS=Mus musculus (Mouse) OX=10090 GN=Dera PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.04	16.0	1	1	1
PRT	sp|P80318|TCPG_MOUSE	T-complex protein 1 subunit gamma OS=Mus musculus (Mouse) OX=10090 GN=Cct3 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null	455-UNIMOD:4	0.09	16.0	4	4	4
PRT	sp|Q9QXD1|ACOX2_MOUSE	Peroxisomal acyl-coenzyme A oxidase 2 OS=Mus musculus (Mouse) OX=10090 GN=Acox2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.05	16.0	2	2	2
PRT	sp|Q9CWJ9|PUR9_MOUSE	Bifunctional purine biosynthesis protein PURH OS=Mus musculus (Mouse) OX=10090 GN=Atic PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null	101-UNIMOD:4	0.02	16.0	1	1	1
PRT	tr|A2A5N3|A2A5N3_MOUSE	Polyadenylate-binding protein OS=Mus musculus (Mouse) OX=10090 GN=Pabpc1l PE=2 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null	339-UNIMOD:4	0.03	16.0	2	1	0
PRT	sp|P62715|PP2AB_MOUSE	Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform OS=Mus musculus (Mouse) OX=10090 GN=Ppp2cb PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null	266-UNIMOD:4	0.05	16.0	1	1	1
PRT	sp|P53395|ODB2_MOUSE	Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Dbt PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.04	16.0	2	2	2
PRT	sp|Q9DBL7|COASY_MOUSE	Bifunctional coenzyme A synthase OS=Mus musculus (Mouse) OX=10090 GN=Coasy PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.04	16.0	2	2	2
PRT	sp|Q5XJY5|COPD_MOUSE	Coatomer subunit delta OS=Mus musculus (Mouse) OX=10090 GN=Arcn1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.05	16.0	2	2	2
PRT	sp|Q61548|AP180_MOUSE	Clathrin coat assembly protein AP180 OS=Mus musculus (Mouse) OX=10090 GN=Snap91 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.01	16.0	1	1	1
PRT	tr|A0A0R4J0I1|A0A0R4J0I1_MOUSE	Isoform of P07759, Serine protease inhibitor A3K OS=Mus musculus (Mouse) OX=10090 GN=Serpina3k PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1000663, ProteinPilot, ],[MS, MS:1002251, Comet, ]	16.0	null		0.11	16.0	2	2	1
PRT	sp|Q9D1G1|RAB1B_MOUSE	Ras-related protein Rab-1B OS=Mus musculus (Mouse) OX=10090 GN=Rab1b PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.08	16.0	1	1	1
PRT	tr|A0A0A6YW07|A0A0A6YW07_MOUSE	Isoform of O55023, Inositol-1-monophosphatase OS=Mus musculus (Mouse) OX=10090 GN=Impa1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.12	16.0	1	1	1
PRT	sp|Q9JKF1|IQGA1_MOUSE	Ras GTPase-activating-like protein IQGAP1 OS=Mus musculus (Mouse) OX=10090 GN=Iqgap1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.01	16.0	1	1	1
PRT	sp|P21995|EMB_MOUSE	Embigin OS=Mus musculus (Mouse) OX=10090 GN=Emb PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.02	16.0	1	1	1
PRT	sp|O55023|IMPA1_MOUSE	Inositol monophosphatase 1 OS=Mus musculus (Mouse) OX=10090 GN=Impa1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null	183-UNIMOD:4	0.04	16.0	1	1	1
PRT	sp|Q9WVK4|EHD1_MOUSE	EH domain-containing protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Ehd1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.02	16.0	1	1	1
PRT	sp|P32921|SYWC_MOUSE	Tryptophan--tRNA ligase, cytoplasmic OS=Mus musculus (Mouse) OX=10090 GN=Wars1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.04	16.0	1	1	1
PRT	sp|P04104|K2C1_MOUSE	Keratin, type II cytoskeletal 1 OS=Mus musculus (Mouse) OX=10090 GN=Krt1 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.02	16.0	1	1	1
PRT	sp|Q62167|DDX3X_MOUSE	ATP-dependent RNA helicase DDX3X OS=Mus musculus (Mouse) OX=10090 GN=Ddx3x PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null	298-UNIMOD:4	0.03	16.0	1	1	1
PRT	sp|P58771|TPM1_MOUSE	Tropomyosin alpha-1 chain OS=Mus musculus (Mouse) OX=10090 GN=Tpm1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.04	16.0	2	1	0
PRT	sp|P48962|ADT1_MOUSE	ADP/ATP translocase 1 OS=Mus musculus (Mouse) OX=10090 GN=Slc25a4 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.06	15.0	2	2	2
PRT	sp|Q8VDM4|PSMD2_MOUSE	26S proteasome non-ATPase regulatory subunit 2 OS=Mus musculus (Mouse) OX=10090 GN=Psmd2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.01	15.0	1	1	1
PRT	tr|A2AEH9|A2AEH9_MOUSE	Thymosin beta 15a OS=Mus musculus (Mouse) OX=10090 GN=Tmsb15a PE=4 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.10	15.0	1	1	1
PRT	sp|O08529|CAN2_MOUSE	Calpain-2 catalytic subunit OS=Mus musculus (Mouse) OX=10090 GN=Capn2 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.02	15.0	1	1	1
PRT	sp|P62774|MTPN_MOUSE	Myotrophin OS=Mus musculus (Mouse) OX=10090 GN=Mtpn PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.15	15.0	2	2	2
PRT	sp|Q61937|NPM_MOUSE	Nucleophosmin OS=Mus musculus (Mouse) OX=10090 GN=Npm1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.03	15.0	1	1	1
PRT	tr|A0A1Y7VKY1|A0A1Y7VKY1_MOUSE	Ribosomal protein S18, pseudogene 5 OS=Mus musculus (Mouse) OX=10090 GN=Rps18-ps5 PE=3 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.14	15.0	2	2	2
PRT	tr|A0A1B0GSX0|A0A1B0GSX0_MOUSE	Isoform of P06151, L-lactate dehydrogenase OS=Mus musculus (Mouse) OX=10090 GN=Ldha PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1000663, ProteinPilot, ]	15.0	null		0.02	15.0	1	1	0
PRT	tr|E9Q3M9|E9Q3M9_MOUSE	DUF4592 domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=2010300C02Rik PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.01	15.0	2	1	0
PRT	sp|O08716|FABP9_MOUSE	Fatty acid-binding protein 9 OS=Mus musculus (Mouse) OX=10090 GN=Fabp9 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.06	15.0	1	1	1
PRT	sp|Q9QXY6|EHD3_MOUSE	EH domain-containing protein 3 OS=Mus musculus (Mouse) OX=10090 GN=Ehd3 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.02	15.0	1	1	1
PRT	sp|Q920A5|RISC_MOUSE	Retinoid-inducible serine carboxypeptidase OS=Mus musculus (Mouse) OX=10090 GN=Scpep1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.04	15.0	2	2	2
PRT	sp|P84099|RL19_MOUSE	60S ribosomal protein L19 OS=Mus musculus (Mouse) OX=10090 GN=Rpl19 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.05	15.0	1	1	1
PRT	sp|P37040|NCPR_MOUSE	NADPH--cytochrome P450 reductase OS=Mus musculus (Mouse) OX=10090 GN=Por PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.03	15.0	2	2	2
PRT	sp|P61750|ARF4_MOUSE	ADP-ribosylation factor 4 OS=Mus musculus (Mouse) OX=10090 GN=Arf4 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.06	15.0	1	1	1
PRT	sp|P60335|PCBP1_MOUSE	Poly(rC)-binding protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Pcbp1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.03	15.0	2	1	0
PRT	sp|Q9WUM4|COR1C_MOUSE	Coronin-1C OS=Mus musculus (Mouse) OX=10090 GN=Coro1c PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null	23-UNIMOD:4	0.02	15.0	1	1	1
PRT	sp|O70439|STX7_MOUSE	Syntaxin-7 OS=Mus musculus (Mouse) OX=10090 GN=Stx7 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null	28-UNIMOD:4	0.04	15.0	1	1	1
PRT	sp|P57722|PCBP3_MOUSE	Poly(rC)-binding protein 3 OS=Mus musculus (Mouse) OX=10090 GN=Pcbp3 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null	86-UNIMOD:4	0.03	15.0	1	1	1
PRT	sp|P47911|RL6_MOUSE	60S ribosomal protein L6 OS=Mus musculus (Mouse) OX=10090 GN=Rpl6 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.04	15.0	1	1	1
PRT	sp|Q8R086|SUOX_MOUSE	Sulfite oxidase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Suox PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null	300-UNIMOD:4	0.02	15.0	1	1	1
PRT	sp|Q9ES97|RTN3_MOUSE	Reticulon-3 OS=Mus musculus (Mouse) OX=10090 GN=Rtn3 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|Q9QZD9|EIF3I_MOUSE	Eukaryotic translation initiation factor 3 subunit I OS=Mus musculus (Mouse) OX=10090 GN=Eif3i PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.06	15.0	2	2	2
PRT	sp|P24472|GSTA4_MOUSE	Glutathione S-transferase A4 OS=Mus musculus (Mouse) OX=10090 GN=Gsta4 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.06	15.0	1	1	1
PRT	sp|Q8CIE6|COPA_MOUSE	Coatomer subunit alpha OS=Mus musculus (Mouse) OX=10090 GN=Copa PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null	522-UNIMOD:4	0.01	15.0	1	1	1
PRT	sp|P00375|DYR_MOUSE	Dihydrofolate reductase OS=Mus musculus (Mouse) OX=10090 GN=Dhfr PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.06	15.0	1	1	1
PRT	sp|P11404|FABPH_MOUSE	Fatty acid-binding protein, heart OS=Mus musculus (Mouse) OX=10090 GN=Fabp3 PE=1 SV=5	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.16	15.0	2	2	2
PRT	sp|Q9CS42|PRPS2_MOUSE	Ribose-phosphate pyrophosphokinase 2 OS=Mus musculus (Mouse) OX=10090 GN=Prps2 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null	165-UNIMOD:4	0.04	15.0	1	1	1
PRT	sp|G3X9C2|FBX50_MOUSE	F-box only protein 50 OS=Mus musculus (Mouse) OX=10090 GN=Nccrp1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.05	15.0	1	1	1
PRT	sp|Q9R112|SQOR_MOUSE	Sulfide:quinone oxidoreductase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Sqor PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null	127-UNIMOD:4	0.03	15.0	1	1	1
PRT	sp|P21981|TGM2_MOUSE	Protein-glutamine gamma-glutamyltransferase 2 OS=Mus musculus (Mouse) OX=10090 GN=Tgm2 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null	370-UNIMOD:4,371-UNIMOD:4,553-UNIMOD:4,27-UNIMOD:4,669-UNIMOD:4	0.11	15.0	6	6	6
PRT	sp|Q7TQI3|OTUB1_MOUSE	Ubiquitin thioesterase OTUB1 OS=Mus musculus (Mouse) OX=10090 GN=Otub1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.05	15.0	1	1	1
PRT	tr|B2RPU8|B2RPU8_MOUSE	SCAN domain containing 3 OS=Mus musculus (Mouse) OX=10090 GN=Zbed5 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.03	15.0	1	1	1
PRT	sp|Q9DBT9|M2GD_MOUSE	Dimethylglycine dehydrogenase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Dmgdh PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.04	15.0	2	2	2
PRT	sp|Q61035|HARS1_MOUSE	Histidine--tRNA ligase, cytoplasmic OS=Mus musculus (Mouse) OX=10090 GN=Hars1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.04	15.0	2	2	2
PRT	sp|Q9JI75|NQO2_MOUSE	Ribosyldihydronicotinamide dehydrogenase [quinone] OS=Mus musculus (Mouse) OX=10090 GN=Nqo2 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.06	15.0	1	1	1
PRT	sp|Q78PY7|SND1_MOUSE	Staphylococcal nuclease domain-containing protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Snd1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.02	15.0	1	1	1
PRT	sp|Q9CPR4|RL17_MOUSE	60S ribosomal protein L17 OS=Mus musculus (Mouse) OX=10090 GN=Rpl17 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.06	15.0	1	1	1
PRT	sp|Q5SW19|CLU_MOUSE	Clustered mitochondria protein homolog OS=Mus musculus (Mouse) OX=10090 GN=Cluh PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|O89017|LGMN_MOUSE	Legumain OS=Mus musculus (Mouse) OX=10090 GN=Lgmn PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null	221-UNIMOD:4	0.03	15.0	1	1	1
PRT	sp|P27600|GNA12_MOUSE	Guanine nucleotide-binding protein subunit alpha-12 OS=Mus musculus (Mouse) OX=10090 GN=Gna12 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.03	15.0	1	1	1
PRT	sp|Q9JKB1|UCHL3_MOUSE	Ubiquitin carboxyl-terminal hydrolase isozyme L3 OS=Mus musculus (Mouse) OX=10090 GN=Uchl3 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.04	15.0	1	1	1
PRT	sp|Q9R257|HEBP1_MOUSE	Heme-binding protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Hebp1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.09	15.0	1	1	1
PRT	sp|Q9CR16|PPID_MOUSE	Peptidyl-prolyl cis-trans isomerase D OS=Mus musculus (Mouse) OX=10090 GN=Ppid PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null	176-UNIMOD:4,181-UNIMOD:4	0.03	15.0	1	1	1
PRT	sp|Q9Z1D1|EIF3G_MOUSE	Eukaryotic translation initiation factor 3 subunit G OS=Mus musculus (Mouse) OX=10090 GN=Eif3g PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.04	15.0	1	1	1
PRT	sp|P53994|RAB2A_MOUSE	Ras-related protein Rab-2A OS=Mus musculus (Mouse) OX=10090 GN=Rab2a PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.07	15.0	2	1	0
PRT	sp|Q9CYR6|AGM1_MOUSE	Phosphoacetylglucosamine mutase OS=Mus musculus (Mouse) OX=10090 GN=Pgm3 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.02	15.0	1	1	1
PRT	sp|P48774|GSTM5_MOUSE	Glutathione S-transferase Mu 5 OS=Mus musculus (Mouse) OX=10090 GN=Gstm5 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	15.0	null	177-UNIMOD:385,177-UNIMOD:4	0.08	15.0	2	2	2
PRT	sp|P36536|SAR1A_MOUSE	GTP-binding protein SAR1a OS=Mus musculus (Mouse) OX=10090 GN=Sar1a PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.06	15.0	1	1	1
PRT	sp|P23492|PNPH_MOUSE	Purine nucleoside phosphorylase OS=Mus musculus (Mouse) OX=10090 GN=Pnp PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null	142-UNIMOD:4	0.17	15.0	3	3	3
PRT	sp|Q9CR67|TMM33_MOUSE	Transmembrane protein 33 OS=Mus musculus (Mouse) OX=10090 GN=Tmem33 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.05	15.0	1	1	1
PRT	sp|Q9QYB5|ADDG_MOUSE	Gamma-adducin OS=Mus musculus (Mouse) OX=10090 GN=Add3 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.02	15.0	1	1	1
PRT	sp|Q9QUH0|GLRX1_MOUSE	Glutaredoxin-1 OS=Mus musculus (Mouse) OX=10090 GN=Glrx PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.11	15.0	1	1	1
PRT	sp|Q9D819|IPYR_MOUSE	Inorganic pyrophosphatase OS=Mus musculus (Mouse) OX=10090 GN=Ppa1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.04	15.0	1	1	1
PRT	sp|Q9JLZ3|AUHM_MOUSE	Methylglutaconyl-CoA hydratase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Auh PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null	113-UNIMOD:4	0.05	15.0	1	1	1
PRT	sp|P80317|TCPZ_MOUSE	T-complex protein 1 subunit zeta OS=Mus musculus (Mouse) OX=10090 GN=Cct6a PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.03	15.0	1	1	1
PRT	sp|A2ASQ1|AGRIN_MOUSE	Agrin OS=Mus musculus (Mouse) OX=10090 GN=Agrn PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|O08788|DCTN1_MOUSE	Dynactin subunit 1 OS=Mus musculus (Mouse) OX=10090 GN=Dctn1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|P51150|RAB7A_MOUSE	Ras-related protein Rab-7a OS=Mus musculus (Mouse) OX=10090 GN=Rab7a PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.07	15.0	1	1	1
PRT	sp|P31254|UBA1Y_MOUSE	Ubiquitin-like modifier-activating enzyme 1 Y OS=Mus musculus (Mouse) OX=10090 GN=Uba1y PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null	480-UNIMOD:4	0.02	15.0	1	1	1
PRT	sp|P62900|RL31_MOUSE	60S ribosomal protein L31 OS=Mus musculus (Mouse) OX=10090 GN=Rpl31 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.12	15.0	1	1	1
PRT	sp|O89019|INVS_MOUSE	Inversin OS=Mus musculus (Mouse) OX=10090 GN=Invs PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.01	15.0	1	1	1
PRT	tr|E9PZF0|E9PZF0_MOUSE	Gm20390 readthrough, Nucleoside diphosphate kinase OS=Mus musculus (Mouse) OX=10090 GN=Gm20390 PE=3 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	null	165-UNIMOD:28	0.03	15.0	1	1	1
PRT	sp|Q8BG32|PSD11_MOUSE	26S proteasome non-ATPase regulatory subunit 11 OS=Mus musculus (Mouse) OX=10090 GN=Psmd11 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	15.0	null	2-UNIMOD:1	0.05	15.0	2	2	2
PRT	tr|F8VQ29|F8VQ29_MOUSE	IQ motif-containing GTPase-activating protein 3 OS=Mus musculus (Mouse) OX=10090 GN=Iqgap3 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|Q9NYQ2|HAOX2_MOUSE	Hydroxyacid oxidase 2 OS=Mus musculus (Mouse) OX=10090 GN=Hao2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.04	15.0	1	1	1
PRT	sp|P70404|IDHG1_MOUSE	Isocitrate dehydrogenase [NAD] subunit gamma 1, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Idh3g PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.03	15.0	1	1	1
PRT	sp|P23198|CBX3_MOUSE	Chromobox protein homolog 3 OS=Mus musculus (Mouse) OX=10090 GN=Cbx3 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.08	15.0	1	1	1
PRT	sp|Q69Z23|DYH17_MOUSE	Dynein heavy chain 17, axonemal OS=Mus musculus (Mouse) OX=10090 GN=Dnah17 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.00	15.0	1	1	1
PRT	sp|P84104|SRSF3_MOUSE	Serine/arginine-rich splicing factor 3 OS=Mus musculus (Mouse) OX=10090 GN=Srsf3 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.05	15.0	1	1	1
PRT	sp|O70591|PFD2_MOUSE	Prefoldin subunit 2 OS=Mus musculus (Mouse) OX=10090 GN=Pfdn2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.10	15.0	1	1	1
PRT	sp|Q8VDC1|FYCO1_MOUSE	FYVE and coiled-coil domain-containing protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Fyco1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|O35136|NCAM2_MOUSE	Neural cell adhesion molecule 2 OS=Mus musculus (Mouse) OX=10090 GN=Ncam2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|P56399|UBP5_MOUSE	Ubiquitin carboxyl-terminal hydrolase 5 OS=Mus musculus (Mouse) OX=10090 GN=Usp5 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.02	15.0	1	1	1
PRT	sp|Q9JME5|AP3B2_MOUSE	AP-3 complex subunit beta-2 OS=Mus musculus (Mouse) OX=10090 GN=Ap3b2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.01	14.0	1	1	1
PRT	tr|G3UXL2|G3UXL2_MOUSE	Pribosyltran_N domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Prps1l3 PE=3 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.08	14.0	2	2	2
PRT	sp|O88712|CTBP1_MOUSE	C-terminal-binding protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Ctbp1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.02	14.0	1	1	1
PRT	sp|P62274|RS29_MOUSE	40S ribosomal protein S29 OS=Mus musculus (Mouse) OX=10090 GN=Rps29 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	null		0.21	14.0	1	1	1
PRT	sp|P97461|RS5_MOUSE	40S ribosomal protein S5 OS=Mus musculus (Mouse) OX=10090 GN=Rps5 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null	66-UNIMOD:4	0.04	14.0	1	1	1
PRT	sp|Q99J99|THTM_MOUSE	3-mercaptopyruvate sulfurtransferase OS=Mus musculus (Mouse) OX=10090 GN=Mpst PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.03	14.0	1	1	1
PRT	sp|C0HKG5|RNT2A_MOUSE	Ribonuclease T2-A OS=Mus musculus (Mouse) OX=10090 GN=Rnaset2a PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null	125-UNIMOD:4	0.06	14.0	1	1	1
PRT	sp|P45591|COF2_MOUSE	Cofilin-2 OS=Mus musculus (Mouse) OX=10090 GN=Cfl2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.06	14.0	1	1	1
PRT	sp|P50543|S10AB_MOUSE	Protein S100-A11 OS=Mus musculus (Mouse) OX=10090 GN=S100a11 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.08	14.0	1	1	1
PRT	sp|P05784|K1C18_MOUSE	Keratin, type I cytoskeletal 18 OS=Mus musculus (Mouse) OX=10090 GN=Krt18 PE=1 SV=5	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.02	14.0	1	1	1
PRT	sp|O89023|TPP1_MOUSE	Tripeptidyl-peptidase 1 OS=Mus musculus (Mouse) OX=10090 GN=Tpp1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.01	14.0	1	1	1
PRT	sp|Q64669|NQO1_MOUSE	NAD(P)H dehydrogenase [quinone] 1 OS=Mus musculus (Mouse) OX=10090 GN=Nqo1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.07	14.0	2	2	2
PRT	sp|P61514|RL37A_MOUSE	60S ribosomal protein L37a OS=Mus musculus (Mouse) OX=10090 GN=Rpl37a PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null	39-UNIMOD:4,42-UNIMOD:4	0.10	14.0	1	1	1
PRT	tr|D3Z0Y2|D3Z0Y2_MOUSE	Isoform of O08709, Thioredoxin domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Prdx6 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.06	14.0	1	1	1
PRT	sp|P68037|UB2L3_MOUSE	Ubiquitin-conjugating enzyme E2 L3 OS=Mus musculus (Mouse) OX=10090 GN=Ube2l3 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.06	14.0	1	1	1
PRT	sp|P11438|LAMP1_MOUSE	Lysosome-associated membrane glycoprotein 1 OS=Mus musculus (Mouse) OX=10090 GN=Lamp1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.03	14.0	1	1	1
PRT	sp|P18894|OXDA_MOUSE	D-amino-acid oxidase OS=Mus musculus (Mouse) OX=10090 GN=Dao PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.03	14.0	1	1	1
PRT	sp|P62317|SMD2_MOUSE	Small nuclear ribonucleoprotein Sm D2 OS=Mus musculus (Mouse) OX=10090 GN=Snrpd2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null	46-UNIMOD:4	0.09	14.0	1	1	1
PRT	sp|P62821|RAB1A_MOUSE	Ras-related protein Rab-1A OS=Mus musculus (Mouse) OX=10090 GN=Rab1A PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null	26-UNIMOD:4	0.08	14.0	2	2	2
PRT	sp|Q8K183|PDXK_MOUSE	Pyridoxal kinase OS=Mus musculus (Mouse) OX=10090 GN=Pdxk PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	14.0	null		0.10	14.0	2	2	2
PRT	sp|Q9R0Q7|TEBP_MOUSE	Prostaglandin E synthase 3 OS=Mus musculus (Mouse) OX=10090 GN=Ptges3 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.06	14.0	1	1	1
PRT	sp|E9PV24|FIBA_MOUSE	Fibrinogen alpha chain OS=Mus musculus (Mouse) OX=10090 GN=Fga PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.02	14.0	1	1	1
PRT	sp|Q9D0E1|HNRPM_MOUSE	Heterogeneous nuclear ribonucleoprotein M OS=Mus musculus (Mouse) OX=10090 GN=Hnrnpm PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.01	14.0	1	1	1
PRT	sp|P51859|HDGF_MOUSE	Hepatoma-derived growth factor OS=Mus musculus (Mouse) OX=10090 GN=Hdgf PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.05	14.0	1	1	1
PRT	sp|Q9WVJ2|PSD13_MOUSE	26S proteasome non-ATPase regulatory subunit 13 OS=Mus musculus (Mouse) OX=10090 GN=Psmd13 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null	114-UNIMOD:4	0.03	14.0	1	1	1
PRT	sp|Q9JKW0|AR6P1_MOUSE	ADP-ribosylation factor-like protein 6-interacting protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Arl6ip1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null	109-UNIMOD:4	0.05	14.0	1	1	1
PRT	sp|P35585|AP1M1_MOUSE	AP-1 complex subunit mu-1 OS=Mus musculus (Mouse) OX=10090 GN=Ap1m1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.03	14.0	1	1	1
PRT	sp|Q61847|MEP1B_MOUSE	Meprin A subunit beta OS=Mus musculus (Mouse) OX=10090 GN=Mep1b PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null	145-UNIMOD:4	0.02	14.0	1	1	1
PRT	sp|Q9Z2H7|GIPC2_MOUSE	PDZ domain-containing protein GIPC2 OS=Mus musculus (Mouse) OX=10090 GN=Gipc2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.04	14.0	1	1	1
PRT	sp|Q9DD20|MET7B_MOUSE	Methyltransferase-like protein 7B OS=Mus musculus (Mouse) OX=10090 GN=Mettl7b PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null	96-UNIMOD:4	0.05	14.0	1	1	1
PRT	tr|A0A1B0GRG8|A0A1B0GRG8_MOUSE	Predicted gene 5678 OS=Mus musculus (Mouse) OX=10090 GN=Gm5678 PE=3 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.03	14.0	2	1	0
PRT	sp|Q9DCZ1|GMPR1_MOUSE	GMP reductase 1 OS=Mus musculus (Mouse) OX=10090 GN=Gmpr PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.03	14.0	1	1	1
PRT	sp|P62334|PRS10_MOUSE	26S proteasome regulatory subunit 10B OS=Mus musculus (Mouse) OX=10090 GN=Psmc6 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null	170-UNIMOD:4	0.03	14.0	1	1	1
PRT	sp|Q8VDN2|AT1A1_MOUSE	Sodium/potassium-transporting ATPase subunit alpha-1 OS=Mus musculus (Mouse) OX=10090 GN=Atp1a1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.01	14.0	1	1	1
PRT	sp|Q9DCV4|RMD1_MOUSE	Regulator of microtubule dynamics protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Rmdn1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.04	14.0	1	1	1
PRT	sp|O35744|CHIL3_MOUSE	Chitinase-like protein 3 OS=Mus musculus (Mouse) OX=10090 GN=Chil3 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.07	14.0	2	2	2
PRT	sp|P63168|DYL1_MOUSE	Dynein light chain 1, cytoplasmic OS=Mus musculus (Mouse) OX=10090 GN=Dynll1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null	56-UNIMOD:4	0.13	14.0	1	1	1
PRT	sp|Q11011|PSA_MOUSE	Puromycin-sensitive aminopeptidase OS=Mus musculus (Mouse) OX=10090 GN=Npepps PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.02	14.0	1	1	1
PRT	sp|Q9WU78|PDC6I_MOUSE	Programmed cell death 6-interacting protein OS=Mus musculus (Mouse) OX=10090 GN=Pdcd6ip PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.02	14.0	1	1	1
PRT	sp|Q6ZWN5|RS9_MOUSE	40S ribosomal protein S9 OS=Mus musculus (Mouse) OX=10090 GN=Rps9 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.04	14.0	1	1	1
PRT	sp|Q9QZE5|COPG1_MOUSE	Coatomer subunit gamma-1 OS=Mus musculus (Mouse) OX=10090 GN=Copg1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.01	14.0	1	1	1
PRT	sp|Q62393|TPD52_MOUSE	Tumor protein D52 OS=Mus musculus (Mouse) OX=10090 GN=Tpd52 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.07	14.0	1	1	1
PRT	sp|P97315|CSRP1_MOUSE	Cysteine and glycine-rich protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Csrp1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null	25-UNIMOD:4	0.09	14.0	1	1	1
PRT	tr|A0A2I3BRL8|A0A2I3BRL8_MOUSE	RRM domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Gm7324 PE=4 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.04	14.0	1	1	1
PRT	sp|Q9JHL1|NHRF2_MOUSE	Na(+)/H(+) exchange regulatory cofactor NHE-RF2 OS=Mus musculus (Mouse) OX=10090 GN=Slc9a3r2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.04	14.0	1	1	1
PRT	sp|P61967|AP1S1_MOUSE	AP-1 complex subunit sigma-1A OS=Mus musculus (Mouse) OX=10090 GN=Ap1s1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.11	14.0	1	1	1
PRT	sp|P36552|HEM6_MOUSE	Oxygen-dependent coproporphyrinogen-III oxidase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Cpox PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.02	14.0	1	1	1
PRT	sp|Q61233|PLSL_MOUSE	Plastin-2 OS=Mus musculus (Mouse) OX=10090 GN=Lcp1 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.02	14.0	1	1	1
PRT	sp|Q9WTX5|SKP1_MOUSE	S-phase kinase-associated protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Skp1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.09	14.0	1	1	1
PRT	tr|A2AFQ2|A2AFQ2_MOUSE	Isoform of O08756, 3-hydroxyacyl-CoA dehydrogenase type-2 OS=Mus musculus (Mouse) OX=10090 GN=Hsd17b10 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.05	14.0	2	1	0
PRT	sp|Q921M3|SF3B3_MOUSE	Splicing factor 3B subunit 3 OS=Mus musculus (Mouse) OX=10090 GN=Sf3b3 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.01	14.0	1	1	1
PRT	sp|Q04447|KCRB_MOUSE	Creatine kinase B-type OS=Mus musculus (Mouse) OX=10090 GN=Ckb PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.03	14.0	1	1	1
PRT	sp|P50285|FMO1_MOUSE	Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Mus musculus (Mouse) OX=10090 GN=Fmo1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.03	14.0	1	1	1
PRT	sp|Q6P3A8|ODBB_MOUSE	2-oxoisovalerate dehydrogenase subunit beta, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Bckdhb PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null	314-UNIMOD:4	0.03	14.0	1	1	1
PRT	sp|Q8R016|BLMH_MOUSE	Bleomycin hydrolase OS=Mus musculus (Mouse) OX=10090 GN=Blmh PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null	326-UNIMOD:4	0.03	14.0	1	1	1
PRT	sp|Q62465|VAT1_MOUSE	Synaptic vesicle membrane protein VAT-1 homolog OS=Mus musculus (Mouse) OX=10090 GN=Vat1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.04	14.0	1	1	1
PRT	sp|Q9R1P3|PSB2_MOUSE	Proteasome subunit beta type-2 OS=Mus musculus (Mouse) OX=10090 GN=Psmb2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.07	14.0	1	1	1
PRT	sp|Q60972|RBBP4_MOUSE	Histone-binding protein RBBP4 OS=Mus musculus (Mouse) OX=10090 GN=Rbbp4 PE=1 SV=5	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.03	14.0	1	1	1
PRT	sp|Q7TMK9|HNRPQ_MOUSE	Heterogeneous nuclear ribonucleoprotein Q OS=Mus musculus (Mouse) OX=10090 GN=Syncrip PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.02	14.0	1	1	1
PRT	sp|Q9R1P1|PSB3_MOUSE	Proteasome subunit beta type-3 OS=Mus musculus (Mouse) OX=10090 GN=Psmb3 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.07	14.0	1	1	1
PRT	sp|Q8BHN3|GANAB_MOUSE	Neutral alpha-glucosidase AB OS=Mus musculus (Mouse) OX=10090 GN=Ganab PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.01	14.0	1	1	1
PRT	sp|Q99KC8|VMA5A_MOUSE	von Willebrand factor A domain-containing protein 5A OS=Mus musculus (Mouse) OX=10090 GN=Vwa5a PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.02	14.0	1	1	1
PRT	sp|P62855|RS26_MOUSE	40S ribosomal protein S26 OS=Mus musculus (Mouse) OX=10090 GN=Rps26 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.14	14.0	1	1	1
PRT	sp|Q9DAS9|GBG12_MOUSE	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12 OS=Mus musculus (Mouse) OX=10090 GN=Gng12 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.24	14.0	1	1	1
PRT	sp|Q9D8I3|GLOD5_MOUSE	Glyoxalase domain-containing protein 5 OS=Mus musculus (Mouse) OX=10090 GN=Glod5 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null	92-UNIMOD:4	0.18	14.0	1	1	1
PRT	sp|P63037|DNJA1_MOUSE	DnaJ homolog subfamily A member 1 OS=Mus musculus (Mouse) OX=10090 GN=Dnaja1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.07	14.0	1	1	1
PRT	tr|A9C474|A9C474_MOUSE	RIKEN cDNA A630010A05 gene OS=Mus musculus (Mouse) OX=10090 GN=A630010A05Rik PE=4 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.01	14.0	1	1	1
PRT	sp|P15247|IL9_MOUSE	Interleukin-9 OS=Mus musculus (Mouse) OX=10090 GN=Il9 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.05	14.0	1	1	1
PRT	sp|P63001|RAC1_MOUSE	Ras-related C3 botulinum toxin substrate 1 OS=Mus musculus (Mouse) OX=10090 GN=Rac1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.08	14.0	1	1	1
PRT	sp|Q3UEG6|AGT2_MOUSE	Alanine--glyoxylate aminotransferase 2, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Agxt2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.03	14.0	1	1	1
PRT	sp|P23780|BGAL_MOUSE	Beta-galactosidase OS=Mus musculus (Mouse) OX=10090 GN=Glb1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.03	14.0	1	1	1
PRT	sp|P53996|CNBP_MOUSE	Cellular nucleic acid-binding protein OS=Mus musculus (Mouse) OX=10090 GN=Cnbp PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	null	57-UNIMOD:385,57-UNIMOD:4	0.06	14.0	1	1	1
PRT	sp|B2RSH2|GNAI1_MOUSE	Guanine nucleotide-binding protein G(i) subunit alpha-1 OS=Mus musculus (Mouse) OX=10090 GN=Gnai1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.04	14.0	1	1	1
PRT	tr|A0A140LHQ9|A0A140LHQ9_MOUSE	Isoform of Q70IV5, Synemin OS=Mus musculus (Mouse) OX=10090 GN=Synm PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	null	2-UNIMOD:1	0.01	14.0	1	1	1
PRT	tr|A0A2I3BQA5|A0A2I3BQA5_MOUSE	Isoform of Q9D5S7, Guanylate kinase-like domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Lrguk PE=4 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	null	879-UNIMOD:35	0.01	14.0	1	1	1
PRT	sp|Q9Z1T6|FYV1_MOUSE	1-phosphatidylinositol 3-phosphate 5-kinase OS=Mus musculus (Mouse) OX=10090 GN=Pikfyve PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	null		0.01	14.0	1	1	1
PRT	sp|Q3UF25|STIMA_MOUSE	Store-operated calcium entry regulator STIMATE OS=Mus musculus (Mouse) OX=10090 GN=Stimate PE=2 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	null	1-UNIMOD:1,1-UNIMOD:35	0.09	14.0	1	1	1
PRT	sp|P23116|EIF3A_MOUSE	Eukaryotic translation initiation factor 3 subunit A OS=Mus musculus (Mouse) OX=10090 GN=Eif3a PE=1 SV=5	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.01	14.0	1	1	1
PRT	sp|E9Q735|UBE4A_MOUSE	Ubiquitin conjugation factor E4 A OS=Mus musculus (Mouse) OX=10090 GN=Ube4a PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	null		0.01	14.0	1	1	1
PRT	tr|E9PZ36|E9PZ36_MOUSE	Polycystic kidney and hepatic disease 1 OS=Mus musculus (Mouse) OX=10090 GN=Pkhd1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.00	14.0	1	1	1
PRT	sp|P56812|PDCD5_MOUSE	Programmed cell death protein 5 OS=Mus musculus (Mouse) OX=10090 GN=Pdcd5 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	null	2-UNIMOD:1	0.09	14.0	1	1	1
PRT	tr|B1AR69|B1AR69_MOUSE	Myosin, heavy polypeptide 13, skeletal muscle OS=Mus musculus (Mouse) OX=10090 GN=Myh13 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	null	517-UNIMOD:35,522-UNIMOD:4	0.01	14.0	1	1	1
PRT	sp|Q0II04|NEBL_MOUSE	Nebulette OS=Mus musculus (Mouse) OX=10090 GN=Nebl PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.02	14.0	1	1	1
PRT	sp|Q9DB34|CHM2A_MOUSE	Charged multivesicular body protein 2a OS=Mus musculus (Mouse) OX=10090 GN=Chmp2a PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	null		0.04	14.0	1	1	1
PRT	sp|O88425|NDK6_MOUSE	Nucleoside diphosphate kinase 6 OS=Mus musculus (Mouse) OX=10090 GN=Nme6 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	null	99-UNIMOD:35	0.06	14.0	1	1	1
PRT	sp|Q80ST9|LCA5_MOUSE	Lebercilin OS=Mus musculus (Mouse) OX=10090 GN=Lca5 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	null		0.02	14.0	1	1	1
PRT	sp|Q9CPW4|ARPC5_MOUSE	Actin-related protein 2/3 complex subunit 5 OS=Mus musculus (Mouse) OX=10090 GN=Arpc5 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.05	14.0	1	1	1
PRT	sp|Q6P1Y1|RTL3_MOUSE	Retrotransposon Gag-like protein 3 OS=Mus musculus (Mouse) OX=10090 GN=Rtl3 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.01	14.0	1	1	1
PRT	sp|Q8VIG6|TRAIP_MOUSE	E3 ubiquitin-protein ligase TRAIP OS=Mus musculus (Mouse) OX=10090 GN=Traip PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.02	14.0	1	1	1
PRT	sp|Q9WVF7|DPOE1_MOUSE	DNA polymerase epsilon catalytic subunit A OS=Mus musculus (Mouse) OX=10090 GN=Pole PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.01	14.0	1	1	1
PRT	sp|Q8VHJ5|MARK1_MOUSE	Serine/threonine-protein kinase MARK1 OS=Mus musculus (Mouse) OX=10090 GN=Mark1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.02	14.0	1	1	1
PRT	sp|P14873|MAP1B_MOUSE	Microtubule-associated protein 1B OS=Mus musculus (Mouse) OX=10090 GN=Map1b PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.00	14.0	1	1	1
PRT	sp|Q9Z1J3|NFS1_MOUSE	Cysteine desulfurase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Nfs1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.02	14.0	1	1	1
PRT	sp|Q9DAI4|ZBT43_MOUSE	Zinc finger and BTB domain-containing protein 43 OS=Mus musculus (Mouse) OX=10090 GN=Zbtb43 PE=2 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.02	14.0	1	1	1
PRT	tr|Q6NZL1|Q6NZL1_MOUSE	DEAH (Asp-Glu-Ala-His) box polypeptide 37 OS=Mus musculus (Mouse) OX=10090 GN=Dhx37 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.01	14.0	1	1	1
PRT	sp|Q8CDM4|CCD73_MOUSE	Coiled-coil domain-containing protein 73 OS=Mus musculus (Mouse) OX=10090 GN=Ccdc73 PE=2 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.01	14.0	1	1	1
PRT	sp|Q3ZT31|SNX25_MOUSE	Sorting nexin-25 OS=Mus musculus (Mouse) OX=10090 GN=Snx25 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.01	14.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	VADALANAAGHLDDLPGALSALSDLHAHK	1	tr|Q91VB8|Q91VB8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	63		ms_run[1]:scan=1.1.3431.2	60.80397	5	2862.489618	2862.462420	K	L	63	92
PSM	LLSHCLLVTLASHHPADFTPAVHASLDK	2	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	59	5-UNIMOD:4	ms_run[1]:scan=1.1.3016.2	49.18272	5	3049.608618	3049.580761	K	F	101	129
PSM	AIVAGDEVAQEVDAVAPDCSFLK	3	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	50	19-UNIMOD:4	ms_run[1]:scan=1.1.3510.6	63.00232	3	2403.182471	2403.162792	R	I	156	179
PSM	LLSHCLLVTLASHHPADFTPAVHASLDK	4	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	47	5-UNIMOD:4	ms_run[1]:scan=1.1.3023.5	49.37158	5	3049.608618	3049.580761	K	F	101	129
PSM	DATNVGDEGGFAPNILENK	5	sp|P17182|ENOA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	45		ms_run[1]:scan=1.1.3146.21	52.83792	2	1959.932047	1959.917400	K	E	203	222
PSM	EGPAPIPAPLEATGSEPTEDAEGHKPK	6	sp|Q9JIL4|NHRF3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	44		ms_run[1]:scan=1.1.2544.13	36.00417	4	2724.339294	2724.324255	K	L	351	378
PSM	APAAIGPYSQAVQVDR	7	sp|P52760|RIDA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	44		ms_run[1]:scan=1.1.2669.20	39.47062	2	1641.851047	1641.847470	K	T	14	30
PSM	VAPEEHPVLLTEAPLNPK	8	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	44		ms_run[1]:scan=1.1.2748.12	41.68027	3	1953.075671	1953.057128	R	A	96	114
PSM	TADGDLAGTVHPQLQDHDFEPLRPGEPIFK	9	sp|Q91XE4|ACY3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	44		ms_run[1]:scan=1.1.3053.12	50.21612	5	3299.648618	3299.621105	R	L	233	263
PSM	IVSNASCTTNCLAPLAK	10	tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	43	7-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=1.1.2562.21	36.50105	2	1818.905247	1818.896805	K	V	144	161
PSM	VIVVGNPANTNCLTASK	11	sp|P14152|MDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	43	12-UNIMOD:4	ms_run[1]:scan=1.1.2632.21	38.44278	2	1756.923847	1756.914169	K	S	126	143
PSM	SGYQQAASEHGLVVIAPDTSPR	12	sp|Q9R0P3|ESTD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	43		ms_run[1]:scan=1.1.2681.17	39.80605	3	2282.140871	2282.129124	K	G	65	87
PSM	LVQDVANNTNEEAGDGTTTATVLAR	13	sp|P63038|CH60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	43		ms_run[1]:scan=1.1.2711.21	40.64788	3	2559.255071	2559.241253	K	S	97	122
PSM	TIYISGQVGLDPSSGQLVPGGVVEEAK	14	sp|P52760|RIDA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	43		ms_run[1]:scan=1.1.3440.13	61.05643	3	2699.424371	2699.401777	R	Q	30	57
PSM	TYFPHFDVSHGSAQVK	15	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	42		ms_run[1]:scan=1.1.2548.11	36.10873	3	1818.879071	1818.868933	K	G	42	58
PSM	IVSNASCTTNCLAPLAK	16	tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	42	7-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=1.1.2561.21	36.47305	2	1818.905247	1818.896805	K	V	144	161
PSM	IVSNASCTTNCLAPLAK	17	tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	42	7-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=1.1.2560.21	36.4449	2	1818.905247	1818.896805	K	V	144	161
PSM	KVITAFNDGLNHLDSLK	18	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	42		ms_run[1]:scan=1.1.2747.14	41.6547	3	1884.021671	1884.010512	K	G	67	84
PSM	HIDCASVYGNETEIGEALK	19	sp|Q9JII6|AK1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	42	4-UNIMOD:4	ms_run[1]:scan=1.1.2778.16	42.51632	3	2104.983671	2104.973535	R	E	43	62
PSM	QAGIAQLYGIAGSTNVTGDQVK	20	sp|Q9QXD6|F16P1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	42		ms_run[1]:scan=1.1.3147.17	52.86337	3	2190.138671	2190.128061	R	K	51	73
PSM	FLHDPSATQGFVGCALSSNIQR	21	sp|P17563|SBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	42	14-UNIMOD:4	ms_run[1]:scan=1.1.2984.19	48.31575	3	2404.167671	2404.159378	R	F	255	277
PSM	LLSHCLLVTLASHHPADFTPAVHASLDK	22	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	42	5-UNIMOD:4	ms_run[1]:scan=1.1.3022.2	49.34295	6	3049.607541	3049.580761	K	F	101	129
PSM	LLSHCLLVTLASHHPADFTPAVHASLDK	23	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	42	5-UNIMOD:4	ms_run[1]:scan=1.1.3015.3	49.15505	6	3049.607541	3049.580761	K	F	101	129
PSM	IVSNASCTTNCLAPLAK	24	tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	41	7-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=1.1.2563.21	36.529	2	1818.905247	1818.896805	K	V	144	161
PSM	AGESVLVHGASGGVGLATCQIAR	25	sp|P47199|QOR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	41	19-UNIMOD:4	ms_run[1]:scan=1.1.2736.20	41.35173	3	2209.135271	2209.127350	R	A	148	171
PSM	SYELPDGQVITIGNER	26	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	41		ms_run[1]:scan=1.1.3188.21	54.01467	2	1789.897647	1789.884643	K	F	239	255
PSM	DQSPASHEIATNLGDFAISLYR	27	sp|P07758|A1AT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	41		ms_run[1]:scan=1.1.3575.17	64.85963	3	2404.186871	2404.165903	K	E	36	58
PSM	TYFPHFDVSHGSAQVK	28	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	40		ms_run[1]:scan=1.1.2543.21	35.98217	2	1818.877447	1818.868933	K	G	42	58
PSM	ALNDHHVYLEGTLLKPNMVTAGHACTK	29	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	40	25-UNIMOD:4	ms_run[1]:scan=1.1.2586.16	37.16792	5	2989.510618	2989.490232	K	K	216	243
PSM	AMGAAQVVVTDLSASR	30	sp|Q64442|DHSO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	40		ms_run[1]:scan=1.1.2989.9	48.44875	2	1574.814447	1574.808641	K	L	194	210
PSM	VGDAIPSVEVFEGEPGK	31	sp|P99029|PRDX5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	40		ms_run[1]:scan=1.1.3131.20	52.41003	2	1728.867447	1728.857031	K	K	54	71
PSM	DLYANTVLSGGTTMYPGIADR	32	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	40		ms_run[1]:scan=1.1.3472.11	61.93056	3	2214.079571	2214.062684	K	M	292	313
PSM	AGAGSATLSMAYAGAR	33	sp|P08249|MDHM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	39		ms_run[1]:scan=1.1.2548.18	36.11457	2	1453.700847	1453.698362	K	F	242	258
PSM	GILAADESVGTMGNR	34	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	39		ms_run[1]:scan=1.1.2634.19	38.49693	2	1489.725447	1489.719492	K	L	29	44
PSM	STEPCAHLLVSSIGVVGTAEQNR	35	sp|O35215|DOPD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	39	5-UNIMOD:4	ms_run[1]:scan=1.1.3002.19	48.80842	3	2424.222671	2424.206723	K	T	53	76
PSM	HVLSTFGPVPEFSGATVER	36	sp|Q99KP3|CRYL1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	39		ms_run[1]:scan=1.1.3024.12	49.40432	3	2029.029071	2029.026891	K	V	261	280
PSM	GIHVEIPGAQAESLGPLQVAR	37	sp|Q9DCW4|ETFB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	39		ms_run[1]:scan=1.1.3141.13	52.68763	3	2141.172971	2141.159302	R	V	86	107
PSM	RPLIDQVVQTALSETQDPEEVSVTVK	38	sp|Q68FD5|CLH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	39		ms_run[1]:scan=1.1.3619.14	66.09875	3	2880.534371	2880.508033	R	A	968	994
PSM	VNQIGSVTESIQACK	39	sp|P21550|ENOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	39	14-UNIMOD:4	ms_run[1]:scan=1.1.2612.19	37.89475	2	1632.819247	1632.814121	K	L	344	359
PSM	GAAQNIIPASTGAAK	40	tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=1.1.2282.21	28.77923	2	1368.736047	1368.736128	R	A	199	214
PSM	LIASVADDEAAVPNNK	41	sp|P16125|LDHB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=1.1.2521.21	35.36727	2	1625.827247	1625.826065	K	I	8	24
PSM	TYFPHFDVSHGSAQVK	42	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=1.1.2540.17	35.89657	3	1818.879071	1818.868933	K	G	42	58
PSM	ECCHGDLLECADDRAELAK	43	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	38	2-UNIMOD:4,3-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.2430.13	32.85988	3	2260.957571	2260.951102	K	Y	268	287
PSM	APAAIGPYSQAVQVDR	44	sp|P52760|RIDA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=1.1.2662.9	39.2796	2	1641.851047	1641.847470	K	T	14	30
PSM	VIVVGNPANTNCLTASK	45	sp|P14152|MDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	38	12-UNIMOD:4	ms_run[1]:scan=1.1.2638.20	38.60927	2	1756.923847	1756.914169	K	S	126	143
PSM	APSSSSVGISEWLDQK	46	sp|Q99LC5|ETFA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=1.1.3079.20	50.95133	2	1689.827647	1689.820980	K	L	188	204
PSM	LLSHCLLVTLASHHPADFTPAVHASLDK	47	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	38	5-UNIMOD:4	ms_run[1]:scan=1.1.3009.10	48.99778	5	3049.608618	3049.580761	K	F	101	129
PSM	SPTGLTLGSLVDEIQR	48	sp|Q9DBM2|ECHP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=1.1.3492.17	62.50032	2	1684.908847	1684.899565	K	Y	68	84
PSM	HPDEPVLLEEPVVLALAEK	49	sp|Q9JII6|AK1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=1.1.3562.8	64.48605	3	2097.156371	2097.135772	R	H	222	241
PSM	VADALANAAGHLDDLPGALSALSDLHAHK	50	tr|Q91VB8|Q91VB8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=1.1.3443.2	61.12517	5	2862.489618	2862.462420	K	L	63	92
PSM	VLSSYPINTLVGAPIIYR	51	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=1.1.3593.6	65.34544	3	1977.135971	1975.114249	K	M	300	318
PSM	GAAQNIIPASTGAAK	52	tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=1.1.2289.16	28.96862	2	1368.736047	1368.736128	R	A	199	214
PSM	VLQATVVAVGSGGK	53	sp|Q64433|CH10_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=1.1.2436.18	33.02212	2	1284.739647	1284.740151	K	G	41	55
PSM	ELGATECINPQDYSK	54	sp|P00329|ADH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	37	7-UNIMOD:4	ms_run[1]:scan=1.1.2617.15	38.0313	2	1723.777847	1723.772316	K	P	235	250
PSM	KVITAFNDGLNHLDSLK	55	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=1.1.2757.16	41.92902	3	1884.021671	1884.010512	K	G	67	84
PSM	AHIMPAEFSSCPLNSDEAVNK	56	sp|Q91V76|CK054_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	37	11-UNIMOD:4	ms_run[1]:scan=1.1.2729.16	41.15838	3	2316.059771	2316.051467	K	W	216	237
PSM	LSQTFPNADFAEITK	57	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=1.1.3103.18	51.62842	2	1680.846247	1680.835902	R	L	243	258
PSM	APSSSSVGISEWLDQK	58	sp|Q99LC5|ETFA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=1.1.3073.19	50.78143	2	1689.827647	1689.820980	K	L	188	204
PSM	AVLGPLVGAVDQGTSSTR	59	sp|Q64516|GLPK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=1.1.2987.9	48.39823	2	1726.922847	1726.921363	K	F	7	25
PSM	VCLIGCGFSTGYGSAVK	60	sp|P00329|ADH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	37	2-UNIMOD:4,6-UNIMOD:4	ms_run[1]:scan=1.1.3011.18	49.06005	2	1774.847847	1774.838227	K	V	170	187
PSM	IGPSEVENALMEHPAVSETAVISSPDPSRGEVVK	61	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=1.1.3163.13	53.32153	4	3529.741694	3530.756278	R	A	474	508
PSM	SVTEQGAELSNEER	62	sp|P63101|1433Z_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=1.1.2114.21	24.10488	2	1547.711847	1547.706344	K	N	28	42
PSM	VNADEVGGEALGR	63	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=1.1.2345.12	30.51877	2	1285.626047	1285.626243	K	L	19	32
PSM	VNADEVGGEALGR	64	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=1.1.2338.8	30.32555	2	1285.626047	1285.626243	K	L	19	32
PSM	VNADEVGGEALGR	65	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=1.1.2337.16	30.3003	2	1285.626047	1285.626243	K	L	19	32
PSM	VAVTGGTHGNEMCGVYLAR	66	sp|Q91XE4|ACY3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	36	13-UNIMOD:4	ms_run[1]:scan=1.1.2481.18	34.24605	3	1990.941071	1990.935315	R	Y	14	33
PSM	APQVSTPTLVEAAR	67	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=1.1.2596.18	37.45222	2	1438.782047	1438.777993	K	N	439	453
PSM	LIGPNCPGVINPGECK	68	sp|Q9WUM5|SUCA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	36	6-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=1.1.2655.21	39.09073	2	1723.845047	1723.838562	R	I	167	183
PSM	AGGLATTGDKDILDIVPTEIHQK	69	sp|Q9QXD6|F16P1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=1.1.3006.8	48.91247	4	2391.276494	2391.264555	K	A	292	315
PSM	LGEYGFQNAILVR	70	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=1.1.3160.12	53.23243	2	1478.796247	1478.788164	K	Y	422	435
PSM	VINEPTAAALAYGLDK	71	sp|P38647|GRP75_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=1.1.3082.16	51.03338	2	1644.882247	1644.872287	R	S	219	235
PSM	KLDILSNDLVINMLK	72	sp|Q9QXD6|F16P1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=1.1.3569.3	64.67852	3	1727.996471	1727.985543	K	S	73	88
PSM	NQVAMNPTNTVFDAK	73	sp|P63017|HSP7C_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=1.1.2686.12	39.94838	2	1648.792047	1648.787906	K	R	57	72
PSM	QHLQIQSSQSDLGK	74	sp|Q9DCY0|KEG1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	36	1-UNIMOD:28	ms_run[1]:scan=1.1.2430.14	32.86155	2	1550.7716	1550.7684	K	V	99	113
PSM	TCVADESAANCDK	75	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	35	2-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=1.1.1812.21	15.72147	2	1439.564647	1439.565694	K	S	76	89
PSM	LDQGGAPLAGTNK	76	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=1.1.2032.21	21.84972	2	1240.639247	1240.641165	K	E	109	122
PSM	GCITIIGGGDTATCCAK	77	sp|P09411|PGK1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	35	2-UNIMOD:4,14-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=1.1.2550.14	36.16938	2	1753.785647	1753.779726	R	W	366	383
PSM	LGGEVSCLVAGTK	78	sp|Q99LC5|ETFA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	35	7-UNIMOD:4	ms_run[1]:scan=1.1.2602.15	37.61465	2	1289.664647	1289.664937	R	C	47	60
PSM	EAFQEALAAAGDK	79	sp|P10639|THIO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=1.1.2744.16	41.57327	2	1319.638247	1319.635745	K	L	9	22
PSM	GDVTTQVALQPALK	80	sp|P09671|SODM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=1.1.2696.17	40.21677	2	1439.801047	1439.798394	K	F	76	90
PSM	THLPGFVEQAGALK	81	sp|P99029|PRDX5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=1.1.2653.4	39.02097	3	1466.787371	1466.788164	K	A	99	113
PSM	THLPGFVEQAGALK	82	sp|P99029|PRDX5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=1.1.2659.2	39.18767	3	1466.787371	1466.788164	K	A	99	113
PSM	AEAEAQAEELSFPR	83	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=1.1.2704.19	40.44598	2	1546.732647	1546.726351	R	S	929	943
PSM	AEAEAQAEELSFPR	84	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=1.1.2710.18	40.6168	2	1546.732647	1546.726351	R	S	929	943
PSM	ESAAIYFTSGTSGPPK	85	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=1.1.2683.20	39.86523	2	1611.781847	1611.778053	R	M	214	230
PSM	VAPEEHPVLLTEAPLNPK	86	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=1.1.2749.6	41.70667	3	1953.075671	1953.057128	R	A	96	114
PSM	ALNDHHVYLEGTLLKPNMVTAGHACTK	87	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	35	25-UNIMOD:4	ms_run[1]:scan=1.1.2585.11	37.13615	5	2989.510618	2989.490232	K	K	216	243
PSM	GVVDSEDIPLNLSR	88	sp|Q9CQN1|TRAP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=1.1.3036.17	49.7367	2	1512.782647	1512.778387	R	E	391	405
PSM	GGNASNSCTVLSLLGAR	89	sp|P97328|KHK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	35	8-UNIMOD:4	ms_run[1]:scan=1.1.3189.17	54.03882	2	1675.840447	1675.831168	R	C	40	57
PSM	VLSSYPINTLVGAPIIYR	90	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=1.1.3591.21	65.30257	2	1975.130447	1975.114249	K	M	300	318
PSM	TTVLLADMNDFGTVNEIYK	91	sp|P52760|RIDA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=1.1.3586.3	65.15372	3	2143.071671	2143.050722	K	T	79	98
PSM	ASYISSAQLDQPDPGAVAAAAIFR	92	sp|Q8VC30|TKFC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=1.1.3600.13	65.55082	3	2418.236771	2418.217939	R	A	544	568
PSM	HVGDLGNVTAGK	93	sp|P08228|SODC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=1.1.1970.19	20.12795	2	1166.599647	1166.604386	R	D	81	93
PSM	GTSFEAAATSGGSASSEK	94	sp|Q99LC5|ETFA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=1.1.2096.21	23.60947	2	1643.726847	1643.727474	R	A	170	188
PSM	VIQCFAETGQVQK	95	sp|Q68FD5|CLH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34	4-UNIMOD:4	ms_run[1]:scan=1.1.2358.16	30.87383	2	1506.749047	1506.750064	K	I	488	501
PSM	GILAADESTGSIAK	96	tr|A6ZI47|A6ZI47_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=1.1.2453.14	33.4876	2	1331.691847	1331.693260	K	R	29	43
PSM	GCITIIGGGDTATCCAK	97	sp|P09411|PGK1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34	2-UNIMOD:4,14-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=1.1.2557.21	36.36143	2	1753.785647	1753.779726	R	W	366	383
PSM	GVEVTVGHEQEEGGKWPYAGTAEAIK	98	sp|Q9D172|GAL3A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=1.1.2659.6	39.20102	3	2741.342771	2741.329674	K	A	187	213
PSM	VILSSSSSCLLPSK	99	sp|Q99KP3|CRYL1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34	9-UNIMOD:4	ms_run[1]:scan=1.1.2741.19	41.49148	2	1476.788247	1476.785781	R	L	117	131
PSM	LEGTNVQEAQNILK	100	sp|Q9Z2I8|SUCB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=1.1.2694.19	40.16315	2	1555.823647	1555.820586	R	S	394	408
PSM	ALNDHHVYLEGTLLKPNMVTAGHACTK	101	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34	25-UNIMOD:4	ms_run[1]:scan=1.1.2587.13	37.19318	5	2989.510618	2989.490232	K	K	216	243
PSM	VFLTTAEVISQQVSDK	102	sp|P06801|MAOX_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=1.1.3134.20	52.49425	2	1763.939447	1763.930531	K	H	477	493
PSM	LISWYDNEYGYSNR	103	tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=1.1.3024.18	49.41015	2	1778.798247	1778.790014	K	V	308	322
PSM	HSMNPFCEIAVEEAVR	104	sp|Q9DCW4|ETFB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34	7-UNIMOD:4	ms_run[1]:scan=1.1.3026.5	49.45564	3	1887.863771	1887.860753	K	L	36	52
PSM	ISSVQSIVPALEIANAHR	105	sp|P63038|CH60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=1.1.3116.6	51.97538	3	1904.057771	1904.047960	K	K	251	269
PSM	VLNNMEIGTSLYDEEGAK	106	sp|P09411|PGK1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=1.1.3015.12	49.17008	2	1981.944647	1981.930273	K	I	247	265
PSM	HVLSTFGPVPEFSGATVER	107	sp|Q99KP3|CRYL1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=1.1.3023.8	49.37658	3	2029.029071	2029.026891	K	V	261	280
PSM	AFVVLAPEFLSHDRDQLTK	108	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=1.1.3112.4	51.8651	4	2185.163694	2185.153154	K	V	508	527
PSM	FAAEHTIFASNTSSLQITNIANATTR	109	sp|Q61425|HCDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=1.1.3182.19	53.84789	3	2778.417671	2778.393672	K	Q	137	163
PSM	VVLAYEPVWAIGTGK	110	sp|P17751|TPIS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=1.1.3422.13	60.56662	2	1601.891047	1601.881730	K	T	211	226
PSM	HPDEPVLLEEPVVLALAEK	111	sp|Q9JII6|AK1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=1.1.3568.7	64.65379	3	2097.156371	2097.135772	R	H	222	241
PSM	HPDEPVLLEEPVVLALAEK	112	sp|Q9JII6|AK1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=1.1.3574.9	64.82457	3	2097.156371	2097.135772	R	H	222	241
PSM	HEIIQTLQMTDGLIPLEIR	113	sp|P17563|SBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=1.1.3603.12	65.63302	3	2219.215571	2219.198389	R	F	236	255
PSM	FLPGAHVFPGGVLDAADSSPDWVR	114	sp|P11930|NUD19_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=1.1.3466.14	61.76885	3	2509.257971	2509.239009	R	L	40	64
PSM	TASSVLLHTGQK	115	sp|Q9JII6|AK1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	34	1-UNIMOD:1	ms_run[1]:scan=1.1.2496.14	34.65962	2	1282.6859	1282.6876	M	M	2	14
PSM	KPMVLGHEAAGTVTK	116	sp|Q64442|DHSO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=1.1.1904.17	18.28893	3	1537.827671	1537.828648	K	V	64	79
PSM	YMCENQATISSK	117	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33	3-UNIMOD:4	ms_run[1]:scan=1.1.2063.21	22.69775	2	1430.616847	1430.617001	K	L	287	299
PSM	VVAGVAAALAHK	118	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=1.1.2233.10	27.42247	2	1105.658447	1105.660778	K	Y	134	146
PSM	VNADEVGGEALGR	119	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=1.1.2359.8	30.89812	2	1285.626047	1285.626243	K	L	19	32
PSM	IIYGGSVTGATCK	120	sp|P17751|TPIS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33	12-UNIMOD:4	ms_run[1]:scan=1.1.2282.19	28.77757	2	1325.664447	1325.664937	R	E	257	270
PSM	IGGHGAEYGAEALER	121	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=1.1.2205.10	26.65785	3	1528.729271	1528.727020	K	M	18	33
PSM	LGTAAIQGAIEK	122	sp|Q8QZT1|THIL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=1.1.2477.15	34.13428	2	1170.657847	1170.660838	K	A	64	76
PSM	VAPLGAELQESAR	123	sp|Q00623|APOA1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=1.1.2534.20	35.7312	2	1339.708047	1339.709579	K	Q	142	155
PSM	EGVVECSFVQSK	124	sp|P08249|MDHM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33	6-UNIMOD:4	ms_run[1]:scan=1.1.2443.18	33.21547	2	1367.638647	1367.639116	K	E	270	282
PSM	ETTIQGLDGLSER	125	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=1.1.2746.18	41.63062	2	1417.707647	1417.704888	K	C	122	135
PSM	NAVTQEFGPVPDTAR	126	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=1.1.2689.11	40.02932	2	1600.787047	1600.784535	R	Y	634	649
PSM	VDATEESDLAQQYGVR	127	sp|P09103|PDIA1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=1.1.2781.20	42.60423	2	1779.833047	1779.827522	K	G	84	100
PSM	DQTNDQVTIDSALATQK	128	sp|P54071|IDHP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=1.1.2774.21	42.40933	2	1846.901647	1846.890851	R	Y	90	107
PSM	ALNDHHVYLEGTLLKPNMVTAGHACTK	129	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33	25-UNIMOD:4	ms_run[1]:scan=1.1.2588.15	37.22278	5	2989.510618	2989.490232	K	K	216	243
PSM	KWDTCAPEVILHAVGGK	130	sp|Q9Z0S1|BPNT1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33	5-UNIMOD:4	ms_run[1]:scan=1.1.2987.4	48.38655	3	1879.961471	1879.961454	K	L	245	262
PSM	GSQGGLSQDFVEALK	131	sp|Q7TNG8|LDHD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=1.1.3062.19	50.46712	2	1534.769247	1534.762737	R	A	22	37
PSM	IINEPTAAAIAYGLDK	132	sp|P16627|HS71L_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=1.1.3119.19	52.06912	2	1658.896647	1658.887937	R	G	174	190
PSM	LSQTFPNADFAEITK	133	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=1.1.3096.17	51.43425	2	1680.846247	1680.835902	R	L	243	258
PSM	VITAFNDGLNHLDSLK	134	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=1.1.2984.5	48.30407	3	1755.927671	1755.915549	K	G	68	84
PSM	SYELPDGQVITIGNER	135	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=1.1.3181.18	53.81953	2	1789.897647	1789.884643	K	F	239	255
PSM	AYHEQLSVAEITNACFEPANQMVK	136	sp|P05213|TBA1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33	15-UNIMOD:4	ms_run[1]:scan=1.1.3127.20	52.2964	3	2749.303571	2749.283987	K	C	281	305
PSM	HSMNPFCEIAVEEAVR	137	sp|Q9DCW4|ETFB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33	7-UNIMOD:4	ms_run[1]:scan=1.1.3019.3	49.27157	3	1887.863771	1887.860753	K	L	36	52
PSM	VNAGDQPGADLGPLITPQAK	138	sp|Q9EQ20|MMSA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=1.1.2984.10	48.30824	3	1961.027471	1961.021805	R	E	345	365
PSM	IAEVGGVPYLLPLVNK	139	sp|Q91V76|CK054_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=1.1.3607.15	65.7503	2	1680.994047	1680.981444	R	K	59	75
PSM	HPDEPVLLEEPVVLALAEK	140	sp|Q9JII6|AK1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=1.1.3556.6	64.31215	3	2097.156371	2097.135772	R	H	222	241
PSM	DVGGIVLANACGPCIGQWDR	141	sp|Q99KI0|ACON_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33	11-UNIMOD:4,14-UNIMOD:4	ms_run[1]:scan=1.1.3501.13	62.75755	3	2157.025271	2157.009543	R	K	438	458
PSM	KHHLDGETEEER	142	sp|P10649|GSTM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.1577.17	9.198083	3	1478.672471	1478.674984	R	I	83	95
PSM	AAQAHEDIIHGSGK	143	sp|P47199|QOR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.1713.8	12.96157	3	1432.702871	1432.705891	K	T	310	324
PSM	KLDEAVAEAHLGK	144	sp|P50247|SAHH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.2106.12	23.87712	3	1379.733071	1379.740879	K	L	389	402
PSM	VVAGVAAALAHK	145	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.2234.11	27.45605	2	1105.658447	1105.660778	K	Y	134	146
PSM	GGGALVENTTTGLSR	146	sp|Q60866|PTER_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.2360.9	30.92752	2	1431.731847	1431.731771	K	D	91	106
PSM	STGSVVGQQPFGGAR	147	sp|Q8CHT0|AL4A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.2351.20	30.68157	2	1446.719847	1446.721541	K	A	509	524
PSM	TYFPHFDVSHGSAQVK	148	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.2550.2	36.1552	4	1818.868894	1818.868933	K	G	42	58
PSM	VNIHGGAVSLGHPIGMSGAR	149	sp|Q8QZT1|THIL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.2405.11	32.15927	4	1928.996094	1929.000299	K	I	371	391
PSM	EGPAPIPAPLEATGSEPTEDAEGHKPK	150	sp|Q9JIL4|NHRF3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.2543.18	35.97965	4	2724.339294	2724.324255	K	L	351	378
PSM	YDYEEVEAEGANK	151	sp|Q9D0F9|PGM1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.2399.21	32.00182	2	1515.639647	1515.636533	R	M	428	441
PSM	IMDPNIVGNEHYDVAR	152	sp|P56480|ATPB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.2642.14	38.71788	3	1841.877371	1841.873032	R	G	407	423
PSM	EHALLAYTLGVK	153	sp|P10126|EF1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.2744.15	41.57243	2	1313.733047	1313.734337	R	Q	135	147
PSM	GAQFSVNYSQGSLR	154	sp|Q3UNZ8|QORL2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.2615.8	37.97747	2	1512.735247	1512.732105	R	D	209	223
PSM	EIYGQTETGLICR	155	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32	12-UNIMOD:4	ms_run[1]:scan=1.1.2668.18	39.44158	2	1538.740847	1538.739893	R	V	360	373
PSM	IYQIYEGTAQIQR	156	sp|P45952|ACADM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.2698.18	40.27347	2	1581.816447	1581.815107	K	L	396	409
PSM	APNSPDVLEIEFKK	157	sp|P16460|ASSY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.2762.9	42.0636	3	1585.840271	1585.835174	K	G	216	230
PSM	DTCFSTEGPNLVTR	158	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32	3-UNIMOD:4	ms_run[1]:scan=1.1.2778.19	42.51882	2	1595.733047	1595.724971	K	C	589	603
PSM	KVITAFNDGLNHLDSLK	159	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.2750.2	41.72626	4	1884.014894	1884.010512	K	G	67	84
PSM	VAPEEHPVLLTEAPLNPK	160	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.2742.13	41.51468	3	1953.075671	1953.057128	R	A	96	114
PSM	VSDLAGLDVGWK	161	sp|Q9DBM2|ECHP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.3113.6	51.8937	2	1258.654447	1258.655752	R	V	516	528
PSM	FVEGLPINDFSR	162	sp|P14152|MDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.3161.11	53.25888	2	1392.708847	1392.703765	K	E	299	311
PSM	VFDYSEYWEGAR	163	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.3163.7	53.31152	2	1520.664847	1520.657209	R	G	831	843
PSM	FSSETWQNLGTLQR	164	sp|Q8VCR7|ABHEB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.3005.17	48.89198	2	1665.818847	1665.811084	R	L	43	57
PSM	SSGLPITSAVDLEDAAK	165	sp|Q9Z2I8|SUCB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.3127.16	52.29305	2	1672.861047	1672.851946	K	K	408	425
PSM	AVLGPLVGAVDQGTSSTR	166	sp|Q64516|GLPK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.2994.10	48.58022	2	1726.922847	1726.921363	K	F	7	25
PSM	VSHALAEGLGVIACIGEK	167	sp|P17751|TPIS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32	14-UNIMOD:4	ms_run[1]:scan=1.1.3123.8	52.17283	3	1822.973171	1822.961119	K	L	164	182
PSM	KQGLLPLTFADPSDYNK	168	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.3111.7	51.84052	3	1906.000871	1905.983629	K	I	701	718
PSM	VNAGDQPGADLGPLITPQAK	169	sp|Q9EQ20|MMSA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.2991.21	48.50588	2	1961.030647	1961.021805	R	E	345	365
PSM	FTASAGIQVVGDDLTVTNPK	170	sp|P17182|ENOA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.3166.10	53.39407	3	2032.060571	2032.047686	K	R	307	327
PSM	AGAPPGLFNVVQGGAATGQFLCHHR	171	sp|Q9JLJ2|AL9A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32	22-UNIMOD:4	ms_run[1]:scan=1.1.3075.9	50.82957	4	2561.284494	2561.270995	K	E	199	224
PSM	LLSHCLLVTLASHHPADFTPAVHASLDK	172	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32	5-UNIMOD:4	ms_run[1]:scan=1.1.3009.11	48.99863	5	3049.608618	3049.580761	K	F	101	129
PSM	ADHQPLTEASYVNLPTIALCNTDSPLR	173	sp|P14206|RSSA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32	20-UNIMOD:4	ms_run[1]:scan=1.1.3438.7	61.0063	3	2995.474271	2995.470936	R	Y	129	156
PSM	LLIQSEFPSLLK	174	sp|P97816|S100G_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.3458.7	61.54572	2	1386.818247	1386.812253	K	A	34	46
PSM	LICCDILDVLDK	175	sp|P62259|1433E_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32	3-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=1.1.3571.11	64.74155	2	1475.741847	1475.736388	K	H	95	107
PSM	GLGGVNVEELFGISK	176	sp|Q9Z2V4|PCKGC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.3628.9	66.35288	2	1517.819247	1517.808959	K	E	568	583
PSM	FYAYNPLAGGLLTGK	177	sp|Q8CG76|ARK72_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.3438.3	60.99462	2	1583.839647	1583.834780	R	Y	230	245
PSM	ALTVPELTQQMFDAK	178	sp|P68372|TBB4B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.3440.12	61.05477	2	1690.871647	1690.860008	R	N	283	298
PSM	AASDLQIAASTFTSFGK	179	sp|Q9DC50|OCTC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.3420.4	60.50262	3	1713.859871	1713.857366	K	K	390	407
PSM	AVFVDLEPTVIDEIR	180	sp|P68368|TBA4A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.3610.13	65.83495	2	1714.927247	1714.914152	R	N	65	80
PSM	KFPLDPLITHVLPFEK	181	sp|P00329|ADH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.3434.3	60.88917	3	1893.087071	1893.076407	K	I	340	356
PSM	KFPLDPLITHVLPFEK	182	sp|P00329|ADH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.3420.9	60.50678	3	1893.087071	1893.076407	K	I	340	356
PSM	IPNIYAIGDVVAGPMLAHK	183	sp|O08749|DLDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.3527.5	63.47567	3	1978.085771	1978.071004	K	A	347	366
PSM	AVLDVAETGTEAAAATGVIGGIR	184	sp|P07759|SPA3K_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.3416.12	60.39418	3	2141.142071	2141.132812	K	K	361	384
PSM	RPLIDQVVQTALSETQDPEEVSVTVK	185	sp|Q68FD5|CLH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.3613.21	65.9279	3	2880.534371	2880.508033	R	A	968	994
PSM	QTANVLSGACGLHR	186	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	32	1-UNIMOD:28,10-UNIMOD:4	ms_run[1]:scan=1.1.2662.7	39.27543	2	1465.7136	1465.7091	K	G	92	106
PSM	VIGSGCNLDSAR	187	sp|P00342|LDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31	6-UNIMOD:4	ms_run[1]:scan=1.1.2094.21	23.5553	2	1247.590047	1247.592835	R	F	158	170
PSM	TRPTVAAGAVGLAQR	188	sp|P45952|ACADM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.2198.16	26.46893	3	1466.829371	1466.831760	R	A	280	295
PSM	IGGHGAEYGAEALER	189	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.2212.13	26.84863	3	1528.729271	1528.727020	K	M	18	33
PSM	EIVHIQAGQCGNQIGAK	190	sp|P99024|TBB5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31	10-UNIMOD:4	ms_run[1]:scan=1.1.2286.7	28.88287	3	1821.916871	1821.915566	R	F	3	20
PSM	NAGVEGSLIVEK	191	sp|P63038|CH60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.2429.18	32.83204	2	1214.649247	1214.650667	K	I	482	494
PSM	LPANALLGEENK	192	sp|P51174|ACADL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.2551.9	36.18807	2	1267.676647	1267.677216	R	G	268	280
PSM	VMVDANEVPIQK	193	sp|Q9D964|GATM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.2545.5	36.03287	2	1341.700447	1341.696237	R	M	370	382
PSM	ALIAAQYSGAQVR	194	sp|Q9D8N0|EF1G_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.2494.15	34.60552	2	1346.729047	1346.730649	K	V	18	31
PSM	GYDVIAQAQSGTGK	195	sp|P10630|IF4A2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.2398.21	31.97443	2	1393.684247	1393.683758	K	T	70	84
PSM	EILGTAQSVGCNVDGR	196	sp|P35979|RL12_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31	11-UNIMOD:4	ms_run[1]:scan=1.1.2545.6	36.03622	2	1674.803047	1674.799533	K	H	131	147
PSM	IVYGHLDDPANQEIER	197	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.2510.15	35.04832	3	1867.913471	1867.906441	K	G	69	85
PSM	LGQSDPAPLQHQVDIYQK	198	sp|P40142|TKT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.2548.16	36.1129	3	2036.041871	2036.032704	R	R	187	205
PSM	LGDVYVNDAFGTAHR	199	sp|P09041|PGK2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.2664.12	39.32845	3	1633.788071	1633.784869	K	A	157	172
PSM	SFLVGSAAQSLSK	200	sp|Q9R0H0|ACOX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.2715.16	40.7585	2	1293.693047	1293.692866	R	A	283	296
PSM	TDTDAELDLVSR	201	sp|Q922D8|C1TC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.2698.14	40.27013	2	1333.639047	1333.636139	K	L	761	773
PSM	APQVSTPTLVEAAR	202	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.2603.19	37.64557	2	1438.782047	1438.777993	K	N	439	453
PSM	DTCFSTEGPNLVTR	203	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31	3-UNIMOD:4	ms_run[1]:scan=1.1.2772.21	42.35282	2	1595.733047	1595.724971	K	C	589	603
PSM	QDLPNAMNAAEITDK	204	sp|P61205|ARF3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.2765.21	42.15748	2	1629.772247	1629.766836	K	L	128	143
PSM	VPNSGKEEIEAAVEAAR	205	sp|Q8BH00|AL8A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.2611.16	37.86412	3	1768.898471	1768.895542	K	E	39	56
PSM	AHIMPAEFSSCPLNSDEAVNK	206	sp|Q91V76|CK054_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31	11-UNIMOD:4	ms_run[1]:scan=1.1.2723.18	40.99014	3	2316.059771	2316.051467	K	W	216	237
PSM	ALNDHHVYLEGTLLKPNMVTAGHACTK	207	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31	25-UNIMOD:4	ms_run[1]:scan=1.1.2589.12	37.24827	5	2989.510618	2989.490232	K	K	216	243
PSM	ISVAGVTSGNVGYLAHAIHQVTK	208	sp|P05202|AATM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.3072.4	50.7404	4	2321.259294	2321.249179	R	-	408	431
PSM	LADMALALESAR	209	sp|Q07417|ACADS_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.2982.10	48.25267	2	1259.653847	1259.654372	K	L	314	326
PSM	APNSPDVLEIEFK	210	sp|P16460|ASSY_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.3125.12	52.23281	2	1457.747647	1457.740210	K	K	216	229
PSM	VLGPLIGVQVPQEK	211	sp|Q61133|GSTT2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.3093.16	51.34862	2	1475.874447	1475.871165	K	V	118	132
PSM	LGEYGFQNAILVR	212	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.3167.15	53.42562	2	1478.796247	1478.788164	K	Y	422	435
PSM	GSQGGLSQDFVEALK	213	sp|Q7TNG8|LDHD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.3055.12	50.27453	2	1534.769247	1534.762737	R	A	22	37
PSM	ANATEFGLASGVFTR	214	sp|Q8R0Y6|AL1L1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.3135.17	52.51977	2	1539.771847	1539.768157	R	D	827	842
PSM	VPSENVLGEVGDGFK	215	sp|P50544|ACADV_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.3022.7	49.35297	2	1545.773447	1545.767488	K	V	318	333
PSM	TPDFESTGLYSAMPR	216	sp|Q9D964|GATM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.3083.21	51.06622	2	1670.769447	1670.761022	K	D	155	170
PSM	LSQTFPNADFAEITK	217	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.3110.18	51.82268	2	1680.846247	1680.835902	R	L	243	258
PSM	AFQFVETHGEVCPANWTPESPTIKPSPTASK	218	sp|P20108|PRDX3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31	12-UNIMOD:4	ms_run[1]:scan=1.1.2989.11	48.45208	4	3412.664094	3412.639792	K	E	219	250
PSM	KYNLGAPVAGTCYQAEWDDYVPK	219	sp|P70296|PEBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31	12-UNIMOD:4	ms_run[1]:scan=1.1.3165.10	53.37267	3	2644.250771	2644.226789	K	L	157	180
PSM	LISWYDNEYGYSNR	220	tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.3017.10	49.22372	2	1778.798247	1778.790014	K	V	308	322
PSM	HVLSTFGPVPEFSGATVER	221	sp|Q99KP3|CRYL1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.3017.6	49.21537	3	2029.029071	2029.026891	K	V	261	280
PSM	GIVDQSQQAYQEAFEISKK	222	sp|P63101|1433Z_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.3020.10	49.29757	3	2168.087471	2168.074963	K	E	140	159
PSM	GPAVGIDLGTTYSCVGVFQHGK	223	sp|P63017|HSP7C_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31	14-UNIMOD:4	ms_run[1]:scan=1.1.3118.17	52.03953	3	2262.123371	2262.110303	K	V	4	26
PSM	AGGLATTGDKDILDIVPTEIHQK	224	sp|Q9QXD6|F16P1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.3004.18	48.86455	3	2391.278171	2391.264555	K	A	292	315
PSM	DIVLVAYGVLGTQR	225	sp|Q91WR5|AK1CL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.3598.5	65.48525	2	1502.853047	1502.845679	K	Y	210	224
PSM	TLNDELEIIEGMK	226	sp|P63038|CH60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.3439.6	61.02553	2	1503.753247	1503.749061	K	F	206	219
PSM	AIVAGDEVAQEVDAVAPDCSFLK	227	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31	19-UNIMOD:4	ms_run[1]:scan=1.1.3503.13	62.81418	3	2403.182471	2403.162792	R	I	156	179
PSM	KLDILSNDLVINMLK	228	sp|Q9QXD6|F16P1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.3575.4	64.84879	3	1727.996471	1727.985543	K	S	73	88
PSM	LLYECNPIAYVMEK	229	sp|Q9QXD6|F16P1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31	5-UNIMOD:4	ms_run[1]:scan=1.1.3491.20	62.47415	2	1741.857247	1741.841915	R	A	278	292
PSM	AIWNVINWENVTER	230	sp|P09671|SODM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.3605.17	65.6945	2	1742.886847	1742.874019	K	Y	203	217
PSM	ENTLNQLVGAAFGAAGQR	231	sp|Q9EQ20|MMSA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.3551.4	64.16666	3	1815.933671	1815.922760	K	C	299	317
PSM	GHYTEGAELVDSVLDVVR	232	sp|P68372|TBB4B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.3483.4	62.2343	3	1957.990271	1957.974521	K	K	104	122
PSM	IGIASQALGIAQASLDCAVK	233	sp|Q07417|ACADS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31	17-UNIMOD:4	ms_run[1]:scan=1.1.3612.4	65.885	3	1985.076071	1985.061562	R	Y	273	293
PSM	VKPIWPIGMFSGYVDNPK	234	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.3496.8	62.6085	3	2047.071971	2047.060105	R	K	415	433
PSM	AVLDVAETGTEAAAATGVIGGIR	235	sp|P07759|SPA3K_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.3422.10	60.56412	3	2141.142071	2141.132812	K	K	361	384
PSM	KADCTITMADSDLLALMTGK	236	sp|P32020|NLTP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31	4-UNIMOD:4	ms_run[1]:scan=1.1.3603.10	65.63135	3	2154.051371	2154.037063	K	M	492	512
PSM	CTTDHISAAGPWLK	237	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	31	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.3010.21	49.03487	2	1538.7247	1538.7182	K	F	592	606
PSM	SDAAVDTSSEITTK	238	sp|P26350|PTMA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	31	1-UNIMOD:1	ms_run[1]:scan=1.1.2560.19	36.44323	2	1465.6784	1465.6779	M	D	2	16
PSM	QATVGDVNTDRPGLLDLK	239	sp|P31786|ACBP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	31	1-UNIMOD:28	ms_run[1]:scan=1.1.3124.21	52.21193	2	1893.9942	1893.9792	K	G	34	52
PSM	HVGDLGNVTAGK	240	sp|P08228|SODC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.1977.19	20.31865	2	1166.599647	1166.604386	R	D	81	93
PSM	GAVHQLCQSLAGK	241	sp|Q8BVI4|DHPR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30	7-UNIMOD:4	ms_run[1]:scan=1.1.2106.20	23.88378	2	1367.693247	1367.697969	K	N	152	165
PSM	AAIAAAAAAAAAK	242	sp|Q9CR57|RL14_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.2232.11	27.39557	2	1040.595447	1040.597844	K	A	148	161
PSM	AAGCDFNNVVK	243	sp|P52760|RIDA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30	4-UNIMOD:4	ms_run[1]:scan=1.1.2244.19	27.72697	2	1193.548047	1193.549907	K	T	68	79
PSM	SDDIINSSGYR	244	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.2321.18	29.85233	2	1225.557247	1225.557495	R	I	463	474
PSM	VNADEVGGEALGR	245	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.2332.21	30.16412	2	1285.626047	1285.626243	K	L	19	32
PSM	NQVAVVTGGGTGIGK	246	sp|Q99MZ7|PECR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.2293.14	29.07647	2	1356.735447	1356.736128	K	A	18	33
PSM	ADFAQACQDAGVR	247	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30	7-UNIMOD:4	ms_run[1]:scan=1.1.2303.21	29.35583	2	1407.622247	1407.620112	R	F	125	138
PSM	SALEHSVQCAVDVK	248	sp|P24270|CATA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30	9-UNIMOD:4	ms_run[1]:scan=1.1.2336.6	30.26413	3	1541.748971	1541.750792	R	R	417	431
PSM	VIESLGATNLGK	249	sp|Q9DCY0|KEG1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.2493.10	34.5737	2	1200.670047	1200.671403	K	V	113	125
PSM	GILAADESTGSIAK	250	tr|A6ZI47|A6ZI47_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.2446.21	33.30063	2	1331.691847	1331.693260	K	R	29	43
PSM	AGAGSATLSMAYAGAR	251	sp|P08249|MDHM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.2541.20	35.92713	2	1453.700847	1453.698362	K	F	242	258
PSM	ITEIYEGTSEIQR	252	sp|Q07417|ACADS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.2542.17	35.95177	2	1537.773047	1537.762402	R	L	387	400
PSM	LGDVYVNDAFGTAHR	253	sp|P09041|PGK2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.2671.10	39.5173	3	1633.788071	1633.784869	K	A	157	172
PSM	VAFITGGGTGLGK	254	sp|Q9CQ62|DECR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.2656.13	39.11175	2	1176.648447	1176.650273	K	A	61	74
PSM	DFTPAAQAAFQK	255	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.2664.16	39.33178	2	1293.637647	1293.635351	K	V	122	134
PSM	TDFAPQLQSLNK	256	sp|Q8R164|BPHL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.2772.16	42.34863	2	1360.700647	1360.698680	K	K	75	87
PSM	GNPTVEVDLYTAK	257	sp|P17182|ENOA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.2696.16	40.21593	2	1405.710847	1405.708910	R	G	16	29
PSM	YHTSQSGDEMTSLSEYVSR	258	sp|P11499|HS90B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.2710.13	40.61263	3	2175.943571	2175.937877	R	M	457	476
PSM	RHPDYSVSLLLR	259	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.2582.7	37.0501	3	1454.797271	1454.799397	R	L	361	373
PSM	GILAADESVGTMGNR	260	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.2640.19	38.66522	2	1489.725447	1489.719492	K	L	29	44
PSM	NHYQAEVFSVNFAESEEAKK	261	sp|P07758|A1AT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.2644.18	38.7777	3	2326.096871	2326.086590	K	V	154	174
PSM	MLLEYTDSSYDEK	262	sp|P10649|GSTM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.2781.19	42.6034	2	1592.696447	1592.691605	R	R	19	32
PSM	ESAAIYFTSGTSGPPK	263	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.2677.21	39.69517	2	1611.781847	1611.778053	R	M	214	230
PSM	APAAIGPYSQAVQVDR	264	sp|P52760|RIDA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.2676.19	39.6649	2	1641.851047	1641.847470	K	T	14	30
PSM	VAPEEHPVLLTEAPLNPK	265	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.2755.17	41.87458	3	1953.075671	1953.057128	R	A	96	114
PSM	FFQEEVIPHHTEWEK	266	sp|P51174|ACADL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.2614.4	37.94128	3	1954.931471	1954.921363	K	A	67	82
PSM	TSRPENAIIYSNNEDFQVGQAK	267	sp|P40142|TKT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.2634.21	38.4986	3	2480.214371	2480.193181	R	V	472	494
PSM	FPVGAALLTGDGR	268	sp|P56389|CDD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.3060.10	50.40434	2	1272.682247	1272.682636	R	I	36	49
PSM	LGQLNIDISNIK	269	sp|Q64516|GLPK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.3072.8	50.74373	2	1326.752647	1326.750716	K	A	75	87
PSM	LAGQIFLGGSIVR	270	sp|P17563|SBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.3135.12	52.51558	2	1329.779847	1329.776871	R	G	345	358
PSM	LNCQVIGASVDSHFCHLAWINTPK	271	sp|P35700|PRDX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30	3-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=1.1.3129.16	52.34988	4	2766.363694	2766.337026	K	K	69	93
PSM	LGGVEFNIDLPNK	272	sp|O08997|ATOX1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.3188.10	54.00548	2	1414.756847	1414.745630	K	K	26	39
PSM	VNLLSFTGSTQVGK	273	sp|Q9DBF1|AL7A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.3073.15	50.77808	2	1449.785847	1449.782744	R	E	267	281
PSM	FLTEELSLDQDR	274	sp|O35215|DOPD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.3023.9	49.37825	2	1464.713447	1464.709639	K	I	84	96
PSM	LYATTSLYSAWDK	275	sp|P17563|SBP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.3058.7	50.3507	2	1517.754647	1517.740210	R	Q	399	412
PSM	VQIAVANAQELLQR	276	sp|P62075|TIM13_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.3058.8	50.35237	2	1551.874447	1551.873290	K	M	28	42
PSM	TSLSPGSGVVTYYLR	277	sp|P28271|ACOC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.3086.20	51.15202	2	1598.837047	1598.830422	K	E	469	484
PSM	AVLVDLEPGTMDSVR	278	sp|P68372|TBB4B_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.3112.9	51.8726	2	1600.817447	1600.813058	R	S	63	78
PSM	SAVYPTSAVQMEAALR	279	sp|Q9D6Y7|MSRA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.3012.8	49.08945	2	1692.856847	1692.850506	R	S	157	173
PSM	ETTDTDTADQVIASFK	280	sp|P57780|ACTN4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.3097.17	51.46202	2	1740.817647	1740.805390	R	V	839	855
PSM	VITAFNDGLNHLDSLK	281	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.2991.5	48.49253	3	1755.927671	1755.915549	K	G	68	84
PSM	VSHALAEGLGVIACIGEK	282	sp|P17751|TPIS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30	14-UNIMOD:4	ms_run[1]:scan=1.1.3129.6	52.34153	3	1822.973171	1822.961119	K	L	164	182
PSM	NPAIIFEDANLEECIPATVR	283	sp|Q8BH00|AL8A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30	14-UNIMOD:4	ms_run[1]:scan=1.1.3540.15	63.85802	3	2271.140471	2271.120533	K	S	258	278
PSM	GSFVLLDGETFEVK	284	sp|P17563|SBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.3418.12	60.45189	2	1539.790047	1539.782075	K	G	161	175
PSM	TCGFDFSGALEDISK	285	sp|P05202|AATM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30	2-UNIMOD:4	ms_run[1]:scan=1.1.3468.16	61.8253	2	1645.740247	1645.729388	K	I	186	201
PSM	EILVGDVGATITDPFK	286	sp|Q9R0P5|DEST_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.3532.16	63.62895	2	1673.898647	1673.887603	K	H	54	70
PSM	IVPLQGAQMLQMLEK	287	sp|Q91XE0|GLYAT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	30		ms_run[1]:scan=1.1.3582.9	65.04787	2	1697.9273	1697.9203	M	S	2	17
PSM	AVFVDLEPTVIDEVR	288	sp|P05213|TBA1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.3487.14	62.35552	2	1700.910047	1700.898502	R	T	65	80
PSM	IITLEEGDLILTGTPK	289	sp|Q8R0F8|FAHD1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.3418.20	60.45857	2	1711.971047	1711.960768	K	G	182	198
PSM	LLYECNPIAYVMEK	290	sp|Q9QXD6|F16P1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30	5-UNIMOD:4	ms_run[1]:scan=1.1.3485.18	62.30252	2	1741.857247	1741.841915	R	A	278	292
PSM	GHYTEGAELVDSVLDVVR	291	sp|P68372|TBB4B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.3489.7	62.4063	3	1957.990271	1957.974521	K	K	104	122
PSM	VKPIWPIGMFSGYVDNPK	292	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.3484.10	62.26757	3	2047.071971	2047.060105	R	K	415	433
PSM	FLPGAHVFPGGVLDAADSSPDWVR	293	sp|P11930|NUD19_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.3459.14	61.5787	3	2509.257971	2509.239009	R	L	40	64
PSM	HIADLAGNPEVILPVPAFNVINGGSHAGNK	294	sp|P17182|ENOA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.3415.12	60.36514	4	3020.608494	3020.583204	R	L	133	163
PSM	VNQIGSVTESIQACK	295	sp|P21550|ENOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30	14-UNIMOD:4	ms_run[1]:scan=1.1.2619.17	38.0835	2	1632.819247	1632.814121	K	L	344	359
PSM	TASSVLLHTGQK	296	sp|Q9JII6|AK1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	30	1-UNIMOD:1	ms_run[1]:scan=1.1.2503.16	34.85395	2	1282.6859	1282.6876	M	M	2	14
PSM	TASSVLLHTGQK	297	sp|Q9JII6|AK1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	30	1-UNIMOD:1	ms_run[1]:scan=1.1.2490.16	34.49517	2	1282.6859	1282.6876	M	M	2	14
PSM	THINIVVIGHVDSGK	298	sp|P10126|EF1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.2403.14	32.1061	3	1587.876971	1587.873290	K	S	6	21
PSM	LGGSAVISLEGKPL	299	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.2984.11	48.30907	2	1339.768047	1339.771117	K	-	153	167
PSM	QATVGDVNTDRPGLLDLK	300	sp|P31786|ACBP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	30	1-UNIMOD:28	ms_run[1]:scan=1.1.3130.21	52.38245	2	1893.9942	1893.9792	K	G	34	52
PSM	AEMDAAVESCK	301	sp|Q9EQ20|MMSA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29	10-UNIMOD:4	ms_run[1]:scan=1.1.2015.19	21.37947	2	1209.496847	1209.500574	K	R	77	88
PSM	YMCENQATISSK	302	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29	3-UNIMOD:4	ms_run[1]:scan=1.1.2056.21	22.50502	2	1430.616847	1430.617001	K	L	287	299
PSM	VVAGVAAALAHK	303	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.2229.6	27.3099	3	1105.655771	1105.660778	K	Y	134	146
PSM	NPADGACLLEK	304	sp|Q91V76|CK054_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29	7-UNIMOD:4	ms_run[1]:scan=1.1.2356.15	30.81505	2	1186.560047	1186.565223	K	Y	134	145
PSM	VPAANVLSQESK	305	sp|Q9JHI5|IVD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.2237.18	27.53593	2	1241.655647	1241.661566	K	G	261	273
PSM	DLGLAQDSATSTK	306	sp|Q99L13|3HIDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.2308.18	29.4945	2	1305.637247	1305.641225	K	T	284	297
PSM	NQVAVVTGGGTGIGK	307	sp|Q99MZ7|PECR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.2286.8	28.88538	2	1356.735447	1356.736128	K	A	18	33
PSM	AAAEVNQEYGLDPK	308	sp|P97807|FUMH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.2363.20	31.00803	2	1503.722847	1503.720538	R	I	99	113
PSM	TEQGPQVDETQFK	309	sp|P47738|ALDH2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.2291.16	29.02072	2	1505.700047	1505.699802	R	K	358	371
PSM	IGGHGAEYGAEALER	310	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.2199.14	26.49542	3	1528.729271	1528.727020	K	M	18	33
PSM	TYFPHFDVSHGSAQVK	311	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.2543.6	35.96965	4	1818.868894	1818.868933	K	G	42	58
PSM	AGDLGVDLTSK	312	sp|Q9DCW4|ETFB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.2468.6	33.88272	2	1074.550447	1074.555704	K	V	211	222
PSM	ELISNASDALDK	313	sp|P08113|ENPL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.2520.16	35.33487	2	1274.631847	1274.635411	R	I	103	115
PSM	LGGTCVNVGCVPK	314	sp|P47791|GSHR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29	5-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.2409.20	32.27765	2	1359.662647	1359.663892	K	K	76	89
PSM	GTFASLSELHCDK	315	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29	11-UNIMOD:4	ms_run[1]:scan=1.1.2459.15	33.6521	2	1463.673247	1463.671479	K	L	84	97
PSM	LCAATATILDKPEDR	316	sp|O35215|DOPD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29	2-UNIMOD:4	ms_run[1]:scan=1.1.2431.8	32.8777	3	1672.844471	1672.845421	R	V	23	38
PSM	TLADAEGDVFR	317	sp|Q9EQ20|MMSA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.2689.4	40.01765	2	1192.573647	1192.572417	K	G	130	141
PSM	ENVLIGEGAGFK	318	sp|P45952|ACADM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.2718.17	40.84597	2	1232.641047	1232.640102	K	I	260	272
PSM	GTPLDTEVPLER	319	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.2738.19	41.40662	2	1325.682647	1325.682696	K	V	819	831
PSM	VVGAMQLYSVDR	320	sp|Q68FD5|CLH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.2771.17	42.3213	2	1336.681047	1336.680921	R	K	177	189
PSM	VGVPTETGALTLNR	321	sp|Q8BWT1|THIM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.2739.19	41.4349	2	1426.780247	1426.777993	R	L	77	91
PSM	THLPGFVEQAGALK	322	sp|P99029|PRDX5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.2647.7	38.85355	3	1466.787371	1466.788164	K	A	99	113
PSM	HVTIVVGTSGDTGSAAIESVQGSK	323	sp|Q80W22|THNS2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.2632.20	38.44195	3	2299.176071	2299.165569	K	N	134	158
PSM	EIYGQTETGLICR	324	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29	12-UNIMOD:4	ms_run[1]:scan=1.1.2661.9	39.25265	2	1538.740847	1538.739893	R	V	360	373
PSM	ETVSEESNVLCLSK	325	sp|P58252|EF2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29	11-UNIMOD:4	ms_run[1]:scan=1.1.2687.18	39.97542	2	1593.759447	1593.755603	R	S	581	595
PSM	ESAAIYFTSGTSGPPK	326	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.2690.18	40.05625	2	1611.781847	1611.778053	R	M	214	230
PSM	HWPFMVVNDAGRPK	327	sp|P63017|HSP7C_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.2627.13	38.29628	3	1652.822471	1652.824566	K	V	89	103
PSM	VSHVSTGGGASLELLEGK	328	sp|P09041|PGK2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.2586.15	37.16708	3	1739.906471	1739.905378	K	I	389	407
PSM	VGLIGSCTNSSYEDMGR	329	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29	7-UNIMOD:4	ms_run[1]:scan=1.1.2743.21	41.54945	2	1844.811647	1844.803298	R	S	379	396
PSM	VASSVPVENFTIHGGLSR	330	sp|Q60597|ODO1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.2761.17	42.04213	3	1868.976071	1868.974461	K	I	620	638
PSM	QATVGDVNTDRPGLLDLK	331	sp|P31786|ACBP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.2764.12	42.12198	3	1911.018371	1911.006155	K	G	34	52
PSM	DAGTIAGLNVLR	332	sp|P63017|HSP7C_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.3090.6	51.255	2	1198.669447	1198.666986	K	I	160	172
PSM	TDIANLAEEFK	333	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.3129.7	52.34237	2	1249.620447	1249.619033	R	D	313	324
PSM	MVLVLQQLEDK	334	sp|Q61133|GSTT2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.3162.4	53.28265	2	1314.725247	1314.721724	R	F	139	150
PSM	DPSGGPVSLDFVK	335	sp|Q99LB7|SARDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.3092.13	51.31763	2	1316.662247	1316.661232	R	N	873	886
PSM	DQSPASHEIATNLGDFALR	336	sp|Q00897|A1AT4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.3111.10	51.84303	3	2041.005371	2040.986482	K	L	36	55
PSM	ATSLNSNDVFILK	337	sp|Q62468|VILI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.3002.13	48.8034	2	1420.757647	1420.756195	R	T	537	550
PSM	LGEYGFQNAILVR	338	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.3154.18	53.06688	2	1478.796247	1478.788164	K	Y	422	435
PSM	ELGEYGLQAYTEVK	339	sp|P47738|ALDH2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.2984.18	48.31492	2	1598.787247	1598.782804	R	T	495	509
PSM	IHFPLATYAPVISAEK	340	sp|P05213|TBA1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.3129.5	52.3407	3	1755.961871	1755.955957	R	A	265	281
PSM	GLVYETSVLDPDEGIR	341	tr|Q80X68|Q80X68_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.3155.20	53.09768	2	1761.891047	1761.878495	K	F	77	93
PSM	LISWYDNEYGYSNR	342	tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.3021.4	49.32689	3	1778.790971	1778.790014	K	V	308	322
PSM	GLLSQGSPLSWEETQR	343	sp|P97494|GSH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	29		ms_run[1]:scan=1.1.3126.18	52.26625	2	1786.8910	1786.8845	M	H	2	18
PSM	HSMNPFCEIAVEEAVR	344	sp|Q9DCW4|ETFB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29	7-UNIMOD:4	ms_run[1]:scan=1.1.3024.9	49.4018	3	1887.863771	1887.860753	K	L	36	52
PSM	YVRPGGGFEPNFTLFEK	345	sp|P11352|GPX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.3134.12	52.48757	3	1956.984971	1956.973398	K	C	96	113
PSM	LCNPPVNAISPTVITEVR	346	sp|Q9DBM2|ECHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29	2-UNIMOD:4	ms_run[1]:scan=1.1.3161.21	53.26723	2	1979.066447	1979.050997	R	N	16	34
PSM	FTASAGIQVVGDDLTVTNPK	347	sp|P17182|ENOA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.3159.12	53.20515	3	2032.060571	2032.047686	K	R	307	327
PSM	TGQATVASGIPAGWMGLDCGTESSKK	348	sp|P09411|PGK1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29	19-UNIMOD:4	ms_run[1]:scan=1.1.3007.19	48.9495	3	2608.244171	2608.226137	K	Y	298	324
PSM	GLETIASDVVSLASK	349	sp|Q8BMF4|ODP2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.3605.13	65.69117	2	1488.810847	1488.803539	K	A	528	543
PSM	DFTATFGPLDSLNTR	350	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.3527.16	63.48485	2	1653.812447	1653.799851	K	L	1022	1037
PSM	ALPFWNEEIVPQIK	351	sp|Q9DBJ1|PGAM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.3622.12	66.1813	2	1682.915447	1682.903193	R	E	163	177
PSM	GGLPSQAFEYILYNK	352	sp|P49935|CATH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.3520.17	63.28427	2	1698.875047	1698.861723	K	G	181	196
PSM	AASDLQIAASTFTSFGK	353	sp|Q9DC50|OCTC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.3418.21	60.4594	2	1713.863447	1713.857366	K	K	390	407
PSM	TLASLSPETSLFIIASK	354	sp|P06745|G6PI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.3622.17	66.18549	2	1777.001247	1776.987317	K	T	195	212
PSM	FAELVYTGFWHSPECEFVR	355	sp|P16460|ASSY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29	15-UNIMOD:4	ms_run[1]:scan=1.1.3469.12	61.84938	3	2373.104171	2373.088839	K	H	317	336
PSM	HIADLAGNPEVILPVPAFNVINGGSHAGNK	356	sp|P17182|ENOA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.3409.14	60.19238	4	3020.608494	3020.583204	R	L	133	163
PSM	AGVDQHEGTIK	357	tr|E9QN99|E9QN99_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	29	1-UNIMOD:1	ms_run[1]:scan=1.1.1998.21	20.90228	2	1195.5787	1195.5828	M	V	2	13
PSM	IQIWDTAGQER	358	sp|Q8K386|RAB15_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.2693.11	40.13092	2	1315.651647	1315.652064	R	Y	59	70
PSM	SNVNDGVAQSTR	359	sp|P17751|TPIS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.1769.21	14.51725	2	1246.587447	1246.590192	K	I	245	257
PSM	HQGVMVGMGQK	360	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.1883.17	17.7053	2	1170.561647	1170.563783	R	D	40	51
PSM	RSAGVDDQENWHEGK	361	sp|Q9CPY7|AMPL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.1824.19	16.05852	3	1726.761371	1726.765925	K	E	104	119
PSM	HFVALSTNTAK	362	sp|P06745|G6PI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.1999.20	20.92972	2	1187.627247	1187.629872	K	V	242	253
PSM	KQTALAELVK	363	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.2192.20	26.3038	2	1099.658047	1099.660110	K	H	549	559
PSM	VTVAGLAGKDPVQCSR	364	sp|Q99LX0|PARK7_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28	14-UNIMOD:4	ms_run[1]:scan=1.1.2361.9	30.9477	3	1656.858671	1656.861740	K	D	33	49
PSM	VVAGVAAALAHK	365	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.2240.3	27.60455	3	1105.655771	1105.660778	K	Y	134	146
PSM	IIYGGSVTGATCK	366	sp|P17751|TPIS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28	12-UNIMOD:4	ms_run[1]:scan=1.1.2289.15	28.96695	2	1325.664447	1325.664937	R	E	257	270
PSM	ALGQNPTNAEVLK	367	sp|Q60605|MYL6_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.2328.20	30.05037	2	1353.726847	1353.725229	R	V	38	51
PSM	ENYGELADCCTK	368	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28	9-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.2265.20	28.3064	2	1458.576047	1458.575530	R	Q	106	118
PSM	AAAEVNQEYGLDPK	369	sp|P97807|FUMH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.2370.21	31.19772	2	1503.722847	1503.720538	R	I	99	113
PSM	VMLGETNPADSKPGTIR	370	sp|P15532|NDKA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.2326.15	29.99003	3	1784.913371	1784.909084	R	G	89	106
PSM	ASQRPDVLTTGGGNPIGDK	371	sp|P24270|CATA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.2316.15	29.70997	3	1881.956771	1881.954454	R	L	20	39
PSM	EITALAPSTMK	372	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.2498.12	34.71273	2	1160.607847	1160.611110	K	I	316	327
PSM	VPAINVNDSVTK	373	sp|P50247|SAHH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.2408.17	32.2477	2	1255.674047	1255.677216	K	S	175	187
PSM	VLQATVVAVGSGGK	374	sp|Q64433|CH10_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.2429.19	32.83287	2	1284.739647	1284.740151	K	G	41	55
PSM	AADKDTCFSTEGPNLVTR	375	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28	7-UNIMOD:4	ms_run[1]:scan=1.1.2478.17	34.16342	3	1980.927071	1980.921105	K	C	585	603
PSM	ILACDDLDEAAK	376	sp|Q9Z2I9|SUCB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28	4-UNIMOD:4	ms_run[1]:scan=1.1.2481.19	34.24688	2	1332.621447	1332.623132	K	M	427	439
PSM	ADIVENQVMDTR	377	sp|P10649|GSTM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.2482.20	34.27488	2	1389.655047	1389.655829	R	M	97	109
PSM	EVDEQMLNVQNK	378	sp|P68372|TBB4B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.2447.21	33.32822	2	1445.683047	1445.682044	K	N	325	337
PSM	SQIHDIVLVGGSTR	379	sp|P63017|HSP7C_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.2452.7	33.45743	3	1480.797071	1480.799791	K	I	329	343
PSM	GILAADESVGTMGNR	380	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28	12-UNIMOD:35	ms_run[1]:scan=1.1.2400.21	32.02923	2	1505.712447	1505.714407	K	L	29	44
PSM	LIASVADDEAAVPNNK	381	sp|P16125|LDHB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.2527.21	35.53647	2	1625.827247	1625.826065	K	I	8	24
PSM	YISGFGNECASEDPR	382	sp|O09173|HGD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28	9-UNIMOD:4	ms_run[1]:scan=1.1.2470.12	33.9482	2	1700.723047	1700.710050	K	C	6	21
PSM	HLEINPDHSIIETLR	383	sp|P07901|HS90A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.2741.13	41.48648	3	1785.942671	1785.937347	K	Q	634	649
PSM	IYVVDVGSEPR	384	sp|P17563|SBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.2613.16	37.91925	2	1232.639447	1232.640102	R	A	104	115
PSM	VQQTVQDLFGR	385	sp|P38647|GRP75_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.2778.12	42.51299	2	1289.673647	1289.672800	K	A	395	406
PSM	RFSMVIDNGIVK	386	sp|P99029|PRDX5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.2697.5	40.23455	3	1377.741371	1377.743856	K	A	176	188
PSM	APQVSTPTLVEAAR	387	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.2590.21	37.28393	2	1438.782047	1438.777993	K	N	439	453
PSM	MVDDGSGEVQVWR	388	sp|Q62468|VILI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.2705.19	40.47468	2	1476.668847	1476.666728	K	I	392	405
PSM	LEGTNVQEAQNILK	389	sp|Q9Z2I8|SUCB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.2687.17	39.97375	2	1555.823647	1555.820586	R	S	394	408
PSM	AIANECQANFISIK	390	sp|Q01853|TERA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28	6-UNIMOD:4	ms_run[1]:scan=1.1.2773.20	42.3803	2	1577.789847	1577.787178	K	G	530	544
PSM	IYQIYEGTAQIQR	391	sp|P45952|ACADM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.2691.20	40.08249	2	1581.816447	1581.815107	K	L	396	409
PSM	HLEINPDHPIVETLR	392	sp|P11499|HS90B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.2603.17	37.6439	3	1781.942171	1781.942433	K	Q	625	640
PSM	AIESQCYVIAAAQCGR	393	sp|Q8VDK1|NIT1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28	6-UNIMOD:4,14-UNIMOD:4	ms_run[1]:scan=1.1.2704.21	40.44767	2	1795.843647	1795.834539	R	H	242	258
PSM	EIIAVSCGPSQCQETIR	394	sp|Q9DCW4|ETFB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28	7-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.2631.18	38.41222	3	1946.924471	1946.918997	K	T	60	77
PSM	VADIGLAAWGR	395	sp|P50247|SAHH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.2989.4	48.4404	2	1127.606247	1127.608743	K	K	9	20
PSM	SPGASLLPVLTK	396	sp|Q8VC30|TKFC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.3003.7	48.82701	2	1181.700247	1181.701974	K	A	511	523
PSM	TDIANLAEEFK	397	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.3123.11	52.17533	2	1249.620447	1249.619033	R	D	313	324
PSM	LQYAVISEAWR	398	sp|Q99KP3|CRYL1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.3069.13	50.6618	2	1334.703247	1334.698286	R	L	198	209
PSM	FVEGLPINDFSR	399	sp|P14152|MDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.3168.13	53.4515	2	1392.708847	1392.703765	K	E	299	311
PSM	LDNNTELSFFAK	400	sp|O88844|IDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.3067.13	50.60417	2	1397.686447	1397.682696	K	A	346	358
PSM	FLTEELSLDQDR	401	sp|O35215|DOPD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.3016.5	49.19024	2	1464.713447	1464.709639	K	I	84	96
PSM	AVLDVAETGTEAAAATGVIGGIRK	402	sp|P07759|SPA3K_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.3148.13	52.88892	3	2269.235471	2269.227775	K	A	361	385
PSM	AFDNDVDALCNLR	403	sp|Q99MN9|PCCB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28	10-UNIMOD:4	ms_run[1]:scan=1.1.3018.7	49.24805	2	1521.696047	1521.688192	R	E	262	275
PSM	GQFSTDELVAEVEK	404	sp|Q68FD5|CLH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.3084.15	51.09013	2	1550.751247	1550.746418	R	R	838	852
PSM	VTLMEEGFNPTVIK	405	sp|O35488|S27A2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.3174.18	53.62198	2	1576.821047	1576.817081	K	D	576	590
PSM	TIQNLASIQSFQIK	406	sp|Q91XE0|GLYAT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.3149.16	52.92023	2	1589.884447	1589.877707	K	H	114	128
PSM	IIPGFMCQGGDFTR	407	sp|P17742|PPIA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28	7-UNIMOD:4	ms_run[1]:scan=1.1.3098.18	51.49038	2	1597.745447	1597.738119	R	H	56	70
PSM	TVFVCDEDATLELK	408	sp|O88958|GNPI1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28	5-UNIMOD:4	ms_run[1]:scan=1.1.3025.9	49.43616	2	1638.782647	1638.781089	R	V	235	249
PSM	HNQLPLVIEFTEQTAPK	409	sp|P09103|PDIA1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.3166.5	53.38988	3	1964.043671	1964.036727	K	I	233	250
PSM	VDLFYLHAPDHSTPVEETLR	410	sp|Q8CG76|ARK72_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.3039.18	49.82267	3	2338.172471	2338.159361	R	A	143	163
PSM	TPALIVYGDQDPMGSSSFQHLK	411	sp|Q8VCR7|ABHEB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.3083.18	51.06372	3	2390.169671	2390.157647	K	Q	152	174
PSM	LLSHCLLVTLASHHPADFTPAVHASLDK	412	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28	5-UNIMOD:4	ms_run[1]:scan=1.1.3030.5	49.56062	5	3049.608618	3049.580761	K	F	101	129
PSM	FVFSLVDAMNGK	413	sp|P08249|MDHM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.3460.4	61.5999	2	1326.667247	1326.664209	R	E	258	270
PSM	VVGVPVALDLITSGR	414	sp|Q9DBM2|ECHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.3565.8	64.57038	2	1494.885447	1494.876979	R	H	140	155
PSM	DIVLVAYGVLGTQR	415	sp|Q91WR5|AK1CL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.3604.9	65.65913	2	1502.853047	1502.845679	K	Y	210	224
PSM	VVLAYEPVWAIGTGK	416	sp|P17751|TPIS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.3429.8	60.75858	2	1601.891047	1601.881730	K	T	211	226
PSM	DLADELALVDVMEDK	417	sp|P06151|LDHA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28	12-UNIMOD:35	ms_run[1]:scan=1.1.3600.15	65.55415	2	1690.808647	1690.797133	K	L	43	58
PSM	VKPIWPIGMFSGYVDNPK	418	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.3490.9	62.43642	3	2047.071971	2047.060105	R	K	415	433
PSM	HEIIQTLQMTDGLIPLEIR	419	sp|P17563|SBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.3597.12	65.46208	3	2219.215571	2219.198389	R	F	236	255
PSM	APVVMGSSEDVQEFLEIYRK	420	sp|Q9QXD6|F16P1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.3416.14	60.39585	3	2296.158971	2296.140934	K	H	315	335
PSM	NQAGYFMLPTVITDIKDESR	421	sp|Q8BH00|AL8A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.3522.9	63.33518	3	2297.149271	2297.136183	R	C	367	387
PSM	AAATFNPELITHILDGSPENTR	422	sp|Q9R0H0|ACOX1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.3508.6	62.94852	3	2366.209571	2366.186639	R	R	10	32
PSM	INPVCPADLVIDHSIQVDFNR	423	sp|P28271|ACOC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28	5-UNIMOD:4	ms_run[1]:scan=1.1.3429.9	60.76027	3	2421.228671	2421.211080	K	R	114	135
PSM	HIADLAGNPEVILPVPAFNVINGGSHAGNK	424	sp|P17182|ENOA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.3466.11	61.76633	4	3021.600094	3020.583204	R	L	133	163
PSM	AHRFPALTPEQK	425	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:1	ms_run[1]:scan=1.1.2309.9	29.51327	3	1435.7534	1435.7567	M	K	2	14
PSM	AHRFPALTPEQK	426	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:1	ms_run[1]:scan=1.1.2316.5	29.70162	3	1435.7534	1435.7567	M	K	2	14
PSM	RQLLQEEVGPVGVETMR	427	sp|Q7TNG8|LDHD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.2743.12	41.54193	3	1941.030671	1940.014946	K	Q	450	467
PSM	MQLIMLCYNPDFTR	428	tr|F6WHQ7|F6WHQ7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28	7-UNIMOD:4	ms_run[1]:scan=1.1.3510.8	63.00733	2	1800.844047	1800.836119	R	T	50	64
PSM	LFVTNDAATILR	429	sp|P42932|TCPQ_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.3071.12	50.71835	2	1333.740647	1332.740151	K	E	63	75
PSM	SDKPDMAEIEK	430	sp|P20065-2|TYB4-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:1	ms_run[1]:scan=1.1.2326.20	29.9942	2	1303.5932	1303.5961	M	F	2	13
PSM	KHGGPADEER	431	sp|P08228|SODC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.1563.12	8.813334	2	1094.504847	1094.510485	K	H	71	81
PSM	SNVNDGVAQSTR	432	sp|P17751|TPIS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.1763.21	14.34912	2	1246.587447	1246.590192	K	I	245	257
PSM	MAEHSHCSLGIK	433	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27	7-UNIMOD:4	ms_run[1]:scan=1.1.1761.21	14.2932	2	1368.623847	1368.627840	K	A	230	242
PSM	ADGSTQVIDTK	434	sp|O08749|DLDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.1905.16	18.3154	2	1133.552647	1133.556432	K	N	167	178
PSM	HLIPAANTGESK	435	sp|P62259|1433E_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.1876.20	17.51508	2	1236.644047	1236.646250	K	V	107	119
PSM	HHAAYVNNLNATEEK	436	sp|P09671|SODM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.1853.19	16.86998	3	1709.807471	1709.812147	K	Y	54	69
PSM	AGFAGDDAPR	437	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.1976.11	20.28833	2	975.437647	975.441009	K	A	19	29
PSM	HFVALSTNTAK	438	sp|P06745|G6PI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.1993.18	20.759	2	1187.627247	1187.629872	K	V	242	253
PSM	LDQGGAPLAGTNK	439	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2039.19	22.03958	2	1240.639247	1240.641165	K	E	109	122
PSM	GTSFEAAATSGGSASSEK	440	sp|Q99LC5|ETFA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2089.21	23.41795	2	1643.726847	1643.727474	R	A	170	188
PSM	HLFTGPALSK	441	sp|P35505|FAAA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2231.12	27.36945	2	1069.588647	1069.592030	K	H	48	58
PSM	KVYDLNEIAK	442	sp|Q91V76|CK054_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2297.17	29.18293	2	1191.644847	1191.649939	K	V	76	86
PSM	AAGCDFNNVVK	443	sp|P52760|RIDA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27	4-UNIMOD:4	ms_run[1]:scan=1.1.2237.15	27.53343	2	1193.548047	1193.549907	K	T	68	79
PSM	AIQDAGCQVLK	444	sp|P40936|INMT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27	7-UNIMOD:4	ms_run[1]:scan=1.1.2274.17	28.5526	2	1201.608247	1201.612508	K	C	225	236
PSM	SDDIINSSGYR	445	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2327.20	30.02223	2	1225.557247	1225.557495	R	I	463	474
PSM	VNADEVGGEALGR	446	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2366.20	31.08798	2	1285.624647	1285.626243	K	L	19	32
PSM	VNADEVGGEALGR	447	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2352.20	30.70925	2	1285.626047	1285.626243	K	L	19	32
PSM	AAPAAAAAMAPPGPR	448	sp|Q8BMF4|ODP2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2341.16	30.41122	2	1318.679447	1318.681590	K	V	392	407
PSM	INVYYNEATGGK	449	sp|P68372|TBB4B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2353.20	30.73702	2	1327.639647	1327.640831	R	Y	47	59
PSM	LVNADGEAVYCK	450	sp|P24270|CATA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27	11-UNIMOD:4	ms_run[1]:scan=1.1.2219.20	27.04457	2	1337.628247	1337.628552	K	F	222	234
PSM	AHSSMVGVNLPQK	451	sp|P09411|PGK1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2189.10	26.20982	3	1366.697771	1366.702719	R	A	172	185
PSM	GDGPVQGTIHFEQK	452	sp|P08228|SODC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2278.10	28.65825	3	1511.737871	1511.736856	K	A	11	25
PSM	IWHHTFYNELR	453	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2323.14	29.90528	3	1514.740271	1514.741882	K	V	85	96
PSM	EAGEQVASSPAEVAEK	454	sp|Q99L13|3HIDH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2167.21	25.5977	2	1600.760247	1600.758045	K	A	79	95
PSM	SVTNEDVTQEQLGGAK	455	sp|Q99MN9|PCCB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2262.21	28.22443	2	1674.806447	1674.806058	K	T	235	251
PSM	LAQSNGWGVMVSHR	456	sp|P17182|ENOA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2449.10	33.37437	3	1540.758671	1540.756880	K	S	359	373
PSM	AAYQVAALPR	457	sp|P52760|RIDA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2453.9	33.48093	2	1058.582447	1058.587279	R	G	108	118
PSM	DEADADLINAGK	458	sp|Q9D0K2|SCOT1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2456.16	33.56727	2	1230.572647	1230.572811	K	E	357	369
PSM	ASAYVFASPGCK	459	sp|Q9Z0S1|BPNT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27	11-UNIMOD:4	ms_run[1]:scan=1.1.2416.15	32.47009	2	1256.577047	1256.585959	K	K	233	245
PSM	VEVLDNTQQLK	460	sp|P16331|PH4H_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2394.20	31.86432	2	1285.683647	1285.687781	R	I	421	432
PSM	VSVISVEEPPQR	461	sp|Q9DCW4|ETFB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2516.19	35.22317	2	1338.711847	1338.714330	K	S	222	234
PSM	VAPLGAELQESAR	462	sp|Q00623|APOA1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2540.20	35.89908	2	1339.708047	1339.709579	K	Q	142	155
PSM	VSVISVEEPPQR	463	sp|Q9DCW4|ETFB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2522.20	35.39454	2	1338.711847	1338.714330	K	S	222	234
PSM	VISLSGEHSIIGR	464	sp|P08228|SODC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2531.7	35.63757	3	1366.752671	1366.756864	R	T	104	117
PSM	VSPDGEEGYPGELK	465	sp|Q8K157|GALM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2396.19	31.91817	2	1475.680447	1475.678004	R	V	132	146
PSM	QEQDTYALSSYTR	466	sp|Q8QZT1|THIL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2518.21	35.28197	2	1560.706447	1560.705616	R	S	206	219
PSM	GVPGAIVNVSSQASQR	467	sp|Q91X52|DCXR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2525.20	35.47861	2	1568.830247	1568.827068	R	A	126	142
PSM	HSENILYVSSETIK	468	sp|Q91XE0|GLYAT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2558.21	36.38915	2	1618.826447	1618.820252	K	K	128	142
PSM	VGVVDEVVPEDQVHSK	469	sp|P42125|ECI1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2484.12	34.3233	3	1734.880571	1734.878829	K	A	207	223
PSM	MISSYVGENAEFER	470	sp|Q9D0K2|SCOT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27	1-UNIMOD:35	ms_run[1]:scan=1.1.2616.10	38.00438	2	1646.721447	1646.724637	R	Q	111	125
PSM	LLADPTGAFGK	471	sp|P99029|PRDX5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2730.10	41.1798	2	1088.584847	1088.586610	R	A	145	156
PSM	SADTLWGIQK	472	sp|P06151|LDHA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2694.8	40.15396	2	1117.574647	1117.576774	K	E	319	329
PSM	LDIDSAPITAR	473	sp|P52480|KPYM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2659.5	39.19768	2	1170.623047	1170.624452	R	N	33	44
PSM	AEAGDNLGALVR	474	sp|Q8BFR5|EFTU_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2581.13	37.02758	2	1184.614047	1184.614950	R	G	316	328
PSM	KYTPEQVAMATVTALHR	475	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27	9-UNIMOD:35	ms_run[1]:scan=1.1.2699.15	40.2993	3	1931.002871	1930.993482	K	T	243	260
PSM	YYVTIIDAPGHR	476	sp|P10126|EF1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2593.4	37.35552	3	1403.716571	1403.719750	K	D	85	97
PSM	TINEVENQILTR	477	sp|P57780|ACTN4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2755.21	41.87793	2	1428.755047	1428.757257	R	D	747	759
PSM	RHPDYSVSLLLR	478	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2589.8	37.24493	3	1454.797271	1454.799397	R	L	361	373
PSM	TTPSYVAFTDTER	479	sp|P16627|HS71L_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2658.19	39.1724	2	1486.694247	1486.693989	R	L	39	52
PSM	GILAADESVGTMGNR	480	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2628.17	38.32748	2	1489.725447	1489.719492	K	L	29	44
PSM	ASAELALGENNEVLK	481	sp|P05202|AATM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2734.20	41.29692	2	1556.810247	1556.804602	K	S	108	123
PSM	ASAELALGENNEVLK	482	sp|P05202|AATM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2727.20	41.10633	2	1556.810247	1556.804602	K	S	108	123
PSM	AIANECQANFISIK	483	sp|Q01853|TERA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27	6-UNIMOD:4	ms_run[1]:scan=1.1.2779.20	42.5476	2	1577.789847	1577.787178	K	G	530	544
PSM	APNSPDVLEIEFKK	484	sp|P16460|ASSY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2768.8	42.2303	3	1585.840271	1585.835174	K	G	216	230
PSM	IEDLSQQAQLAAAEK	485	sp|P70670|NACAM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2605.18	37.6996	2	1613.830047	1613.826065	K	F	2100	2115
PSM	VIVVGNPANTNCLTASK	486	sp|P14152|MDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27	12-UNIMOD:4	ms_run[1]:scan=1.1.2627.15	38.29795	3	1756.915571	1756.914169	K	S	126	143
PSM	VPNSGKEEIEAAVEAAR	487	sp|Q8BH00|AL8A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2604.16	37.67055	3	1768.898471	1768.895542	K	E	39	56
PSM	FAREEIIPVAPEYDK	488	sp|P45952|ACADM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2753.12	41.81583	3	1775.910371	1775.909401	K	S	55	70
PSM	HLEINPDHSIIETLR	489	sp|P07901|HS90A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2741.12	41.48563	3	1785.942671	1785.937347	K	Q	634	649
PSM	RQLLQEEVGPVGVETMR	490	sp|Q7TNG8|LDHD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2737.16	41.37613	3	1940.021471	1940.014946	K	Q	450	467
PSM	ALQHIICQLGGTVCDGEK	491	sp|Q9D826|SOX_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27	7-UNIMOD:4,14-UNIMOD:4	ms_run[1]:scan=1.1.2773.17	42.3778	3	1997.977571	1997.966281	R	V	157	175
PSM	IREDLPNLESSEETEQINK	492	sp|Q9EQH3|VPS35_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2623.15	38.18967	3	2243.106371	2243.091735	K	H	750	769
PSM	LIDDMVAQAMK	493	sp|O88844|IDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2987.3	48.38488	2	1233.610247	1233.609730	R	S	250	261
PSM	AGAPPGLFNVVQGGAATGQFLCHHR	494	sp|Q9JLJ2|AL9A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27	22-UNIMOD:4	ms_run[1]:scan=1.1.3081.11	51.0006	4	2561.284494	2561.270995	K	E	199	224
PSM	TLTIVDTGIGMTK	495	sp|P07901|HS90A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3002.11	48.80173	2	1348.728447	1348.727203	R	A	88	101
PSM	FESTSILQTLSK	496	sp|Q3UNX5|ACSM3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3049.14	50.10605	2	1352.718247	1352.718747	R	F	300	312
PSM	FASEITPITISVK	497	sp|Q8QZT1|THIL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3088.14	51.20473	2	1404.791047	1404.786432	K	G	228	241
PSM	DDGSWEVIEGYR	498	sp|P26443|DHE3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3166.12	53.39573	2	1424.624447	1424.620824	R	A	125	137
PSM	DIELVMSQANVSR	499	sp|P70670|NACAM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2988.5	48.41353	2	1460.731047	1460.729328	K	A	2152	2165
PSM	ITQLTPFIGYAGGK	500	sp|O35488|S27A2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3105.15	51.68133	2	1464.803647	1464.797666	K	T	429	443
PSM	GVVNILPGSGSLVGQR	501	sp|Q8R0Y6|AL1L1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3078.17	50.92062	2	1551.877847	1551.873290	K	L	621	637
PSM	LQLGPETLLQDNPK	502	sp|O09174|AMACR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3101.13	51.56888	2	1564.850047	1564.846073	K	L	87	101
PSM	LGVLGFFSTGDQHAR	503	tr|Q6PDB7|Q6PDB7_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3085.5	51.11063	3	1603.810571	1603.810690	R	G	176	191
PSM	VDAILCVAGGWAGGNAK	504	sp|Q8BVI4|DHPR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27	6-UNIMOD:4	ms_run[1]:scan=1.1.3189.15	54.03715	2	1657.834847	1657.824626	K	S	77	94
PSM	IINEPTAAAIAYGLDK	505	sp|P16627|HS71L_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3112.10	51.87427	2	1658.896647	1658.887937	R	G	174	190
PSM	TQEFILNSPTVTSIK	506	sp|Q9R0H0|ACOX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3029.15	49.54342	2	1676.901247	1676.898502	K	W	160	175
PSM	LLGNMIVIVLGHHLGK	507	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27	5-UNIMOD:35	ms_run[1]:scan=1.1.3012.2	49.07443	4	1729.001694	1729.007282	R	D	106	122
PSM	GAGAFGYFEVTHDITR	508	sp|P24270|CATA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2991.4	48.4917	3	1739.825171	1739.826734	K	Y	78	94
PSM	IHFPLATYAPVISAEK	509	sp|P05213|TBA1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3135.5	52.50975	3	1755.961871	1755.955957	R	A	265	281
PSM	IHFPLATYAPVISAEK	510	sp|P05213|TBA1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3147.8	52.85585	3	1755.961871	1755.955957	R	A	265	281
PSM	GLVYETSVLDPDEGIR	511	tr|Q80X68|Q80X68_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3149.19	52.92275	2	1761.891047	1761.878495	K	F	77	93
PSM	AEEYEFLTPMEEAPK	512	sp|Q99PT1|GDIR1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3171.19	53.53932	2	1782.811847	1782.802218	R	G	153	168
PSM	GSRVEIEAIAVQGPFIK	513	sp|P52760|RIDA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3055.4	50.26368	3	1813.011371	1813.009784	R	A	118	135
PSM	ILATPPQEDAPSVDIANIR	514	sp|P40142|TKT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3110.12	51.81768	3	2019.070871	2019.063670	K	M	284	303
PSM	ISGETIFVTAPHEATAGIIGVNR	515	sp|Q68FD5|CLH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3143.15	52.74673	3	2352.253571	2352.243760	R	K	298	321
PSM	NLQNLLILTAIK	516	sp|Q68FD5|CLH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3599.8	65.51465	2	1352.843047	1352.839137	R	A	1023	1035
PSM	EHGGSIVNIIVLLNNGFPTAAHTGAAR	517	sp|Q99MZ7|PECR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3554.6	64.25452	4	2728.456494	2728.440896	R	E	149	176
PSM	APVVMGSSEDVQEFLEIYRK	518	sp|Q9QXD6|F16P1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3422.12	60.56578	3	2296.158971	2296.140934	K	H	315	335
PSM	DNVINLEVVLPDGR	519	sp|Q7TNG8|LDHD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3518.13	63.22363	2	1551.836047	1551.825671	R	L	185	199
PSM	ALQLGTLFSPAEALK	520	sp|P42125|ECI1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3550.11	64.14407	2	1557.884447	1557.876644	R	V	192	207
PSM	FYAYNPLAGGLLTGK	521	sp|Q8CG76|ARK72_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3433.7	60.86578	2	1583.839647	1583.834780	R	Y	230	245
PSM	DSLLQDGEFTMDLR	522	sp|P62962|PROF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3512.9	63.05888	2	1638.765847	1638.755937	R	T	76	90
PSM	ALPFWNEEIVPQIK	523	sp|Q9DBJ1|PGAM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3616.10	66.00635	2	1682.915447	1682.903193	R	E	163	177
PSM	APFALQVNTLPLNFDK	524	sp|Q61838|PZP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3611.19	65.86877	2	1786.973247	1786.961771	K	A	1358	1374
PSM	VAPAPAGVFTDIPISNIR	525	sp|Q8BMF4|ODP2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3414.20	60.34272	2	1837.019047	1837.009784	R	R	407	425
PSM	AIAELGIYPAVDPLDSTSR	526	sp|P56480|ATPB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3506.2	62.8871	3	1987.029071	1987.026222	R	I	388	407
PSM	GSASSALELTEEELATAEAVR	527	sp|Q8R0Y6|AL1L1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3555.6	64.28336	3	2133.055571	2133.043722	K	S	308	329
PSM	TTVLLADMNDFGTVNEIYK	528	sp|P52760|RIDA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3579.6	64.96294	3	2143.071671	2143.050722	K	T	79	98
PSM	HEIIQTLQMTDGLIPLEIR	529	sp|P17563|SBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3609.14	65.80693	3	2219.215571	2219.198389	R	F	236	255
PSM	ISALQSAGVVVSMSPAQLGTTIYK	530	sp|Q9WUM5|SUCA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3567.13	64.63075	3	2420.317571	2420.298497	K	E	315	339
PSM	QVGYENAGTVEFLVDK	531	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:28	ms_run[1]:scan=1.1.3619.11	66.09373	2	1750.8522	1750.8412	K	H	301	317
PSM	RSEPEPQILDFQTQQYK	532	sp|Q9R0H0|ACOX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.2760.12	42.00983	3	2107.046471	2106.038184	K	L	314	331
PSM	QEYDESGPSIVHR	533	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:28	ms_run[1]:scan=1.1.2485.20	34.35775	2	1499.6792	1498.6682	K	K	360	373
PSM	VITAFNDGLNHLDSLK	534	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3091.8	51.28503	3	1756.903571	1755.915549	K	G	68	84
PSM	GVVPLAGTNGETTTQGLDGLSER	535	tr|A6ZI46|A6ZI46_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3143.13	52.74507	3	2272.127471	2271.134269	K	C	167	190
PSM	QFSYTHICAGASAFGK	536	sp|Q99LC5|ETFA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:28,8-UNIMOD:4	ms_run[1]:scan=1.1.3078.20	50.92311	2	1726.7833	1726.7768	K	N	102	118
PSM	AGVDQHEGTIK	537	tr|E9QN99|E9QN99_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:1	ms_run[1]:scan=1.1.1992.20	20.73285	2	1195.5787	1195.5828	M	V	2	13
PSM	ASAFALQEQPVVNAVIDDATK	538	sp|Q9D2G2|ODO2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.3540.12	63.85552	3	2186.136971	2186.121913	K	E	288	309
PSM	RVAEDDEDDDVDTK	539	sp|P26350|PTMA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.1759.18	14.2341	3	1620.667271	1620.675104	K	K	90	104
PSM	GGNIGDGGGAADR	540	sp|Q01853|TERA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.1708.12	12.83163	2	1115.491647	1115.495563	R	V	587	600
PSM	HQTVLDNTEGK	541	sp|Q921I1|TRFE_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.1738.20	13.65313	2	1240.599047	1240.604780	K	N	555	566
PSM	IGPASQGLQK	542	sp|P00920|CAH2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.1949.17	19.53435	2	997.550047	997.555644	K	V	149	159
PSM	VGGTSDVEVNEK	543	sp|P63038|CH60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.1915.21	18.59295	2	1232.585847	1232.588461	K	K	406	418
PSM	YLAEVAAGDDKK	544	sp|P63101|1433Z_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.1961.12	19.86973	3	1278.639971	1278.645582	R	G	128	140
PSM	NQAPPGLYTK	545	sp|P16460|ASSY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2096.15	23.60445	2	1087.562247	1087.566209	K	T	200	210
PSM	RAAAEVNQEYGLDPK	546	sp|P97807|FUMH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2152.18	25.17082	3	1659.822371	1659.821649	K	I	98	113
PSM	IAVAAQNCYK	547	sp|P17751|TPIS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26	8-UNIMOD:4	ms_run[1]:scan=1.1.2040.16	22.06448	2	1136.560447	1136.564829	K	V	110	120
PSM	TIQVDNTDAEGR	548	sp|Q9CPY7|AMPL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2022.19	21.57007	2	1317.614447	1317.616073	K	L	357	369
PSM	RFNSANEDNVTQVR	549	sp|P24270|CATA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.1983.21	20.48388	3	1648.794671	1648.791746	K	T	431	445
PSM	RFNSANEDNVTQVR	550	sp|P24270|CATA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.1989.19	20.64917	3	1648.794671	1648.791746	K	T	431	445
PSM	IKGEHPGLSIGDVAK	551	sp|P63158|HMGB1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2165.15	25.53602	3	1519.832171	1519.835842	K	K	113	128
PSM	VLEDNSVPQVK	552	sp|Q9D051|ODPB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2289.12	28.96193	2	1226.645447	1226.650667	K	D	337	348
PSM	VAGQDGSVVQFK	553	sp|P61957|SUMO2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2341.14	30.40788	2	1233.632247	1233.635351	K	I	22	34
PSM	TEGGYYQITGR	554	sp|Q99NB1|ACS2L_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2317.18	29.74015	2	1243.581647	1243.583316	R	M	531	542
PSM	AAISDSVVEPAAK	555	sp|Q62468|VILI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2289.13	28.96362	2	1256.658247	1256.661232	K	A	238	251
PSM	AAISDSVVEPAAK	556	sp|Q62468|VILI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2296.15	29.15358	2	1256.658247	1256.661232	K	A	238	251
PSM	EDQTEYLEER	557	sp|P07901|HS90A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2275.19	28.58203	2	1310.559847	1310.562640	K	R	192	202
PSM	AVDPDSPAEASGLR	558	sp|P70441|NHRF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2303.20	29.355	2	1383.666447	1383.663023	R	A	176	190
PSM	ADFAQACQDAGVR	559	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26	7-UNIMOD:4	ms_run[1]:scan=1.1.2309.20	29.52243	2	1407.622247	1407.620112	R	F	125	138
PSM	LAQAAQSSVATITR	560	sp|P26039|TLN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2291.15	29.01905	2	1415.771647	1415.773242	K	L	2044	2058
PSM	VIQCFAETGQVQK	561	sp|Q68FD5|CLH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26	4-UNIMOD:4	ms_run[1]:scan=1.1.2351.21	30.6824	2	1506.749047	1506.750064	K	I	488	501
PSM	QVGQENQMQWAQK	562	sp|Q9WVL0|MAAI_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2291.17	29.02238	2	1573.731647	1573.730725	K	V	121	134
PSM	VMLGETNPADSKPGTIR	563	sp|P15532|NDKA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26	2-UNIMOD:35	ms_run[1]:scan=1.1.2237.16	27.53427	3	1800.901271	1800.903999	R	G	89	106
PSM	VAVTGGTHGNEMCGVYLAR	564	sp|Q91XE4|ACY3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26	12-UNIMOD:35,13-UNIMOD:4	ms_run[1]:scan=1.1.2252.21	27.9513	3	2006.933771	2006.930230	R	Y	14	33
PSM	TYFPHFDVSHGSAQVK	565	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2557.6	36.34892	4	1818.868894	1818.868933	K	G	42	58
PSM	KITISDCGQL	566	sp|P17742|PPIA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26	7-UNIMOD:4	ms_run[1]:scan=1.1.2453.11	33.4826	2	1133.571647	1133.575060	K	-	155	165
PSM	NVIIWGNHSSTQYPDVNHAK	567	sp|P14152|MDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2478.12	34.15925	4	2279.114494	2279.108329	K	V	180	200
PSM	LGTAAIQGAIEK	568	sp|Q8QZT1|THIL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2470.10	33.94487	2	1170.657847	1170.660838	K	A	64	76
PSM	DGVANVSIEDR	569	sp|P08228|SODC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2386.15	31.63523	2	1173.561047	1173.562580	K	V	93	104
PSM	TYFPHFDVSHGSAQVK	570	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2555.15	36.30163	3	1818.879071	1818.868933	K	G	42	58
PSM	GMGGAMDLVSSSK	571	sp|Q9D0K2|SCOT1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2575.12	36.85909	2	1238.562047	1238.563508	K	T	422	435
PSM	LSQLEGVNVER	572	sp|Q9EQH3|VPS35_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2417.17	32.49726	2	1242.653447	1242.656815	R	Y	227	238
PSM	FDDAVVQSDMK	573	sp|P63017|HSP7C_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2458.11	33.62355	2	1253.555447	1253.559803	R	H	78	89
PSM	VPAINVNDSVTK	574	sp|P50247|SAHH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2402.18	32.08175	2	1255.674047	1255.677216	K	S	175	187
PSM	LVEEAIQCAEK	575	sp|Q8BH95|ECHM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26	8-UNIMOD:4	ms_run[1]:scan=1.1.2406.18	32.19308	2	1288.631447	1288.633303	K	I	218	229
PSM	TIYAGNALCTVK	576	sp|Q99LC5|ETFA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26	9-UNIMOD:4	ms_run[1]:scan=1.1.2492.18	34.5527	2	1309.668247	1309.670023	R	C	147	159
PSM	GNIYSLNEGYAK	577	sp|Q9QXD6|F16P1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2504.15	34.88122	2	1327.639647	1327.640831	K	D	207	219
PSM	AQVAQPGGDTIFGK	578	sp|P70349|HINT1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2537.19	35.81367	2	1387.709047	1387.709579	K	I	8	22
PSM	ITSLEVENQNLR	579	sp|P57776|EF1D_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2483.18	34.3006	2	1414.740647	1414.741607	R	G	84	96
PSM	SQIHDIVLVGGSTR	580	sp|P63017|HSP7C_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2445.20	33.27215	2	1480.802647	1480.799791	K	I	329	343
PSM	AQGSVALSVTQDPAR	581	sp|Q78JT3|3HAO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2399.20	32.00098	2	1498.777047	1498.773970	R	K	267	282
PSM	LSGCEAMDSQALVR	582	sp|Q91WG0|EST2C_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26	4-UNIMOD:4	ms_run[1]:scan=1.1.2561.19	36.47137	2	1535.710047	1535.707213	K	C	279	293
PSM	ITEIYEGTSEIQR	583	sp|Q07417|ACADS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2536.20	35.78658	2	1537.773047	1537.762402	R	L	387	400
PSM	YAAELHLVHWNTK	584	sp|P00920|CAH2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2529.13	35.5866	3	1580.807471	1580.809962	K	Y	114	127
PSM	NKQELDINNITTYK	585	sp|P12658|CALB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2550.13	36.16772	2	1692.872447	1692.868265	K	K	222	236
PSM	ALALGGTCTGEHGIGLGK	586	sp|Q7TNG8|LDHD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26	8-UNIMOD:4	ms_run[1]:scan=1.1.2533.18	35.70197	3	1710.870971	1710.872304	R	R	432	450
PSM	IVSNASCTTNCLAPLAK	587	tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26	7-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=1.1.2569.21	36.6975	2	1818.905247	1818.896805	K	V	144	161
PSM	EAINQGMDEELERDEK	588	sp|Q9D051|ODPB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2372.18	31.2503	3	1904.844371	1904.842186	R	V	37	53
PSM	AIGSASEGAQSSLQEVYHK	589	sp|Q9Z2U1|PSA5_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2413.17	32.3874	3	1960.953071	1960.949034	R	S	169	188
PSM	VVEIAPATHLDPQLR	590	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2708.11	40.55395	3	1657.920071	1657.915155	K	S	274	289
PSM	LGDPLLEDTR	591	sp|Q9JLJ2|AL9A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2666.8	39.37978	2	1127.577847	1127.582253	K	M	317	327
PSM	LVQEVTDFAK	592	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2578.12	36.94395	2	1148.605847	1148.607740	K	T	66	76
PSM	SEGGFIWACK	593	sp|O88844|IDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26	9-UNIMOD:4	ms_run[1]:scan=1.1.2766.10	42.17624	2	1153.522447	1153.522630	K	N	261	271
PSM	ISFTGSVPTGVK	594	sp|Q9JLJ2|AL9A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2660.3	39.21977	2	1191.645447	1191.649939	K	I	228	240
PSM	LVQAFQFTDK	595	sp|P35700|PRDX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2767.13	42.20665	2	1195.626047	1195.623724	R	H	159	169
PSM	AIEMLGGELGSK	596	sp|P97807|FUMH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2765.12	42.14998	2	1203.614647	1203.616924	R	K	158	170
PSM	PAACTMLVSSLR	597	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26	4-UNIMOD:4	ms_run[1]:scan=1.1.2774.15	42.40432	2	1304.661047	1304.658078	K	D	749	761
PSM	EAAQMDMVNDGVEDLRGK	598	sp|P19157|GSTP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2750.8	41.73545	3	1976.896271	1976.893176	R	Y	86	104
PSM	EAFQEALAAAGDK	599	sp|P10639|THIO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2738.18	41.40578	2	1319.638247	1319.635745	K	L	9	22
PSM	MLLQQDLSSYK	600	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26	1-UNIMOD:35	ms_run[1]:scan=1.1.2619.13	38.0785	2	1340.663647	1340.664603	R	F	318	329
PSM	YLILNATQAESK	601	sp|Q9CQV8|1433B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2616.9	38.00188	2	1349.715647	1349.719081	K	V	106	118
PSM	VGVPTETGALTLNR	602	sp|Q8BWT1|THIM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2732.11	41.2367	2	1426.780247	1426.777993	R	L	77	91
PSM	VILSSSSSCLLPSK	603	sp|Q99KP3|CRYL1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26	9-UNIMOD:4	ms_run[1]:scan=1.1.2747.19	41.65887	2	1476.788247	1476.785781	R	L	117	131
PSM	GENLSLVVHGPGDIR	604	sp|Q64442|DHSO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2665.12	39.35954	2	1561.820447	1561.821255	K	L	7	22
PSM	GENLSLVVHGPGDIR	605	sp|Q64442|DHSO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2669.9	39.46143	3	1561.821071	1561.821255	K	L	7	22
PSM	ATCIGNNSAAAVSMLK	606	sp|Q9R1P0|PSA4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26	3-UNIMOD:4	ms_run[1]:scan=1.1.2667.10	39.4152	2	1606.787047	1606.780712	K	Q	161	177
PSM	ESAAIYFTSGTSGPPK	607	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2685.7	39.90967	3	1611.781571	1611.778053	R	M	214	230
PSM	QDLPNAMNAAEITDK	608	sp|P61205|ARF3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2759.20	41.9884	2	1629.772247	1629.766836	K	L	128	143
PSM	MISSYVGENAEFER	609	sp|Q9D0K2|SCOT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2719.20	40.87722	2	1630.735047	1630.729722	R	Q	111	125
PSM	HGYIGEFEIIDDHR	610	sp|P62245|RS15A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2706.11	40.49665	3	1699.799471	1699.795434	K	A	44	58
PSM	VSHVSTGGGASLELLEGK	611	sp|P09041|PGK2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2579.21	36.9791	2	1739.908847	1739.905378	K	I	389	407
PSM	KGSLLIDSSTIDPSVSK	612	sp|Q99L13|3HIDH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2693.8	40.12675	3	1745.940671	1745.941095	K	E	124	141
PSM	GEVITTYCPANNEPIAR	613	sp|Q9DBF1|AL7A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26	8-UNIMOD:4	ms_run[1]:scan=1.1.2661.10	39.25515	2	1903.917847	1903.909812	R	V	63	80
PSM	EIIAVSCGPSQCQETIR	614	sp|Q9DCW4|ETFB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26	7-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.2637.21	38.58202	2	1946.930647	1946.918997	K	T	60	77
PSM	LVQDVANNTNEEAGDGTTTATVLAR	615	sp|P63038|CH60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2705.21	40.47637	3	2559.255071	2559.241253	K	S	97	122
PSM	ALNDHHVYLEGTLLKPNMVTAGHACTK	616	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26	25-UNIMOD:4	ms_run[1]:scan=1.1.2590.13	37.27725	5	2989.510618	2989.490232	K	K	216	243
PSM	LAVNMVPFPR	617	sp|A2AQ07|TBB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3073.6	50.77058	2	1142.625647	1142.627035	K	L	253	263
PSM	FLASVSTVLTSK	618	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2992.8	48.52623	2	1251.707847	1251.707454	K	Y	129	141
PSM	TVTNAVVTVPAYFNDSQR	619	sp|P63017|HSP7C_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3071.10	50.71668	3	1981.000571	1980.990505	K	Q	138	156
PSM	DPEGYFHFIGR	620	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3007.2	48.93532	3	1336.617071	1336.620036	K	S	452	463
PSM	IEDLELVPVESK	621	sp|Q62468|VILI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2987.5	48.38822	2	1369.739447	1369.734062	R	W	405	417
PSM	AEMQQILQGLDK	622	sp|Q91YI0|ARLY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3068.17	50.63622	2	1372.703447	1372.702051	K	V	58	70
PSM	ALAGCDFLTISPK	623	sp|Q93092|TALDO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26	5-UNIMOD:4	ms_run[1]:scan=1.1.3080.12	50.97295	2	1391.714447	1391.711887	K	L	246	259
PSM	FASEITPITISVK	624	sp|Q8QZT1|THIL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3094.11	51.37287	2	1404.791047	1404.786432	K	G	228	241
PSM	VDLCATWEAMEK	625	sp|Q91WR5|AK1CL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26	4-UNIMOD:4	ms_run[1]:scan=1.1.3171.11	53.53263	2	1451.644847	1451.642487	R	C	142	154
PSM	SSGPALWWMNGSGK	626	sp|Q8K0L3|ACSM2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3163.6	53.30985	2	1476.693847	1476.681984	R	E	64	78
PSM	LYTLVLTDPDAPSR	627	sp|P70296|PEBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3100.18	51.54548	2	1559.825847	1559.819523	K	K	63	77
PSM	LYTLVLTDPDAPSR	628	sp|P70296|PEBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3107.14	51.736	2	1559.825847	1559.819523	K	K	63	77
PSM	SVIGMGTGAGAYILTR	629	sp|Q62433|NDRG1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3127.13	52.29055	2	1565.827447	1565.823563	K	F	133	149
PSM	VDGLLTCCSVFINK	630	sp|Q9CWS0|DDAH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26	7-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.3142.14	52.71722	2	1624.803047	1624.795300	K	K	268	282
PSM	FSSETWQNLGTLQR	631	sp|Q8VCR7|ABHEB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2999.18	48.72233	2	1665.818847	1665.811084	R	L	43	57
PSM	LSQTFPNADFAEITK	632	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3117.20	52.01442	2	1680.846247	1680.835902	R	L	243	258
PSM	SPAHGISLFLVENGMK	633	sp|P51174|ACADL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3019.2	49.26572	3	1698.877871	1698.876327	R	G	225	241
PSM	IHFPLATYAPVISAEK	634	sp|P05213|TBA1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3141.5	52.68097	3	1755.961871	1755.955957	R	A	265	281
PSM	VCLIGCGFSTGYGSAVK	635	sp|P00329|ADH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26	2-UNIMOD:4,6-UNIMOD:4	ms_run[1]:scan=1.1.3005.19	48.89365	2	1774.847847	1774.838227	K	V	170	187
PSM	VSHALAEGLGVIACIGEK	636	sp|P17751|TPIS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26	14-UNIMOD:4	ms_run[1]:scan=1.1.3117.21	52.01527	2	1822.970647	1822.961119	K	L	164	182
PSM	ESSIYLIGGSIPEEDAGK	637	sp|Q9JHW2|NIT2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3136.20	52.55042	2	1863.919047	1863.910189	K	L	75	93
PSM	FQDEEEVFEWNNEVK	638	sp|Q9DBF1|AL7A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3171.21	53.54099	2	1940.855847	1940.842838	K	Q	438	453
PSM	ATEIGGILVNTPEDPNLSK	639	sp|P34914|HYES_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3141.21	52.69432	2	1967.034447	1967.021136	K	I	421	440
PSM	EIIVTDYTPQNLQELQK	640	sp|P40936|INMT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3187.10	53.97807	3	2031.060371	2031.052437	R	W	81	98
PSM	GIHVEIPGAQAESLGPLQVAR	641	sp|Q9DCW4|ETFB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3147.15	52.8617	3	2141.172971	2141.159302	R	V	86	107
PSM	GPAVGIDLGTTYSCVGVFQHGK	642	sp|P63017|HSP7C_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26	14-UNIMOD:4	ms_run[1]:scan=1.1.3111.13	51.8472	3	2262.123371	2262.110303	K	V	4	26
PSM	TPALIVYGDQDPMGSSSFQHLK	643	sp|Q8VCR7|ABHEB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3077.19	50.89412	3	2390.169671	2390.157647	K	Q	152	174
PSM	VWSRDEDITEYQSILAAAVK	644	sp|Q9DCM2|GSTK1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3435.3	60.91757	3	2293.160171	2293.159027	R	A	125	145
PSM	IILDLISESPIK	645	sp|P61979|HNRPK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3489.9	62.40797	2	1339.798647	1339.796269	K	G	208	220
PSM	TLNDELEIIEGMK	646	sp|P63038|CH60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3446.9	61.21112	2	1503.753247	1503.749061	K	F	206	219
PSM	GLGGVNVEELFGISK	647	sp|Q9Z2V4|PCKGC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3622.9	66.1788	2	1517.819247	1517.808959	K	E	568	583
PSM	VYEGSILEADCDILIPAASEK	648	sp|P26443|DHE3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26	11-UNIMOD:4	ms_run[1]:scan=1.1.3483.12	62.24098	3	2292.136871	2292.119530	K	Q	366	387
PSM	DAVLNAWAEDVDLR	649	sp|P52480|KPYM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3502.13	62.7859	2	1585.781247	1585.773636	K	V	476	490
PSM	TFVSITPAEVGVLVGK	650	sp|P62962|PROF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3514.12	63.1108	2	1615.930647	1615.918509	K	D	39	55
PSM	IVPLQGAQMLQMLEK	651	sp|Q91XE0|GLYAT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	26		ms_run[1]:scan=1.1.3576.11	64.88808	2	1697.9273	1697.9203	M	S	2	17
PSM	AVFVDLEPTVIDEIR	652	sp|P68368|TBA4A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3616.12	66.00968	2	1714.927247	1714.914152	R	N	65	80
PSM	AVFVDLEPTVIDEIR	653	sp|P68368|TBA4A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3604.12	65.66248	2	1714.927247	1714.914152	R	N	65	80
PSM	GLAPVQAYLHIPDIIK	654	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3472.4	61.92473	3	1747.013171	1747.003242	R	V	89	105
PSM	QGLLPLTFADPSDYNK	655	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3512.11	63.06222	2	1777.901247	1777.888666	K	I	702	718
PSM	SGGGGNFVLSTSLVGYLR	656	sp|Q9DC50|OCTC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3531.13	63.59938	2	1782.933847	1782.926448	R	V	533	551
PSM	LENYPIPELGPNDVLLK	657	sp|Q64442|DHSO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3533.21	63.6618	2	1923.052847	1923.035330	R	M	22	39
PSM	VKPIWPIGMFSGYVDNPK	658	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3478.8	62.09513	3	2047.071971	2047.060105	R	K	415	433
PSM	ISALQSAGVVVSMSPAQLGTTIYK	659	sp|Q9WUM5|SUCA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3561.15	64.46343	3	2420.317571	2420.298497	K	E	315	339
PSM	LNPNFLVDFGKEPLGPALAHELR	660	sp|P17563|SBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3488.5	62.37635	4	2546.384094	2546.364544	K	Y	438	461
PSM	AVNACGINCSALLQDDITAAIQCAK	661	sp|P08905|LYZ2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26	5-UNIMOD:4,9-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=1.1.3595.17	65.41143	3	2676.288671	2676.266957	R	R	91	116
PSM	RSEPEPQILDFQTQQYK	662	sp|Q9R0H0|ACOX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2766.16	42.18123	3	2107.046471	2106.038184	K	L	314	331
PSM	VAGALAEEGMGLEEITK	663	sp|Q8VC30|TKFC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.3082.17	51.03422	2	1715.853047	1716.860402	K	R	163	180
PSM	LTGSLSGWTSPK	664	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.2620.12	38.10455	2	1232.639447	1232.640102	K	D	234	246
PSM	VGGTSDVEVNEKK	665	sp|P63038|CH60_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.1748.15	13.92302	3	1360.676171	1360.683424	K	D	406	419
PSM	KVNVVEQEK	666	sp|P17182|ENOA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.1671.16	11.79672	2	1071.585247	1071.592424	K	I	81	90
PSM	KPMVLGHEAAGTVTK	667	sp|Q64442|DHSO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.1898.12	18.12108	4	1537.824494	1537.828648	K	V	64	79
PSM	KLSVSQVVHK	668	sp|P07759|SPA3K_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.1848.9	16.72305	3	1123.663871	1123.671343	K	A	351	361
PSM	DSYVGDEAQSK	669	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.1902.19	18.2362	2	1197.513247	1197.514961	K	R	51	62
PSM	DSYVGDEAQSK	670	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.1909.19	18.427	2	1197.513247	1197.514961	K	R	51	62
PSM	TVEAEAAHGTVTR	671	sp|O88844|IDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.1807.10	15.57115	3	1340.662271	1340.668442	K	H	302	315
PSM	HEYQANGPEDLNR	672	sp|Q9R0P5|DEST_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.1954.16	19.67448	3	1541.682371	1541.685883	K	T	133	146
PSM	HYGGLTGLNK	673	sp|O70250|PGAM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.1967.19	20.04337	2	1058.547447	1058.550893	R	A	91	101
PSM	VIEASEIQAK	674	sp|P17563|SBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2129.15	24.51698	2	1086.587247	1086.592090	K	C	121	131
PSM	VVGCSCVVVK	675	sp|P63323|RS12_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25	4-UNIMOD:4,6-UNIMOD:4	ms_run[1]:scan=1.1.2097.14	23.63325	2	1105.557647	1105.562387	K	D	103	113
PSM	LDQGGAPLAGTNK	676	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2026.20	21.68172	2	1240.639247	1240.641165	K	E	109	122
PSM	AQEIDQTNDFK	677	sp|Q9JHI5|IVD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2144.20	24.9456	2	1307.598447	1307.599360	K	N	66	77
PSM	SDGALVDCGTSAQK	678	sp|Q64105|SPRE_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25	8-UNIMOD:4	ms_run[1]:scan=1.1.2009.20	21.21362	2	1407.628247	1407.630008	K	L	228	242
PSM	QEYDESGPSIVHR	679	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2143.17	24.91482	3	1515.691871	1515.695386	K	K	360	373
PSM	RDPSVGEHTVEVLR	680	sp|O09174|AMACR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2160.18	25.39713	3	1592.822171	1592.827068	K	E	341	355
PSM	DGGGDVAFVK	681	sp|Q921I1|TRFE_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2317.10	29.73347	2	963.462247	963.466161	K	H	216	226
PSM	IGGHGAEYGAEALER	682	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2219.16	27.04123	3	1528.729271	1528.727020	K	M	18	33
PSM	SGEIEPVSVK	683	sp|Q64433|CH10_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2164.18	25.51013	2	1043.547247	1043.549890	K	V	57	67
PSM	VVAGVAAALAHK	684	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2240.16	27.61538	2	1105.658447	1105.660778	K	Y	134	146
PSM	IDVSVEAASGGK	685	sp|O08749|DLDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2287.11	28.9081	2	1131.571847	1131.577168	K	A	289	301
PSM	VNVPVIGGHAGK	686	sp|P08249|MDHM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2202.4	26.57183	3	1146.644171	1146.650942	R	T	192	204
PSM	FAAATGATPIAGR	687	sp|P14206|RSSA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2307.17	29.46565	2	1202.635647	1202.640771	K	F	90	103
PSM	NAAGNFYINDK	688	sp|Q8CHT0|AL4A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2333.20	30.19167	2	1225.567447	1225.572751	R	S	498	509
PSM	DQVANSAFVER	689	sp|P07901|HS90A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2326.17	29.9917	2	1234.590847	1234.594215	K	L	501	512
PSM	YVGSMVADIHR	690	sp|Q9QXD6|F16P1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2321.7	29.84315	3	1246.608071	1246.612842	R	T	245	256
PSM	RTIAQDYGVLK	691	sp|P35700|PRDX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2304.18	29.38177	2	1262.696847	1262.698286	K	A	110	121
PSM	LAQEDPDYGLR	692	sp|P24270|CATA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2364.16	31.03325	2	1275.607647	1275.609531	R	D	253	264
PSM	IIYGGSVTGATCK	693	sp|P17751|TPIS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25	12-UNIMOD:4	ms_run[1]:scan=1.1.2276.20	28.61063	2	1325.664447	1325.664937	R	E	257	270
PSM	VVAGVAAALAHKYH	694	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2338.5	30.32055	3	1405.781471	1405.783019	K	-	134	148
PSM	VCVQTVESGAMTK	695	sp|P54071|IDHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25	2-UNIMOD:4	ms_run[1]:scan=1.1.2296.20	29.15777	2	1408.665047	1408.669036	K	D	401	414
PSM	VCVQTVESGAMTK	696	sp|P54071|IDHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25	2-UNIMOD:4	ms_run[1]:scan=1.1.2302.19	29.32573	2	1408.665047	1408.669036	K	D	401	414
PSM	STGSVVGQQPFGGAR	697	sp|Q8CHT0|AL4A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2344.15	30.49012	2	1446.719847	1446.721541	K	A	509	524
PSM	ENYGELADCCTK	698	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25	9-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.2258.21	28.1154	2	1458.576047	1458.575530	R	Q	106	118
PSM	QTANVLSGACGLHR	699	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25	10-UNIMOD:4	ms_run[1]:scan=1.1.2237.10	27.52925	3	1482.732971	1482.736145	K	G	92	106
PSM	HSSLAGCQIINYR	700	sp|Q68FD5|CLH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25	7-UNIMOD:4	ms_run[1]:scan=1.1.2354.12	30.75783	3	1517.739971	1517.740896	R	T	145	158
PSM	IIAEGANGPTTPEADK	701	sp|P26443|DHE3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2182.21	26.02135	2	1582.783247	1582.783866	K	I	400	416
PSM	SDFDPGQDTYQHPPK	702	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2222.15	27.1241	3	1730.754371	1730.753629	R	D	535	550
PSM	GQHMSEQFSQVNCLNK	703	sp|Q61133|GSTT2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25	13-UNIMOD:4	ms_run[1]:scan=1.1.2296.16	29.15442	3	1905.848771	1905.846166	K	V	38	54
PSM	EQAGGDATENFEDVGHSTDAR	704	sp|P56395|CYB5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2311.11	29.5759	3	2204.920871	2204.920647	R	E	53	74
PSM	VNIHGGAVSLGHPIGMSGAR	705	sp|Q8QZT1|THIL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2398.9	31.96443	4	1928.996094	1929.000299	K	I	371	391
PSM	KITISDCGQL	706	sp|P17742|PPIA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25	7-UNIMOD:4	ms_run[1]:scan=1.1.2446.16	33.29645	2	1133.571647	1133.575060	K	-	155	165
PSM	KTEQGPPSSEYIFER	707	sp|P29758|OAT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2432.11	32.90895	3	1766.851871	1766.847529	K	E	32	47
PSM	SAGACTAAAFLR	708	sp|Q9CPY7|AMPL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25	5-UNIMOD:4	ms_run[1]:scan=1.1.2566.14	36.607	2	1194.580047	1194.581542	R	E	458	470
PSM	LPANALLGEENK	709	sp|P51174|ACADL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2544.11	36.00082	2	1267.676647	1267.677216	R	G	268	280
PSM	AFSGYLGPDESK	710	sp|Q9R0P3|ESTD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2500.12	34.76767	2	1269.585847	1269.587733	K	W	187	199
PSM	EALQDVEDENQ	711	sp|P62259|1433E_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2425.19	32.7209	2	1288.542047	1288.541905	K	-	245	256
PSM	IAPAIAAGNTVIAK	712	sp|Q8BH00|AL8A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2573.19	36.80838	2	1308.774847	1308.776536	K	P	165	179
PSM	CSDFTEEICR	713	sp|Q9D6R2|IDH3A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25	1-UNIMOD:4,9-UNIMOD:4	ms_run[1]:scan=1.1.2457.13	33.59333	2	1315.511047	1315.517287	K	R	351	361
PSM	AIAGTGANVIVTGGK	714	sp|P42932|TCPQ_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2412.20	32.36162	2	1327.742847	1327.745965	K	V	282	297
PSM	AIAGTGANVIVTGGK	715	sp|P42932|TCPQ_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2413.18	32.38823	2	1327.742847	1327.745965	K	V	282	297
PSM	GYDVIAQAQSGTGK	716	sp|P10630|IF4A2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2392.20	31.80735	2	1393.684247	1393.683758	K	T	70	84
PSM	FAQTVIGKPIEPR	717	sp|Q9DBM2|ECHP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2387.9	31.65808	3	1454.821871	1454.824549	K	R	182	195
PSM	GTFASLSELHCDK	718	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25	11-UNIMOD:4	ms_run[1]:scan=1.1.2466.4	33.82907	3	1463.672771	1463.671479	K	L	84	97
PSM	TFTTQETITNAETAK	719	sp|P06745|G6PI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2414.21	32.41898	2	1654.808247	1654.804996	K	E	212	227
PSM	IVYGHLDDPANQEIER	720	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2504.11	34.87788	3	1867.913471	1867.906441	K	G	69	85
PSM	VAVPSTIHCDHLIEAQVGGEK	721	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25	9-UNIMOD:4	ms_run[1]:scan=1.1.2573.14	36.8042	4	2259.136094	2259.131767	K	D	118	139
PSM	LPAVVTADLR	722	sp|Q9DCW4|ETFB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2731.4	41.20205	2	1053.614247	1053.618245	K	L	177	187
PSM	LGDPLLEDTR	723	sp|Q9JLJ2|AL9A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2659.3	39.191	2	1127.577847	1127.582253	K	M	317	327
PSM	SEGGFIWACK	724	sp|O88844|IDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25	9-UNIMOD:4	ms_run[1]:scan=1.1.2760.10	42.00817	2	1153.522447	1153.522630	K	N	261	271
PSM	VGLIGSCTNSSYEDMGR	725	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25	7-UNIMOD:4	ms_run[1]:scan=1.1.2741.15	41.48815	3	1844.806871	1844.803298	R	S	379	396
PSM	DGNGYISAAELR	726	sp|P0DP26|CALM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2687.8	39.96457	2	1264.606447	1264.604780	K	H	96	108
PSM	KPFDPENTEEAEFHVDESTTVK	727	sp|P07758|A1AT1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2625.20	38.2467	4	2548.174094	2548.160543	K	V	214	236
PSM	PAACTMLVSSLR	728	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25	4-UNIMOD:4	ms_run[1]:scan=1.1.2768.16	42.23698	2	1304.661047	1304.658078	K	D	749	761
PSM	NPAVLSAASFDGR	729	sp|Q3UPL0|SC31A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2701.15	40.35637	2	1303.661447	1303.652064	R	I	315	328
PSM	FFQEEVIPHHTEWEK	730	sp|P51174|ACADL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2615.7	37.97497	3	1954.931471	1954.921363	K	A	67	82
PSM	LRGEDGESECVINYVEK	731	sp|Q8R0Y6|AL1L1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25	10-UNIMOD:4	ms_run[1]:scan=1.1.2595.15	37.42167	3	1995.933671	1995.920771	K	A	395	412
PSM	WALSQSNPSALR	732	sp|Q01853|TERA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2656.16	39.11425	2	1328.689247	1328.683699	R	E	454	466
PSM	LNISFPATGCQK	733	sp|P62754|RS6_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25	10-UNIMOD:4	ms_run[1]:scan=1.1.2750.9	41.73712	2	1334.667247	1334.665272	K	L	3	15
PSM	LPMGMTAENLAAK	734	sp|Q8BWT1|THIM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2714.19	40.73212	2	1345.673247	1345.673393	K	Y	159	172
PSM	TVIIEQSWGSPK	735	sp|P63038|CH60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2688.5	39.9949	2	1343.708447	1343.708516	R	V	61	73
PSM	TVIIEQSWGSPK	736	sp|P63038|CH60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2695.14	40.1865	2	1343.708447	1343.708516	R	V	61	73
PSM	AYSTDVCVPISR	737	sp|Q7TNG8|LDHD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25	7-UNIMOD:4	ms_run[1]:scan=1.1.2596.16	37.45055	2	1366.655847	1366.655101	K	L	363	375
PSM	SLVANLAAANCYK	738	sp|P55264|ADK_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25	11-UNIMOD:4	ms_run[1]:scan=1.1.2751.11	41.76915	2	1393.700047	1393.702385	R	K	149	162
PSM	ETTIQGLDGLSER	739	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2753.18	41.82085	2	1417.707647	1417.704888	K	C	122	135
PSM	IIAINVNDPEAEK	740	sp|Q91VM9|IPYR2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2662.6	39.27375	2	1424.752447	1424.751109	K	F	199	212
PSM	ARPFPDGLAEDIDKGEVSAR	741	sp|P58252|EF2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	25		ms_run[1]:scan=1.1.2748.17	41.68443	3	2143.0842	2142.0702	K	Q	606	626
PSM	TTPSVVAFTADGER	742	sp|P38647|GRP75_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2677.20	39.69433	2	1449.711047	1449.709973	R	L	86	100
PSM	NVETMNYADIER	743	sp|Q9D2G2|ODO2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2595.17	37.42333	2	1453.650647	1453.650744	R	T	335	347
PSM	LQAGTVFVNTYNK	744	sp|Q8R0Y6|AL1L1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2649.18	38.91965	2	1453.758847	1453.756529	K	T	853	866
PSM	SQFTITPGSEQIR	745	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2631.19	38.41305	2	1462.745847	1462.741607	K	A	412	425
PSM	VDGVSAEPTPESWR	746	sp|O35488|S27A2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2624.20	38.21938	2	1528.720847	1528.715787	K	S	198	212
PSM	ETVSEESNVLCLSK	747	sp|P58252|EF2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25	11-UNIMOD:4	ms_run[1]:scan=1.1.2681.19	39.80772	2	1593.759447	1593.755603	R	S	581	595
PSM	WIDIHNPATNEVVGR	748	sp|Q9EQ20|MMSA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2763.12	42.09405	3	1719.873071	1719.869268	K	V	56	71
PSM	ADNFEYSDPVDGSISK	749	sp|Q9D0F9|PGM1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2758.18	41.95863	2	1742.776247	1742.763525	K	N	471	487
PSM	EVYMGNVIQGGEGQAPTR	750	sp|Q8QZT1|THIL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2691.21	40.08332	2	1904.914247	1904.905061	K	Q	85	103
PSM	NANSLGGGFHCWTCDVR	751	sp|Q9D964|GATM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25	11-UNIMOD:4,14-UNIMOD:4	ms_run[1]:scan=1.1.2662.5	39.27208	3	1949.831771	1949.826099	R	R	397	414
PSM	SVVLMSHLGRPDGVPMPDK	752	sp|P09411|PGK1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2709.20	40.58993	3	2034.050171	2034.039052	K	Y	57	76
PSM	VADIGLAAWGR	753	sp|P50247|SAHH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2982.8	48.251	2	1127.606247	1127.608743	K	K	9	20
PSM	LIDDMVAQAMK	754	sp|O88844|IDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2994.7	48.57522	2	1233.610247	1233.609730	R	S	250	261
PSM	SGAMSQALNFIK	755	sp|Q62468|VILI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3008.10	48.9699	2	1265.639847	1265.643808	R	A	309	321
PSM	LLSPGSVMLVSAR	756	sp|Q64105|SPRE_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3056.6	50.29737	2	1328.748847	1328.748607	R	S	31	44
PSM	FTQAGSEVSALLGR	757	sp|P56480|ATPB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3011.11	49.0542	2	1434.747447	1434.746693	R	I	311	325
PSM	GVVDSEDIPLNLSR	758	sp|Q9CQN1|TRAP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3042.14	49.90533	2	1512.782647	1512.778387	R	E	391	405
PSM	LLLINNAATLGDVSK	759	sp|Q64105|SPRE_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3148.15	52.89058	2	1540.886247	1540.882458	R	G	96	111
PSM	SIITLDGGALVQVQK	760	sp|P04117|FABP4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3154.20	53.06855	2	1540.886247	1540.882458	K	W	83	98
PSM	TDMFQTVDLYEGK	761	sp|P37804|TAGL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3160.16	53.23662	2	1545.711047	1545.702110	K	D	109	122
PSM	TPDFESTGLYSAMPR	762	sp|Q9D964|GATM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3087.20	51.18102	2	1670.769447	1670.761022	K	D	155	170
PSM	AIVAIENPADVSVISSR	763	sp|P14206|RSSA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3128.19	52.32402	2	1739.951047	1739.941764	R	N	64	81
PSM	VITAFNDGLNHLDSLK	764	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2998.10	48.6875	3	1755.927671	1755.915549	K	G	68	84
PSM	QVGYENAGTVEFLVDK	765	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3097.20	51.46453	2	1767.875847	1767.867930	K	H	301	317
PSM	NGICLEMGPQPQGVLR	766	sp|Q91XE4|ACY3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25	4-UNIMOD:4	ms_run[1]:scan=1.1.3053.21	50.22362	2	1767.879847	1767.876010	K	A	172	188
PSM	FDTGNLCMVTGGANLGR	767	sp|P62702|RS4X_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25	7-UNIMOD:4	ms_run[1]:scan=1.1.3096.19	51.43593	2	1781.826447	1781.818889	K	I	175	192
PSM	SYELPDGQVITIGNER	768	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3076.20	50.86685	2	1789.896047	1789.884643	K	F	239	255
PSM	TASAQPVSSVGVLGLGTMGR	769	sp|Q9DBM2|ECHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3141.20	52.69348	2	1886.998847	1886.988397	K	G	289	309
PSM	IFNSGADLSGITEENAPLK	770	sp|Q00898|A1AT5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3091.21	51.29588	2	1975.001847	1974.989836	R	L	329	348
PSM	TVTNAVVTVPAYFNDSQR	771	sp|P63017|HSP7C_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3074.21	50.8114	2	1981.002247	1980.990505	K	Q	138	156
PSM	ALYQTEAFTADFQQPTEAK	772	sp|P07759|SPA3K_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3092.17	51.32096	3	2158.029971	2158.021865	R	N	158	177
PSM	LAELEEFINGPNNAHIQQVGDR	773	sp|Q68FD5|CLH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3087.16	51.17768	3	2463.229871	2463.214250	R	C	1183	1205
PSM	EVMQMLVELAK	774	sp|P06745|G6PI_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3474.6	61.98147	2	1289.676447	1289.672331	K	S	63	74
PSM	GGELGLAMASFLK	775	sp|O55137|ACOT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3502.5	62.77922	2	1292.682447	1292.679859	K	G	234	247
PSM	DNVINLEVVLPDGR	776	sp|Q7TNG8|LDHD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3511.8	63.026	2	1551.836047	1551.825671	R	L	185	199
PSM	LGILGLCNTLAIEGR	777	sp|P51660|DHB4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25	7-UNIMOD:4	ms_run[1]:scan=1.1.3460.7	61.60492	2	1598.881847	1598.881412	K	K	169	184
PSM	TFVSITPAEVGVLVGK	778	sp|P62962|PROF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3520.16	63.28342	2	1615.930647	1615.918509	K	D	39	55
PSM	TCGFDFSGALEDISK	779	sp|P05202|AATM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25	2-UNIMOD:4	ms_run[1]:scan=1.1.3469.15	61.85188	2	1645.740247	1645.729388	K	I	186	201
PSM	LLYECNPIAYVMEK	780	sp|Q9QXD6|F16P1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25	5-UNIMOD:4	ms_run[1]:scan=1.1.3479.17	62.13108	2	1741.857247	1741.841915	R	A	278	292
PSM	LENYPIPELGPNDVLLK	781	sp|Q64442|DHSO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3539.21	63.83428	2	1923.052847	1923.035330	R	M	22	39
PSM	FLSQPFQVAEVFTGHMGK	782	sp|P56480|ATPB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3464.6	61.70747	3	2022.017471	2022.003318	R	L	463	481
PSM	AYGAGLLSSFGELQYCLSDKPK	783	sp|P16331|PH4H_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25	16-UNIMOD:4	ms_run[1]:scan=1.1.3476.16	62.04533	3	2403.199271	2403.178048	K	L	342	364
PSM	GLQVVEHACSVTSLMLGETMPSITK	784	sp|Q9EQ20|MMSA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25	9-UNIMOD:4	ms_run[1]:scan=1.1.3498.16	62.67413	3	2687.354471	2687.333245	R	D	141	166
PSM	TIYISGQVGLDPSSGQLVPGGVVEEAK	785	sp|P52760|RIDA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3447.18	61.24592	3	2699.424371	2699.401777	R	Q	30	57
PSM	VAVVAGYGDVGK	786	sp|P50247|SAHH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.2405.15	32.1626	2	1133.604047	1133.608074	K	G	215	227
PSM	VTNGAFTGEISPGMIK	787	sp|P17751|TPIS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.3017.9	49.22122	2	1621.806647	1620.818143	K	D	120	136
PSM	QGTFHSQQALEYGTK	788	sp|Q9WUM5|SUCA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:28	ms_run[1]:scan=1.1.2487.21	34.4145	2	1676.7821	1676.7789	K	L	67	82
PSM	VVNSETPVVVDFHAQWCGPCK	789	sp|P97493|THIOM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25	17-UNIMOD:4,20-UNIMOD:4	ms_run[1]:scan=1.1.3016.6	49.19357	3	2428.136771	2428.130387	R	I	74	95
PSM	AAQAHEDIIHGSGK	790	sp|P47199|QOR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.1712.5	12.93148	4	1432.698094	1432.705891	K	T	310	324
PSM	HGGPADEER	791	sp|P08228|SODC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.1570.16	9.002983	2	966.407847	966.415522	K	H	72	81
PSM	SEATAAAEHK	792	sp|Q9Z2V4|PCKGC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.1574.19	9.11495	2	1013.475047	1013.477788	R	G	462	472
PSM	RYDDPEVQK	793	sp|P38647|GRP75_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.1751.20	14.01067	2	1148.542447	1148.546202	R	D	127	136
PSM	PNMVTAGHACTK	794	sp|Q91Y97|ALDOB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	10-UNIMOD:4	ms_run[1]:scan=1.1.1731.20	13.45683	2	1285.586447	1285.590726	K	K	231	243
PSM	GDASKEDIDTAMK	795	sp|Q61425|HCDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.1951.17	19.59055	3	1379.619071	1379.623860	R	L	237	250
PSM	LLCGGGAAADR	796	sp|P47738|ALDH2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	3-UNIMOD:4	ms_run[1]:scan=1.1.1922.19	18.78532	2	1059.508047	1059.513128	K	G	386	397
PSM	IQEAGTEVVK	797	sp|P08249|MDHM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.1962.20	19.90438	2	1072.572247	1072.576440	R	A	230	240
PSM	STTTGHLIYK	798	sp|P10126|EF1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.1875.20	17.48742	2	1119.588647	1119.592424	K	C	21	31
PSM	KEEEVSNLVK	799	sp|Q99MZ7|PECR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.1954.21	19.67865	2	1173.620647	1173.624118	R	S	83	93
PSM	NIIHGSDSVESAEK	800	sp|Q01768|NDKB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.1961.14	19.8714	3	1484.709071	1484.710701	R	E	115	129
PSM	KPMVLGHEAAGTVTK	801	sp|Q64442|DHSO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.1897.19	18.09885	3	1537.827671	1537.828648	K	V	64	79
PSM	EASTIHQCVETESR	802	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	8-UNIMOD:4	ms_run[1]:scan=1.1.1851.18	16.81403	3	1645.734071	1645.736599	K	E	200	214
PSM	IHEGCEEPATHNALAK	803	sp|Q68FD5|CLH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	5-UNIMOD:4	ms_run[1]:scan=1.1.1804.21	15.49588	3	1775.825471	1775.826082	R	I	866	882
PSM	LGVTADDVK	804	sp|P14152|MDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2108.11	23.93118	2	916.480247	916.486562	K	N	171	180
PSM	KFSGVYLEK	805	sp|P40936|INMT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2128.16	24.49048	2	1069.575247	1069.580797	K	E	211	220
PSM	VEIIANDQGNR	806	sp|P16627|HS71L_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2114.20	24.10405	2	1227.615647	1227.620764	K	T	28	39
PSM	STESLQANVQR	807	sp|P47963|RL13_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.1990.20	20.67758	2	1231.614047	1231.615679	K	L	106	117
PSM	VIGSGCNLDSAR	808	sp|P00342|LDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	6-UNIMOD:4	ms_run[1]:scan=1.1.2101.19	23.74453	2	1247.590047	1247.592835	R	F	158	170
PSM	ERVCNLIDSGTK	809	sp|Q9EQ20|MMSA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	4-UNIMOD:4	ms_run[1]:scan=1.1.2135.12	24.68263	3	1390.681271	1390.687464	K	E	365	377
PSM	TLEEDAHQQIAR	810	sp|Q9DCG6|PBLD1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2057.17	22.53217	2	1409.691447	1409.689906	R	E	29	41
PSM	SVTEQGAELSNEER	811	sp|P63101|1433Z_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2120.21	24.27452	2	1547.711847	1547.706344	K	N	28	42
PSM	VATVPQHATSGPGPADVSK	812	sp|Q8BTM8|FLNA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2057.15	22.52882	3	1817.924771	1817.927176	K	V	2541	2560
PSM	AIDAALAAR	813	sp|Q8CHT0|AL4A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2195.9	26.3788	2	870.485647	870.492316	R	K	104	113
PSM	IVVVTAGVR	814	sp|P16125|LDHB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2310.9	29.54038	2	912.571247	912.575652	K	Q	92	101
PSM	TRPTVAAGAVGLAQR	815	sp|P45952|ACADM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2192.17	26.3013	3	1466.829371	1466.831760	R	A	280	295
PSM	TRPTVAAGAVGLAQR	816	sp|P45952|ACADM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2194.12	26.35332	3	1466.829371	1466.831760	R	A	280	295
PSM	RHVFGESDELIGQK	817	sp|P17751|TPIS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2193.16	26.32865	3	1613.813471	1613.816169	R	V	150	164
PSM	LRVDPVNFK	818	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2361.8	30.94602	2	1086.614247	1086.618579	K	L	92	101
PSM	VETTEDLVAK	819	sp|Q9DCW4|ETFB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2167.15	25.59268	2	1103.567447	1103.571020	K	L	239	249
PSM	GEFITTVQQR	820	sp|P14152|MDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2351.16	30.67823	2	1177.603647	1177.609137	K	G	221	231
PSM	GEFITTVQQR	821	sp|P14152|MDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2358.14	30.8705	2	1177.603647	1177.609137	K	G	221	231
PSM	EAAENSLVAYK	822	sp|P62259|1433E_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2289.11	28.96027	2	1193.590247	1193.592818	K	A	143	154
PSM	LNQDQLDAVSK	823	sp|Q60865|CAPR1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2231.16	27.3753	2	1229.623047	1229.625181	R	Y	86	97
PSM	YSTDVSVDEVK	824	sp|P26443|DHE3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2342.14	30.43307	2	1240.581647	1240.582313	R	A	152	163
PSM	DHGGALGPEEFK	825	sp|P57780|ACTN4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2236.15	27.50813	2	1255.578847	1255.583316	K	A	781	793
PSM	LAQEDPDYGLR	826	sp|P24270|CATA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2357.11	30.84695	2	1275.607647	1275.609531	R	D	253	264
PSM	ELISNSSDALDK	827	sp|P07901|HS90A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2342.16	30.4364	2	1290.627247	1290.630326	R	I	47	59
PSM	VNADEVGGEALGR	828	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2237.19	27.53677	2	1285.628247	1285.626243	K	L	19	32
PSM	GVQVETISPGDGR	829	sp|P26883|FKB1A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	24		ms_run[1]:scan=1.1.2310.17	29.54707	2	1313.6561	1313.6570	M	T	2	15
PSM	AAPAAAAAMAPPGPR	830	sp|Q8BMF4|ODP2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2348.21	30.59985	2	1318.679447	1318.681590	K	V	392	407
PSM	INVYYNEATGGK	831	sp|P68372|TBB4B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2346.12	30.53905	2	1327.639647	1327.640831	R	Y	47	59
PSM	NANCSIEESFQR	832	sp|P38060|HMGCL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	4-UNIMOD:4	ms_run[1]:scan=1.1.2350.21	30.65477	2	1453.621847	1453.625592	K	F	138	150
PSM	KGNIYSLNEGYAK	833	sp|Q9QXD6|F16P1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2205.8	26.65618	3	1455.732971	1455.735794	K	D	206	219
PSM	HSENILYVSSETIKK	834	sp|Q91XE0|GLYAT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2315.17	29.68397	3	1746.913871	1746.915215	K	L	128	143
PSM	HSENILYVSSETIKK	835	sp|Q91XE0|GLYAT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2308.14	29.49032	3	1746.913871	1746.915215	K	L	128	143
PSM	TAPYVVTGSVDQTVK	836	sp|P63005|LIS1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2552.10	36.22507	2	1563.826047	1563.814438	K	V	391	406
PSM	THINIVVIGHVDSGK	837	sp|P10126|EF1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2405.4	32.15343	4	1587.863294	1587.873290	K	S	6	21
PSM	AAVSGLWGK	838	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2453.3	33.47592	2	887.482847	887.486502	K	V	10	19
PSM	AAVSGLWGK	839	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2460.4	33.66482	2	887.482847	887.486502	K	V	10	19
PSM	VGLQVVAVK	840	sp|P63038|CH60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2484.3	34.3158	2	911.575647	911.580403	K	A	293	302
PSM	HVFGESDELIGQK	841	sp|P17751|TPIS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2423.10	32.6573	3	1457.712371	1457.715058	R	V	151	164
PSM	ADPLGLEAEK	842	sp|Q8R0Y6|AL1L1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2442.12	33.18303	2	1041.529847	1041.534240	K	D	39	49
PSM	ATDFVVPGPGK	843	sp|O88844|IDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2499.13	34.74103	2	1086.569047	1086.570960	R	V	141	152
PSM	AADLQIQMTK	844	sp|O35855|BCAT2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2401.14	32.0509	2	1117.573447	1117.580145	K	E	34	44
PSM	LCAATATILDKPEDR	845	sp|O35215|DOPD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	2-UNIMOD:4	ms_run[1]:scan=1.1.2425.14	32.71673	3	1672.844471	1672.845421	R	V	23	38
PSM	VAVVAGYGDVGK	846	sp|P50247|SAHH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2398.14	31.9686	2	1133.604047	1133.608074	K	G	215	227
PSM	VISAEEALPGR	847	sp|Q9D6Y7|MSRA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2427.15	32.77388	2	1140.611247	1140.613888	K	T	28	39
PSM	LGTAAIQGAIEK	848	sp|Q8QZT1|THIL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2479.9	34.18408	2	1170.657847	1170.660838	K	A	64	76
PSM	DGVANVSIEDR	849	sp|P08228|SODC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2392.17	31.80485	2	1173.561047	1173.562580	K	V	93	104
PSM	LLEAAITPQTK	850	sp|Q8VCN5|CGL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2468.10	33.88939	2	1183.679847	1183.681239	K	L	141	152
PSM	ASSIVVSGTPIR	851	sp|P35505|FAAA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2444.14	33.2395	2	1185.668447	1185.671737	R	R	163	175
PSM	TNVSGGAIALGHPLGGSGSR	852	sp|Q8BWT1|THIM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2411.17	32.33088	3	1806.934271	1806.933659	K	I	341	361
PSM	LYEIGAGTSEVR	853	sp|Q9JHI5|IVD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2492.17	34.55187	2	1293.654447	1293.656481	K	R	400	412
PSM	AADKDTCFSTEGPNLVTR	854	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	7-UNIMOD:4	ms_run[1]:scan=1.1.2479.15	34.18908	3	1980.927071	1980.921105	K	C	585	603
PSM	TAVVVGTVTDDVR	855	sp|P35980|RL18_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2523.19	35.4217	2	1330.705447	1330.709245	K	I	79	92
PSM	AATGEEVSAEDLGGADLHCR	856	sp|Q3ULD5|MCCB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	19-UNIMOD:4	ms_run[1]:scan=1.1.2479.17	34.19077	3	2056.920971	2056.911997	K	K	249	269
PSM	ADIVENQVMDTR	857	sp|P10649|GSTM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2489.19	34.46952	2	1389.655047	1389.655829	R	M	97	109
PSM	EHHFEAIALVEK	858	sp|Q8CG76|ARK72_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2412.9	32.35243	3	1421.729771	1421.730314	K	A	275	287
PSM	HAFSPVASVESASGETLHSPK	859	sp|P29699|FETUA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2513.19	35.13708	3	2137.058771	2137.043997	R	V	302	323
PSM	HVFGESDELIGQK	860	sp|P17751|TPIS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2430.6	32.84903	3	1457.712371	1457.715058	R	V	151	164
PSM	GILAADESVGTMGNR	861	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	12-UNIMOD:35	ms_run[1]:scan=1.1.2393.20	31.83597	2	1505.712447	1505.714407	K	L	29	44
PSM	NVIIWGNHSSTQYPDVNHAK	862	sp|P14152|MDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2479.20	34.19327	3	2279.116871	2279.108329	K	V	180	200
PSM	CTTDHISAAGPWLK	863	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	1-UNIMOD:4	ms_run[1]:scan=1.1.2549.10	36.13486	3	1555.744871	1555.745313	K	F	592	606
PSM	RVLVETEGPAGVAVMK	864	sp|P42125|ECI1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2536.11	35.77907	3	1654.902371	1654.907627	K	L	33	49
PSM	KYDTDHSGFIETEELK	865	sp|P12658|CALB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2388.18	31.6934	3	1910.895971	1910.889788	R	N	109	125
PSM	GENLSLVVHGPGDIR	866	sp|Q64442|DHSO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2662.3	39.26875	3	1561.821071	1561.821255	K	L	7	22
PSM	KVNLAELFK	867	sp|P99029|PRDX5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2742.7	41.50968	2	1060.626647	1060.628081	K	G	71	80
PSM	HWPFMVVNDAGRPK	868	sp|P63017|HSP7C_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2620.7	38.10037	3	1652.822471	1652.824566	K	V	89	103
PSM	IGQFQLMQGK	869	sp|Q9JHI5|IVD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2642.11	38.71538	2	1148.600647	1148.601214	K	M	317	327
PSM	FYTDPVEAVK	870	sp|Q9D0K2|SCOT1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2617.6	38.01878	2	1167.576247	1167.581191	K	D	42	52
PSM	HLGLPVFNTVK	871	sp|Q9WUM5|SUCA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2741.14	41.48732	2	1223.700447	1223.702643	K	E	95	106
PSM	GVLFASGQNLAR	872	sp|Q9CPY7|AMPL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2649.15	38.91715	2	1231.665447	1231.667320	K	H	189	201
PSM	IYVVDVGSEPR	873	sp|P17563|SBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	24		ms_run[1]:scan=1.1.2620.12	38.10455	2	1232.6389	1232.6396	R	A	104	115
PSM	KAVLGPLVGAVDQGTSSTR	874	sp|Q64516|GLPK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2651.15	38.97402	3	1855.013171	1855.016326	K	F	6	25
PSM	VFVTGPLPAEGR	875	sp|Q91Z53|GRHPR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2699.14	40.29847	2	1241.676247	1241.676822	K	A	9	21
PSM	QVVDSAYEVIK	876	sp|P06151|LDHA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2618.11	38.05155	2	1249.651647	1249.655418	K	L	233	244
PSM	HLGFQSAVEALR	877	tr|A0A0J9YTU1|A0A0J9YTU1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2700.4	40.31857	3	1326.704171	1326.704434	K	G	198	210
PSM	SGNTPLDMNQFR	878	sp|Q9DC50|OCTC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2699.19	40.30264	2	1378.629647	1378.629948	K	M	149	161
PSM	TGQQAEPLVVDLK	879	sp|P98078|DAB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2725.18	41.04742	2	1396.757047	1396.756195	K	D	151	164
PSM	EACDTSFNVNLR	880	sp|Q91X52|DCXR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	3-UNIMOD:4	ms_run[1]:scan=1.1.2636.18	38.55165	2	1424.636847	1424.635428	K	A	98	110
PSM	MVNSNLASVEELK	881	sp|P35486|ODPA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2707.19	40.53203	2	1432.725447	1432.723180	R	E	324	337
PSM	SSLATMAHAQSLVEAQPNVDK	882	sp|Q60597|ODO1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2701.19	40.3597	3	2196.092171	2196.084482	R	L	102	123
PSM	AGGIETIANEYSDR	883	sp|Q61316|HSP74_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2693.13	40.13427	2	1494.703247	1494.695051	R	C	20	34
PSM	FKLEAPDADELPR	884	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2777.7	42.481	3	1499.759771	1499.762009	K	S	522	535
PSM	SLTNDWEDHLAVK	885	sp|P11499|HS90B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2739.20	41.43573	2	1526.740247	1526.736522	K	H	307	320
PSM	FEPQINAEESEIR	886	sp|Q64516|GLPK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2658.20	39.17323	2	1560.744847	1560.742001	R	Y	493	506
PSM	VAMSHFEPSEYIR	887	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2676.9	39.65655	3	1564.735571	1564.734414	K	Y	32	45
PSM	DTCFSTEGPNLVTR	888	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	3-UNIMOD:4	ms_run[1]:scan=1.1.2769.18	42.26642	2	1595.733047	1595.724971	K	C	589	603
PSM	AKLDNNTELSFFAK	889	sp|O88844|IDHC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2768.10	42.23198	3	1596.811571	1596.814772	R	A	344	358
PSM	GGHVNLTMLGAMQVSK	890	sp|Q9D0K2|SCOT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2769.9	42.2589	3	1641.835571	1641.833082	R	Y	391	407
PSM	TDDYLDQPCCETINR	891	sp|Q61598|GDIB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	9-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.2604.21	37.67472	2	1898.784847	1898.777478	R	I	194	209
PSM	LHTVYQSVELPETHQMLR	892	sp|Q07417|ACADS_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2666.13	39.38813	3	2180.112671	2180.104823	R	Q	25	43
PSM	DVAPQAPVHFLVIPR	893	sp|Q9D0S9|HINT2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3162.3	53.28098	3	1657.934471	1657.930411	R	K	80	95
PSM	VDLFYLHAPDHSTPVEETLR	894	sp|Q8CG76|ARK72_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3034.9	49.67393	4	2338.169294	2338.159361	R	A	143	163
PSM	EIRPALELLEPIEQK	895	sp|Q61598|GDIB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3176.5	53.6676	3	1777.003271	1776.998551	K	F	365	380
PSM	VFEFGGPEVLK	896	sp|P47199|QOR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3073.10	50.77392	2	1220.644247	1220.644125	R	L	13	24
PSM	TFESLVDFCK	897	sp|Q61425|HCDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	9-UNIMOD:4	ms_run[1]:scan=1.1.3100.7	51.53632	2	1244.575847	1244.574725	K	T	193	203
PSM	VHLVGIDIFTGK	898	sp|P63242|IF5A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3092.2	51.30845	3	1297.734371	1297.739423	K	K	56	68
PSM	LAGQIFLGGSIVR	899	sp|P17563|SBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3141.12	52.6868	2	1329.779847	1329.776871	R	G	345	358
PSM	DLGTDSQIFISR	900	sp|Q61598|GDIB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3041.14	49.87665	2	1350.678647	1350.677945	K	A	391	403
PSM	FIDTSQFILNR	901	sp|Q4FZG7|TI8AB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3170.11	53.50493	2	1352.710247	1352.708851	R	L	70	81
PSM	VVDSLQLTGTKPVATPVDWK	902	sp|O08709|PRDX6_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2984.13	48.31075	3	2153.186771	2153.173221	R	K	163	183
PSM	AVQMGMSSVFFNK	903	sp|Q8R0Y6|AL1L1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3090.11	51.25917	2	1444.681847	1444.684292	K	G	691	704
PSM	VDLCATWEAMEK	904	sp|Q91WR5|AK1CL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	4-UNIMOD:4	ms_run[1]:scan=1.1.3177.10	53.7003	2	1451.644847	1451.642487	R	C	142	154
PSM	CMALSTAILVGEAK	905	sp|Q9EQ20|MMSA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	1-UNIMOD:4	ms_run[1]:scan=1.1.3116.12	51.98038	2	1462.755647	1462.752372	R	K	317	331
PSM	GCALQCAILSPAFK	906	sp|P48722|HS74L_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	2-UNIMOD:4,6-UNIMOD:4	ms_run[1]:scan=1.1.3105.16	51.68217	2	1534.771047	1534.763606	R	V	375	389
PSM	DLGATWVVLGHSER	907	sp|P17751|TPIS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3017.2	49.2087	3	1538.783771	1538.784141	K	R	136	150
PSM	GFGFVDFNSEEDAK	908	sp|P09405|NUCL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3142.13	52.71638	2	1560.678647	1560.673253	K	A	608	622
PSM	TFLLDGDEVIITGHCQGDGYR	909	sp|P35505|FAAA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	15-UNIMOD:4	ms_run[1]:scan=1.1.3167.18	53.42813	3	2365.112771	2365.100860	R	V	382	403
PSM	RAFPAWADTSILSR	910	sp|Q9EQ20|MMSA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3010.6	49.02235	3	1589.829971	1589.831425	K	Q	88	102
PSM	FLHDPSATQGFVGCALSSNIQR	911	sp|P17563|SBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	14-UNIMOD:4	ms_run[1]:scan=1.1.2991.19	48.50422	3	2404.167671	2404.159378	R	F	255	277
PSM	WGLGGTCVNVGCIPK	912	sp|Q9JLT4|TRXR2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	7-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.3090.18	51.26502	2	1616.791447	1616.780318	K	K	80	95
PSM	STEPCAHLLVSSIGVVGTAEQNR	913	sp|O35215|DOPD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	5-UNIMOD:4	ms_run[1]:scan=1.1.3008.19	48.97742	3	2424.222671	2424.206723	K	T	53	76
PSM	SQQEGGILPLLDSPAK	914	sp|Q6ZQM8|UD17C_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3162.9	53.29433	2	1651.886047	1651.878101	K	G	100	116
PSM	DVAPQAPVHFLVIPR	915	sp|Q9D0S9|HINT2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3169.3	53.47068	3	1657.934471	1657.930411	R	K	80	95
PSM	MGAVFMDAPVSGGVGAAR	916	sp|Q99L13|3HIDH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2993.11	48.55825	2	1691.816647	1691.812346	K	S	149	167
PSM	VGDAIPSVEVFEGEPGK	917	sp|P99029|PRDX5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3137.21	52.57962	2	1728.867447	1728.857031	K	K	54	71
PSM	GQNILDGGAPFYTTYK	918	sp|O09174|AMACR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3127.18	52.29472	2	1743.854647	1743.846801	R	T	208	224
PSM	ETTDTDTADQVIASFK	919	sp|P57780|ACTN4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3091.19	51.29422	2	1740.817647	1740.805390	R	V	839	855
PSM	RTGAIVDVPVGEELLGR	920	sp|Q03265|ATPA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3048.11	50.07483	3	1779.984971	1779.984297	K	V	133	150
PSM	LSLDGQNIYNACCTLR	921	sp|P17225|PTBP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	12-UNIMOD:4,13-UNIMOD:4	ms_run[1]:scan=1.1.2994.13	48.58522	2	1896.886047	1896.882217	K	I	238	254
PSM	GIVDQSQQAYQEAFEISKK	922	sp|P63101|1433Z_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3027.9	49.49014	3	2168.087471	2168.074963	K	E	140	159
PSM	AAVPSGASTGIYEALELRDNDK	923	sp|P17182|ENOA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3008.17	48.97575	3	2276.139971	2276.128455	R	T	33	55
PSM	SCTLTFLGSTATPDDPYEVKR	924	sp|Q91XE4|ACY3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	2-UNIMOD:4	ms_run[1]:scan=1.1.2992.11	48.53123	3	2357.132471	2357.120927	R	A	72	93
PSM	IGPVEVENALAEHPAVAESAVVSSPDK	925	sp|Q91VA0|ACSM1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3115.21	51.96058	3	2714.398571	2714.376290	R	D	475	502
PSM	LLSHCLLVTLASHHPADFTPAVHASLDK	926	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	5-UNIMOD:4	ms_run[1]:scan=1.1.3037.10	49.75905	5	3049.608618	3049.580761	K	F	101	129
PSM	DLEDLQILIK	927	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3549.4	64.10976	2	1198.683847	1198.680905	K	V	578	588
PSM	TDLALILSAGDN	928	sp|P12658|CALB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3597.4	65.45457	2	1201.620647	1201.619033	R	-	250	262
PSM	LLIQSEFPSLLK	929	sp|P97816|S100G_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3465.6	61.73478	2	1386.818247	1386.812253	K	A	34	46
PSM	DVQFAVQQVLQEEHFDAR	930	sp|Q8R146|APEH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3444.4	61.157	3	2158.048571	2158.044332	K	R	562	580
PSM	GSFVLLDGETFEVK	931	sp|P17563|SBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3419.14	60.48233	2	1539.790047	1539.782075	K	G	161	175
PSM	DTSYLFITGPEVVK	932	sp|Q99MN9|PCCB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3427.6	60.7032	2	1567.821047	1567.813375	K	S	221	235
PSM	FYAYNPLAGGLLTGK	933	sp|Q8CG76|ARK72_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3440.9	61.04975	2	1583.839647	1583.834780	R	Y	230	245
PSM	LLGQFTLIGIPPAPR	934	sp|P38647|GRP75_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3606.12	65.71907	2	1591.952047	1591.944999	K	G	499	514
PSM	TCGFDFSGALEDISK	935	sp|P05202|AATM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	2-UNIMOD:4	ms_run[1]:scan=1.1.3461.10	61.63367	2	1645.740247	1645.729388	K	I	186	201
PSM	AGVPPGVINIVFGTGPR	936	sp|Q8BH00|AL8A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3574.15	64.82957	2	1649.935847	1649.925326	K	V	197	214
PSM	DIPSDAFTGLDPLGDK	937	sp|P98078|DAB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3530.18	63.57302	2	1659.808447	1659.799182	K	E	629	645
PSM	ALTVPELTQQMFDAK	938	sp|P68372|TBB4B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3433.8	60.86745	2	1690.871647	1690.860008	R	N	283	298
PSM	ALTVPELTQQMFDAK	939	sp|P68372|TBB4B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3447.15	61.24342	2	1690.871647	1690.860008	R	N	283	298
PSM	LFIGGLSFETTEESLR	940	sp|O88569|ROA2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3535.18	63.71672	2	1797.926047	1797.914880	K	N	23	39
PSM	YVWLVYEQEQPLSCDEPILSNK	941	sp|P70296|PEBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	14-UNIMOD:4	ms_run[1]:scan=1.1.3614.10	65.95188	3	2709.322871	2709.299620	R	S	120	142
PSM	AAVASLLQSVQVPEFTPK	942	sp|Q02053|UBA1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3573.20	64.80545	2	1884.049247	1884.035664	R	S	785	803
PSM	SVSAFAPICNPVLCSWGK	943	sp|Q9R0P3|ESTD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	9-UNIMOD:4,14-UNIMOD:4	ms_run[1]:scan=1.1.3508.9	62.95603	2	1991.978447	1991.959739	R	K	168	186
PSM	LFLYEPAGTETFSVESISK	944	sp|Q91XE4|ACY3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3519.6	63.2464	3	2117.071271	2117.056853	R	N	153	172
PSM	DPQNCQEFLESSEVINWK	945	sp|Q91XE0|GLYAT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	5-UNIMOD:4	ms_run[1]:scan=1.1.3412.13	60.27873	3	2222.008271	2221.994998	K	Q	82	100
PSM	GLTDNFADVQVSVVDCPDLTK	946	sp|Q91V76|CK054_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	16-UNIMOD:4	ms_run[1]:scan=1.1.3463.7	61.6861	3	2292.112571	2292.094378	K	E	23	44
PSM	DQSPASHEIATNLGDFAISLYR	947	sp|P07758|A1AT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3581.11	65.02229	3	2404.186871	2404.165903	K	E	36	58
PSM	LLEVSDDPQVLAVAAHDVGEYVR	948	sp|Q8BVE3|VATH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3616.9	66.00468	3	2494.291871	2494.270368	K	H	397	420
PSM	VNPSRLPVVIGGLLDVDCSEDVIK	949	sp|Q68FD5|CLH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	18-UNIMOD:4	ms_run[1]:scan=1.1.3597.16	65.46875	3	2593.400471	2593.378539	K	N	807	831
PSM	ADFAQACQDAGVR	950	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	7-UNIMOD:4	ms_run[1]:scan=1.1.2302.19	29.32573	2	1407.622247	1407.620112	R	F	125	138
PSM	VGGTSDVEVNEK	951	sp|P63038|CH60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.1908.20	18.4006	2	1232.585847	1232.588461	K	K	406	418
PSM	ASSVLLHTGQK	952	sp|Q9JII6|AK1A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:1	ms_run[1]:scan=1.1.2459.11	33.64542	2	1181.6367	1181.6399	T	M	3	14
PSM	AAVVLENGVLSR	953	sp|P16331|PH4H_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:1	ms_run[1]:scan=1.1.3547.5	64.05331	2	1268.7113	1268.7083	M	K	2	14
PSM	VALLSGGGSGHEPAHAGFIGK	954	sp|Q8VC30|TKFC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2374.19	31.30587	3	1962.015071	1961.011909	R	G	49	70
PSM	QHLQIQSSQSDLGK	955	sp|Q9DCY0|KEG1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:28	ms_run[1]:scan=1.1.2424.21	32.69453	2	1550.7716	1550.7684	K	V	99	113
PSM	IGGHGAEYGAEALER	956	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2233.8	27.41997	3	1528.720571	1528.727020	K	M	18	33
PSM	VADALANAAGHLDDLPGALSALSDLHAHK	957	tr|Q91VB8|Q91VB8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3504.5	62.83637	4	2863.470094	2862.462420	K	L	63	92
PSM	FLASVSTVLTSK	958	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.2985.5	48.33452	2	1252.710047	1251.707454	K	Y	129	141
PSM	ASGVQVADEVCR	959	sp|Q9R0P5|DEST_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:1,11-UNIMOD:4	ms_run[1]:scan=1.1.2734.15	41.29273	2	1331.6113	1331.6134	M	I	2	14
PSM	TPILLGSLAHQIYR	960	sp|Q99L13|3HIDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3074.3	50.79638	3	1580.904371	1580.903862	K	M	297	311
PSM	TQGPYDVVVLPGGNLGAQNLSESPMVK	961	sp|Q99LX0|PARK7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.3472.20	61.93808	3	2769.427871	2769.400731	K	E	63	90
PSM	GFGHIGIAVPDVYSACK	962	sp|Q9CPU0|LGUL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	16-UNIMOD:4	ms_run[1]:scan=1.1.3006.7	48.91163	3	1789.882871	1789.882141	R	R	124	141
PSM	YMCENQATISSK	963	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24	2-UNIMOD:35,3-UNIMOD:4	ms_run[1]:scan=1.1.1905.20	18.31873	2	1447.606047	1446.611916	K	L	287	299
PSM	TPVSEHVTK	964	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.1672.19	11.82653	2	996.518247	996.524010	K	C	491	500
PSM	TPVSEHVTK	965	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.1665.20	11.63585	2	996.518247	996.524010	K	C	491	500
PSM	ILATGGASHNK	966	sp|Q3TNA1|XYLB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.1636.19	10.83282	2	1067.568647	1067.572357	K	D	451	462
PSM	ACHQLHQEGK	967	sp|Q8CG76|ARK72_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	2-UNIMOD:4	ms_run[1]:scan=1.1.1565.20	8.870334	2	1206.552047	1206.556390	R	F	163	173
PSM	TGVIEHEHPVNK	968	sp|P98078|DAB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.1683.21	12.13482	2	1358.691447	1358.694263	K	I	109	121
PSM	QEYDESGPSIVHRK	969	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.1924.9	18.83268	4	1643.786494	1643.790349	K	C	360	374
PSM	KATQEAFMK	970	sp|Q91Y97|ALDOB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.1778.17	14.7658	2	1052.528647	1052.532466	K	R	322	331
PSM	CCSGSLVER	971	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	1-UNIMOD:4,2-UNIMOD:4	ms_run[1]:scan=1.1.1858.16	17.0063	2	1066.449647	1066.453564	K	R	500	509
PSM	LTQDQDVDVK	972	sp|Q76MZ3|2AAA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.1940.21	19.29008	2	1159.569247	1159.572082	K	Y	567	577
PSM	RSAGVDDQENWHEGK	973	sp|Q9CPY7|AMPL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.1818.19	15.88828	3	1726.761371	1726.765925	K	E	104	119
PSM	AAGAQVVAVSR	974	sp|Q91X52|DCXR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2008.17	21.18265	2	1027.571847	1027.577443	K	T	29	40
PSM	KVFIEDVSK	975	sp|P16460|ASSY_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2105.17	23.85382	2	1063.584847	1063.591361	K	E	58	67
PSM	KVINDFVEK	976	sp|P07758|A1AT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2070.18	22.88983	2	1090.597847	1090.602260	K	G	173	182
PSM	KLTEIINTQHENVK	977	sp|P13707|GPDA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2060.20	22.61373	3	1665.903671	1665.904984	R	Y	49	63
PSM	REDIFYTSK	978	sp|P70694|DHB5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2103.15	23.79673	2	1157.569047	1157.571688	K	V	76	85
PSM	SPQYSQVIHR	979	sp|P17563|SBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2026.9	21.67253	3	1213.614971	1213.620370	K	L	53	63
PSM	SPQYSQVIHR	980	sp|P17563|SBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2019.19	21.48842	2	1213.616847	1213.620370	K	L	53	63
PSM	LNQVLEEEQK	981	sp|Q8K1Z0|COQ9_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2093.18	23.52573	2	1228.625847	1228.629932	R	L	152	162
PSM	VIGSGCNLDSAR	982	sp|P00342|LDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	6-UNIMOD:4	ms_run[1]:scan=1.1.2088.20	23.38887	2	1247.590047	1247.592835	R	F	158	170
PSM	ALQTTYGTNAPR	983	sp|Q8CG76|ARK72_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2098.21	23.66373	2	1291.648247	1291.652064	K	M	287	299
PSM	MDSTANEVEAVK	984	sp|P09103|PDIA1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2144.19	24.94477	2	1292.584047	1292.591832	K	V	427	439
PSM	NSNPALNDNLEK	985	sp|Q9Z1Q5|CLIC1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2126.21	24.44028	2	1327.635247	1327.636808	K	G	120	132
PSM	HELQANCYEEVK	986	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	7-UNIMOD:4	ms_run[1]:scan=1.1.2029.21	21.76615	2	1518.674247	1518.677293	K	D	133	145
PSM	AVTEQGAELSNEER	987	sp|P68254|1433T_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2080.21	23.16752	2	1531.709847	1531.711430	K	N	28	42
PSM	QHLQIQSSQSDLGK	988	sp|Q9DCY0|KEG1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2037.17	21.983	3	1567.791971	1567.795434	K	V	99	113
PSM	STAGDTHLGGEDFDNR	989	sp|P17156|HSP72_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2153.18	25.1994	3	1690.718171	1690.718306	K	M	224	240
PSM	TGQAAGFSYTDANK	990	sp|P62897|CYC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2205.20	26.66703	2	1429.646047	1429.647373	K	N	41	55
PSM	AEEAGIGDTPNQEDQAAGHVTQAR	991	tr|B1AQW2|B1AQW2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2234.12	27.45772	3	2464.133471	2464.121472	K	V	34	58
PSM	LTDIHGNALQYNK	992	sp|Q9Z0S1|BPNT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2187.13	26.15528	3	1485.756371	1485.757592	K	E	262	275
PSM	ASGELMTVAR	993	sp|P97494|GSH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2214.8	26.89918	2	1033.514847	1033.522630	R	W	566	576
PSM	AYDATCLVK	994	sp|Q9R0P3|ESTD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	6-UNIMOD:4	ms_run[1]:scan=1.1.2361.7	30.94435	2	1039.494847	1039.500832	K	A	201	210
PSM	RHVFGESDELIGQK	995	sp|P17751|TPIS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2201.16	26.55367	3	1613.813471	1613.816169	R	V	150	164
PSM	LRVDPVNFK	996	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2364.2	31.01907	3	1086.612071	1086.618579	K	L	92	101
PSM	LRVDPVNFK	997	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2357.2	30.83192	3	1086.612071	1086.618579	K	L	92	101
PSM	LRVDPVNFK	998	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2355.3	30.77775	3	1086.612071	1086.618579	K	L	92	101
PSM	LHVDPENFR	999	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2289.9	28.9586	2	1125.554447	1125.556707	K	L	97	106
PSM	GYSFTTTAER	1000	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2259.16	28.13828	2	1131.517647	1131.519653	R	E	197	207
PSM	ILQEAGADISK	1001	sp|Q60866|PTER_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2205.18	26.66453	2	1143.608247	1143.613553	R	T	215	226
PSM	YLAEVAAGDDK	1002	sp|P63101|1433Z_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2195.19	26.38713	2	1150.547047	1150.550619	R	K	128	139
PSM	GDDVINASGYR	1003	sp|Q91VA0|ACSM1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2276.16	28.6073	2	1165.536047	1165.536366	R	I	464	475
PSM	VYIGGEDYEK	1004	sp|P40936|INMT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2301.16	29.2949	2	1171.539447	1171.539720	K	E	5	15
PSM	EITALAPSTMK	1005	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	10-UNIMOD:35	ms_run[1]:scan=1.1.2252.17	27.94797	2	1176.604447	1176.606025	K	I	316	327
PSM	QHGIPIPVTPK	1006	sp|P16460|ASSY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2314.18	29.65723	2	1185.684447	1185.686993	K	S	166	177
PSM	HIYFITGETK	1007	sp|P07901|HS90A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2346.11	30.53738	2	1207.620647	1207.623724	K	D	491	501
PSM	EELGAQQPDLK	1008	sp|Q64105|SPRE_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2222.20	27.12827	2	1226.610047	1226.614282	K	V	53	64
PSM	DRVTDALNATR	1009	sp|P63038|CH60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2306.16	29.43672	2	1230.628247	1230.631663	K	A	419	430
PSM	TEGGYYQITGR	1010	sp|Q99NB1|ACS2L_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2323.19	29.90947	2	1243.581647	1243.583316	R	M	531	542
PSM	ASDETGFIAVHK	1011	sp|P34914|HYES_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2193.21	26.33283	2	1273.626247	1273.630266	R	A	409	421
PSM	ICNQVLVCER	1012	sp|Q9Z2I9|SUCB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	2-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.2279.18	28.69288	2	1289.620247	1289.622027	R	K	151	161
PSM	VPGAWTEACGQK	1013	sp|Q8R0Y6|AL1L1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	9-UNIMOD:4	ms_run[1]:scan=1.1.2250.20	27.8946	2	1302.600647	1302.602671	K	L	230	242
PSM	GLSEDTTEETLK	1014	sp|P09405|NUCL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2236.16	27.5098	2	1321.623047	1321.624906	K	E	575	587
PSM	LVNADGEAVYCK	1015	sp|P24270|CATA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	11-UNIMOD:4	ms_run[1]:scan=1.1.2212.17	26.85197	2	1337.628247	1337.628552	K	F	222	234
PSM	ASFSQGPINSANR	1016	sp|P97823|LYPA1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2168.20	25.6252	2	1347.652447	1347.653127	R	D	150	163
PSM	ASFSQGPINSANR	1017	sp|P97823|LYPA1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2168.21	25.62603	2	1347.652447	1347.653127	R	D	150	163
PSM	INVYYNEAAGNK	1018	sp|Q7TMM9|TBB2A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2295.20	29.13025	2	1354.652247	1354.651730	R	Y	47	59
PSM	GAAQNIIPASTGAAK	1019	tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2296.19	29.15692	2	1368.736047	1368.736128	R	A	199	214
PSM	AVPREELFVTSK	1020	sp|Q9JII6|AK1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2354.9	30.75533	3	1374.746171	1374.750716	K	L	69	81
PSM	CLHSVGCPLPLK	1021	sp|Q9Z2V4|PCKGC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	1-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=1.1.2360.4	30.91583	3	1379.701271	1379.705363	K	K	192	204
PSM	RFDDAVVQSDMK	1022	sp|P63017|HSP7C_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2270.21	28.44575	2	1409.658247	1409.660914	R	H	77	89
PSM	TEQGPQVDETQFK	1023	sp|P47738|ALDH2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2298.20	29.21335	2	1505.700047	1505.699802	R	K	358	371
PSM	IAQLEEQLDNETK	1024	sp|Q8VDD5|MYH9_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2541.21	35.92797	2	1529.768847	1529.757317	K	E	1816	1829
PSM	VGAFTVVCK	1025	sp|P05202|AATM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	8-UNIMOD:4	ms_run[1]:scan=1.1.2378.9	31.40693	2	979.513247	979.516088	R	D	288	297
PSM	LLDAAGANLR	1026	sp|Q91Z53|GRHPR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2397.12	31.93965	2	1012.562447	1012.566543	K	V	67	77
PSM	DGLTDVYNK	1027	sp|Q8QZT1|THIL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2385.11	31.6039	2	1023.484247	1023.487290	K	I	179	188
PSM	IGGIGTVPVGR	1028	sp|P10126|EF1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2484.10	34.32163	2	1024.598447	1024.602929	K	V	256	267
PSM	TIAQDYGVLK	1029	sp|P35700|PRDX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2547.8	36.08347	2	1106.594647	1106.597175	R	A	111	121
PSM	VVDALGNAIDGK	1030	sp|Q03265|ATPA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2531.17	35.6459	2	1170.617247	1170.624452	R	G	150	162
PSM	AAATTVQEYLK	1031	sp|Q62468|VILI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2521.14	35.36142	2	1193.624647	1193.629203	K	T	673	684
PSM	AVFPSIVGRPR	1032	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2492.2	34.53935	3	1197.693071	1197.698226	R	H	29	40
PSM	AVFPSIVGRPR	1033	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2499.2	34.73185	3	1197.693071	1197.698226	R	H	29	40
PSM	LEAPDADELPR	1034	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2575.11	36.85825	2	1224.599847	1224.598632	K	S	524	535
PSM	VGGVQSLGGTGALR	1035	sp|P05201|AATC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2445.17	33.26965	2	1270.697247	1270.699349	R	I	101	115
PSM	LMIEMDGTENK	1036	sp|P17182|ENOA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2567.14	36.63507	2	1279.577247	1279.578824	K	S	93	104
PSM	ASLQELDLSSNK	1037	sp|Q91VI7|RINI_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2575.13	36.85992	2	1303.660847	1303.661960	K	L	222	234
PSM	LGGNYGPTVAVQR	1038	sp|O35855|BCAT2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2403.19	32.11027	2	1330.694847	1330.699349	K	E	231	244
PSM	TFIAIKPDGVQR	1039	sp|P15532|NDKA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2427.4	32.7647	3	1343.753171	1343.756135	R	G	7	19
PSM	TFIAIKPDGVQR	1040	sp|P15532|NDKA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2421.5	32.59722	3	1343.753171	1343.756135	R	G	7	19
PSM	LFIVGSNSSSSTR	1041	sp|O09172|GSH0_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2454.14	33.51443	2	1353.687447	1353.688844	K	S	95	108
PSM	EVDEQMLNVQNK	1042	sp|P68372|TBB4B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2440.20	33.13495	2	1445.683047	1445.682044	K	N	325	337
PSM	GTFASLSELHCDK	1043	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	11-UNIMOD:4	ms_run[1]:scan=1.1.2480.6	34.20882	3	1463.672771	1463.671479	K	L	84	97
PSM	AQGSVALSVTQDPAR	1044	sp|Q78JT3|3HAO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2406.20	32.19475	2	1498.777047	1498.773970	R	K	267	282
PSM	FSSQEAASSFGDDR	1045	sp|Q91ZA3|PCCA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2379.21	31.44447	2	1502.629047	1502.627366	R	L	240	254
PSM	VHACGVNPVETYIR	1046	sp|P47199|QOR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	4-UNIMOD:4	ms_run[1]:scan=1.1.2489.18	34.46869	3	1613.793971	1613.798411	K	S	42	56
PSM	WLQTEVQNPSVTSK	1047	sp|P34914|HYES_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2561.20	36.47222	2	1615.821447	1615.820586	K	I	540	554
PSM	LIASVADDEAAVPNNK	1048	sp|P16125|LDHB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2515.21	35.19618	2	1625.827247	1625.826065	K	I	8	24
PSM	VLPMNTGVEAGETACK	1049	sp|P29758|OAT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	15-UNIMOD:4	ms_run[1]:scan=1.1.2471.18	33.97346	2	1675.799047	1675.790943	K	L	136	152
PSM	LDHHPEWFNVYNK	1050	sp|P61458|PHS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2543.12	35.97465	3	1697.794571	1697.795040	K	V	60	73
PSM	YISGFGNECASEDPR	1051	sp|O09173|HGD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	9-UNIMOD:4	ms_run[1]:scan=1.1.2463.21	33.76015	2	1700.723047	1700.710050	K	C	6	21
PSM	IQGGSVVEMQGDEMTR	1052	sp|O88844|IDHC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2548.21	36.11707	2	1735.793247	1735.786920	K	I	5	21
PSM	YPNAELAWCQEEHK	1053	sp|Q60597|ODO1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	9-UNIMOD:4	ms_run[1]:scan=1.1.2523.16	35.4192	3	1773.777971	1773.778070	K	N	948	962
PSM	SLNPELGTDADKEQWK	1054	sp|P06151|LDHA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2496.12	34.65795	3	1829.879771	1829.879558	K	E	213	229
PSM	TEAITQDNGGSHFSWAK	1055	sp|Q7TNG8|LDHD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2435.17	32.99385	3	1847.845871	1847.843841	R	E	319	336
PSM	PVSAIKPTAAPPLAEAGAAK	1056	sp|Q9D2G2|ODO2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2453.12	33.48427	3	1859.055671	1859.051649	K	G	199	219
PSM	PVSAIKPTAAPPLAEAGAAK	1057	sp|Q9D2G2|ODO2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2460.14	33.67733	3	1859.055671	1859.051649	K	G	199	219
PSM	RHPDYSVSLLLR	1058	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2585.5	37.13113	3	1454.797271	1454.799397	R	L	361	373
PSM	VPGATMLLAK	1059	sp|Q9EQ20|MMSA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2633.7	38.45898	2	999.576847	999.578688	R	L	214	224
PSM	LIQFHFHWGSSDGQGSEHTVNK	1060	sp|P00920|CAH2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2621.2	38.12555	5	2510.183118	2510.172720	R	K	90	112
PSM	NLGSVDFPR	1061	sp|Q91XE4|ACY3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2604.9	37.6647	2	1003.505447	1003.508694	R	T	224	233
PSM	MFASFPTTK	1062	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2613.8	37.91257	2	1028.498047	1028.500103	R	T	33	42
PSM	RIPQSTLSEFYPR	1063	sp|P62814|VATB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2709.8	40.57993	3	1592.833571	1592.831091	K	D	494	507
PSM	NPGAPFQIIR	1064	sp|Q60866|PTER_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2774.6	42.39682	2	1111.610847	1111.613828	R	I	205	215
PSM	TVVTEAGNLLK	1065	sp|Q61207|SAP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2701.10	40.3522	2	1143.650647	1143.649939	K	D	68	79
PSM	ISFTGSVPTGVK	1066	sp|Q9JLJ2|AL9A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2667.6	39.40854	2	1191.645447	1191.649939	K	I	228	240
PSM	QDAQSLLVPVK	1067	sp|Q99K67|AASS_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2697.13	40.24123	2	1196.671647	1196.676488	R	S	323	334
PSM	HLGLPVFNTVK	1068	sp|Q9WUM5|SUCA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2748.10	41.6786	2	1223.700447	1223.702643	K	E	95	106
PSM	RPDPIDWSLK	1069	sp|Q9D964|GATM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2631.16	38.41055	2	1225.643647	1225.645522	R	Y	143	153
PSM	VFVTGPLPAEGR	1070	sp|Q91Z53|GRHPR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2705.12	40.46885	2	1241.676247	1241.676822	K	A	9	21
PSM	MNPQSAFFQGK	1071	sp|P32020|NLTP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2598.14	37.50426	2	1253.583447	1253.586293	K	L	512	523
PSM	MVVDSAYEVIK	1072	sp|P16125|LDHB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	1-UNIMOD:35	ms_run[1]:scan=1.1.2607.16	37.7528	2	1268.633247	1268.632240	K	L	234	245
PSM	LGGEVSCLVAGTK	1073	sp|Q99LC5|ETFA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	7-UNIMOD:4	ms_run[1]:scan=1.1.2595.14	37.42083	2	1289.664647	1289.664937	R	C	47	60
PSM	FNVWDTAGQEK	1074	sp|P62827|RAN_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2694.15	40.1598	2	1293.600647	1293.598966	K	F	61	72
PSM	YVDIAIPCNNK	1075	sp|P14206|RSSA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	8-UNIMOD:4	ms_run[1]:scan=1.1.2616.7	37.99771	2	1305.641647	1305.638722	R	G	156	167
PSM	HTTIFEVLPEK	1076	sp|Q921I1|TRFE_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2683.17	39.86272	2	1312.702247	1312.702703	K	A	226	237
PSM	YALYDATYETK	1077	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2602.18	37.61715	2	1336.616847	1336.618698	R	E	82	93
PSM	ASDTSITWNNLK	1078	sp|Q921I1|TRFE_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2673.19	39.58042	2	1348.656047	1348.662294	K	G	456	468
PSM	LSQALGNITVVQK	1079	sp|Q9CZ42|NNRD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2651.18	38.97652	2	1369.789447	1369.792915	K	G	230	243
PSM	CGPGYSTPLEAMK	1080	sp|P17563|SBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	1-UNIMOD:4	ms_run[1]:scan=1.1.2638.15	38.6051	2	1409.633447	1409.631923	K	G	8	21
PSM	IVLDNSVFSEHR	1081	sp|Q68FD5|CLH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2634.6	38.48608	3	1414.719071	1414.720478	K	N	1011	1023
PSM	ETTIQGLDGLSER	1082	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2740.20	41.46405	2	1417.707647	1417.704888	K	C	122	135
PSM	AYTEEDLDLVEK	1083	sp|Q922D8|C1TC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2748.16	41.6836	2	1423.676247	1423.671856	K	G	722	734
PSM	IIAINVNDPEAEK	1084	sp|Q91VM9|IPYR2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2669.16	39.46729	2	1424.752447	1424.751109	K	F	199	212
PSM	TVFGELPSGGGTVEK	1085	sp|Q8K157|GALM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2698.15	40.27097	2	1476.747447	1476.746024	R	F	7	22
PSM	TTPSYVAFTDTER	1086	sp|P16627|HS71L_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2665.11	39.35787	2	1486.694247	1486.693989	R	L	39	52
PSM	EAVAVAPPPSPSLPAK	1087	sp|A2ARV4|LRP2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2681.18	39.80688	2	1529.850647	1529.845344	K	A	4615	4631
PSM	EIYGQTETGLICR	1088	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	12-UNIMOD:4	ms_run[1]:scan=1.1.2675.20	39.63735	2	1538.740847	1538.739893	R	V	360	373
PSM	MLLEYTDSSYDEK	1089	sp|P10649|GSTM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2775.21	42.43717	2	1592.696447	1592.691605	R	R	19	32
PSM	LIGPNCPGVINPGECK	1090	sp|Q9WUM5|SUCA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	6-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=1.1.2662.10	39.2821	2	1723.845047	1723.838562	R	I	167	183
PSM	QFSYTHICAGASAFGK	1091	sp|Q99LC5|ETFA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	8-UNIMOD:4	ms_run[1]:scan=1.1.2641.20	38.69453	2	1743.813447	1743.803890	K	N	102	118
PSM	VGLIGSCTNSSYEDMGR	1092	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	7-UNIMOD:4	ms_run[1]:scan=1.1.2737.21	41.3803	2	1844.811647	1844.803298	R	S	379	396
PSM	VASSVPVENFTIHGGLSR	1093	sp|Q60597|ODO1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2767.16	42.20915	3	1868.976071	1868.974461	K	I	620	638
PSM	IAQNFGLQHLSSGHLLR	1094	sp|Q9WUR9|KAD4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2669.14	39.4656	3	1890.023171	1890.022414	R	E	25	42
PSM	SGYQQAASEHGLVVIAPDTSPR	1095	sp|Q9R0P3|ESTD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2687.15	39.97042	3	2282.140871	2282.129124	K	G	65	87
PSM	NHYQAEVFSVNFAESEEAKK	1096	sp|P07758|A1AT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2638.19	38.60843	3	2326.096871	2326.086590	K	V	154	174
PSM	LGEYGFQNAILVR	1097	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3158.3	53.1703	3	1478.793071	1478.788164	K	Y	422	435
PSM	INEAFDLLR	1098	sp|P00329|ADH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3041.5	49.86913	2	1089.580847	1089.581859	K	S	356	365
PSM	GAGAFGYFEVTHDITR	1099	sp|P24270|CATA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2998.8	48.68583	3	1739.825171	1739.826734	K	Y	78	94
PSM	ALSFLSPSLSR	1100	sp|Q64462|CP4B1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	23		ms_run[1]:scan=1.1.3039.6	49.81267	2	1176.6489	1176.6497	M	L	2	13
PSM	RTGAIVDVPVGEELLGR	1101	sp|Q03265|ATPA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3042.6	49.89867	3	1779.984971	1779.984297	K	V	133	150
PSM	VTSLVVDIVPR	1102	sp|Q8R146|APEH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3069.6	50.65597	2	1196.712647	1196.712873	K	Q	340	351
PSM	RFDEILEASDGIMVAR	1103	sp|P52480|KPYM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3191.6	54.0845	3	1820.917571	1820.909084	R	G	279	295
PSM	YGIDEYLEVK	1104	sp|Q8BWF0|SSDH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3032.6	49.61603	2	1227.601447	1227.602320	K	Y	507	517
PSM	FSVDVFEETR	1105	sp|O09173|HGD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3046.11	50.01735	2	1227.577247	1227.577168	R	G	188	198
PSM	TDIANLAEEFK	1106	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3135.8	52.51225	2	1249.620447	1249.619033	R	D	313	324
PSM	FLASVSTVLTSK	1107	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3016.3	49.18523	2	1251.707847	1251.707454	K	Y	129	141
PSM	SGAMSQALNFIK	1108	sp|Q62468|VILI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3016.4	49.18773	2	1265.639847	1265.643808	R	A	309	321
PSM	FPVGAALLTGDGR	1109	sp|P56389|CDD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3066.9	50.57205	2	1272.682247	1272.682636	R	I	36	49
PSM	TVTNAVVTVPAYFNDSQR	1110	sp|P63017|HSP7C_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3077.11	50.88745	3	1981.000571	1980.990505	K	Q	138	156
PSM	QVEAELLPCLR	1111	sp|Q8CG76|ARK72_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	9-UNIMOD:4	ms_run[1]:scan=1.1.3006.13	48.91663	2	1326.697447	1326.696572	R	H	214	225
PSM	DPEGYFHFIGR	1112	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3014.2	49.12822	3	1336.617071	1336.620036	K	S	452	463
PSM	DLQILAEFHEK	1113	sp|P07759|SPA3K_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3027.7	49.48595	2	1341.693847	1341.692866	K	T	145	156
PSM	DTLYFMDDAEK	1114	sp|O35488|S27A2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3013.5	49.10629	2	1346.572047	1346.570034	K	T	590	601
PSM	ETTDDPVEYVLK	1115	sp|Q5U5V2|HYKK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2987.7	48.39322	2	1407.676047	1407.676942	K	I	57	69
PSM	PKPHSEAGTAFIQTQQLHAAMADTFLEHMCR	1116	sp|P52480|KPYM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	23	30-UNIMOD:4	ms_run[1]:scan=1.1.3050.12	50.13303	5	3522.6882	3522.6592	M	L	2	33
PSM	RPWLVDYGESGEQVAGFVK	1117	sp|P16675|PPGB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3147.14	52.86085	3	2136.063371	2136.064004	R	E	418	437
PSM	SCWDEPLSIAVR	1118	sp|O55137|ACOT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	2-UNIMOD:4	ms_run[1]:scan=1.1.3165.8	53.36934	2	1431.688047	1431.681650	R	G	13	25
PSM	PFVELETNLPASR	1119	sp|O35215|DOPD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	23		ms_run[1]:scan=1.1.2984.14	48.31158	2	1471.7690	1471.7666	M	I	2	15
PSM	VLGPLIGVQVPQEK	1120	sp|Q61133|GSTT2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3090.13	51.26083	2	1475.874447	1475.871165	K	V	118	132
PSM	ITSEALLVTQQLVK	1121	sp|Q6ZQ38|CAND1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3183.16	53.87275	2	1541.904847	1541.902859	K	V	535	549
PSM	ALDIAENEMPGLMR	1122	sp|P50247|SAHH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3175.16	53.64842	2	1558.752247	1558.748349	K	M	21	35
PSM	LQLGPETLLQDNPK	1123	sp|O09174|AMACR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3095.16	51.4054	2	1564.850047	1564.846073	K	L	87	101
PSM	TIQNLASIQSFQIK	1124	sp|Q91XE0|GLYAT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3143.16	52.74757	2	1589.884447	1589.877707	K	H	114	128
PSM	GSLLIDSSTIDPSVSK	1125	sp|Q99L13|3HIDH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2999.16	48.72066	2	1617.847047	1617.846132	K	E	125	141
PSM	AKPVVSFIAGITAPPGR	1126	sp|Q9WUM5|SUCA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2990.3	48.46392	3	1679.974271	1679.972276	K	R	279	296
PSM	TLVYGGIFLYPANKK	1127	sp|Q9QXD6|F16P1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3039.4	49.811	3	1682.943671	1682.939579	R	S	256	271
PSM	SAVYPTSAVQMEAALR	1128	sp|Q9D6Y7|MSRA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3006.19	48.92165	2	1692.856847	1692.850506	R	S	157	173
PSM	NAVITVPAYFNDSQR	1129	sp|P38647|GRP75_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3051.21	50.16903	2	1693.846247	1693.842384	K	Q	188	203
PSM	PHPLVTSTDIVLTITK	1130	sp|P28271|ACOC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3041.8	49.87165	3	1733.996171	1733.992737	K	H	251	267
PSM	GQNILDGGAPFYTTYK	1131	sp|O09174|AMACR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3133.19	52.46544	2	1743.854647	1743.846801	R	T	208	224
PSM	NGICLEMGPQPQGVLR	1132	sp|Q91XE4|ACY3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	4-UNIMOD:4	ms_run[1]:scan=1.1.3060.19	50.41183	2	1767.879847	1767.876010	K	A	172	188
PSM	LAEMPADSGYPAYLGAR	1133	sp|P50516|VATA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2984.20	48.31658	2	1780.851447	1780.845421	R	L	365	382
PSM	SGNSVTLLVLDGDSYEK	1134	sp|Q9JIL4|NHRF3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3172.18	53.56618	2	1795.898847	1795.883974	K	A	78	95
PSM	VGINYQPPTVVPGGDLAK	1135	sp|P05213|TBA1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3044.21	49.96845	2	1823.989247	1823.978149	K	V	353	371
PSM	NALPTPSDDPTALMTDPK	1136	sp|P11352|GPX1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3011.21	49.06255	2	1882.910647	1882.898244	R	Y	129	147
PSM	HNQLPLVIEFTEQTAPK	1137	sp|P09103|PDIA1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3159.11	53.20432	3	1964.043671	1964.036727	K	I	233	250
PSM	AVATLQGEGLSVTGIVCHVGK	1138	sp|Q99LB2|DHRS4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	17-UNIMOD:4	ms_run[1]:scan=1.1.3038.13	49.79	3	2095.115771	2095.109575	R	A	73	94
PSM	GIHVEIPGAQAESLGPLQVAR	1139	sp|Q9DCW4|ETFB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3135.15	52.5181	3	2141.172971	2141.159302	R	V	86	107
PSM	QDVSPFNVVAWHGNYTPYK	1140	sp|O09173|HGD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3182.11	53.84122	3	2221.073771	2221.059253	K	Y	258	277
PSM	ADFDNTVAIHPTSSEELVTLR	1141	sp|P47791|GSHR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3053.17	50.22028	3	2314.156571	2314.144105	K	-	480	501
PSM	IFSGCNIENACYPLGVCAER	1142	sp|P56389|CDD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	5-UNIMOD:4,11-UNIMOD:4,17-UNIMOD:4	ms_run[1]:scan=1.1.3112.8	51.87093	3	2329.045871	2329.028958	R	T	49	69
PSM	FAAEHTIFASNTSSLQITNIANATTR	1143	sp|Q61425|HCDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3176.21	53.68095	3	2778.417671	2778.393672	K	Q	137	163
PSM	FVSISDLFVPK	1144	sp|Q61598|GDIB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3569.4	64.67935	2	1250.693047	1250.691075	K	D	380	391
PSM	DGIILCELINK	1145	sp|Q9DAW9|CNN3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	6-UNIMOD:4	ms_run[1]:scan=1.1.3430.2	60.77715	2	1286.694647	1286.690424	K	L	54	65
PSM	IEIPEYFNFAK	1146	sp|Q3UNX5|ACSM3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3432.3	60.8357	2	1369.696447	1369.691804	K	D	46	57
PSM	HPDEPVLLEEPVVLALAEK	1147	sp|Q9JII6|AK1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3578.7	64.93605	3	2097.156371	2097.135772	R	H	222	241
PSM	GYEEWLLNEIR	1148	sp|P57780|ACTN4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3539.10	63.8251	2	1420.705847	1420.698680	K	R	397	408
PSM	VALTGLTVAEYFR	1149	sp|P56480|ATPB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3457.10	61.52085	2	1438.781047	1438.782016	R	D	282	295
PSM	LMNESLMLVTALNPHIGYDK	1150	sp|P97807|FUMH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3503.10	62.81167	3	2258.157071	2258.143911	K	A	445	465
PSM	NLCLLYSLYGISQK	1151	sp|Q9R0H0|ACOX1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	3-UNIMOD:4	ms_run[1]:scan=1.1.3582.8	65.04704	2	1670.878247	1670.870179	R	G	557	571
PSM	IEFLDDVMMDACNR	1152	sp|Q7TNG8|LDHD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	12-UNIMOD:4	ms_run[1]:scan=1.1.3499.19	62.70493	2	1727.742847	1727.731713	R	H	276	290
PSM	SLRPGVAIADFVIFPPR	1153	sp|O09173|HGD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3502.3	62.77755	3	1854.056471	1854.051589	K	W	305	322
PSM	AYSEALAAFGNGALFVEK	1154	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3513.11	63.08927	2	1856.944647	1856.930865	R	F	220	238
PSM	KFPLDPLITHVLPFEK	1155	sp|P00329|ADH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3426.7	60.67278	3	1893.087071	1893.076407	K	I	340	356
PSM	AIMTYVSSFYHAFSGAQK	1156	sp|P57780|ACTN4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3451.6	61.3468	3	2006.966171	2006.956034	K	A	257	275
PSM	KAQGTGELTQLLNSLCTAIK	1157	sp|Q9QXD6|F16P1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	16-UNIMOD:4	ms_run[1]:scan=1.1.3599.12	65.51798	3	2145.158771	2145.146354	R	A	24	44
PSM	QFLSGELEVELTPQGTLAER	1158	sp|Q9D0K2|SCOT1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3487.10	62.35218	3	2216.145371	2216.132478	R	I	125	145
PSM	KIWCFGPDGTGPNILTDITK	1159	sp|P58252|EF2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	4-UNIMOD:4	ms_run[1]:scan=1.1.3444.5	61.1595	3	2232.140171	2232.124890	R	G	648	668
PSM	WGEAGAEYVVESTGVFTTMEK	1160	tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3599.15	65.5205	3	2290.062971	2290.046365	K	A	85	106
PSM	GLTDNFADVQVSVVDCPDLTK	1161	sp|Q91V76|CK054_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	16-UNIMOD:4	ms_run[1]:scan=1.1.3470.7	61.87917	3	2292.112571	2292.094378	K	E	23	44
PSM	KFDLGQDVIDFTGHSLALYR	1162	sp|Q61598|GDIB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3534.4	63.67647	4	2294.184094	2294.169532	K	T	174	194
PSM	FEPQINAEESEIR	1163	sp|Q64516|GLPK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2665.12	39.35954	2	1560.744847	1560.742001	R	Y	493	506
PSM	VITAFNDGLNHLDSLK	1164	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3104.3	51.6436	3	1756.906871	1755.915549	K	G	68	84
PSM	IRADIVENQVMDTR	1165	sp|P10649|GSTM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2554.12	36.2719	3	1658.840171	1658.841004	R	M	95	109
PSM	MDDREDLVYQAK	1166	sp|P62259|1433E_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:1	ms_run[1]:scan=1.1.2695.17	40.189	2	1523.6943	1523.6921	-	L	1	13
PSM	IGIASQALGIAQASLDCAVK	1167	sp|Q07417|ACADS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23	17-UNIMOD:4	ms_run[1]:scan=1.1.3618.5	66.0596	3	1985.076071	1985.061562	R	Y	273	293
PSM	QSLIYHVASQQIQTLEK	1168	sp|Q9DCY0|KEG1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:28	ms_run[1]:scan=1.1.3424.3	60.61386	3	1968.0385	1968.0311	R	L	239	256
PSM	ASHLELNNGTK	1169	sp|P45376|ALDR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:1	ms_run[1]:scan=1.1.2199.21	26.50127	2	1224.6031	1224.6093	M	M	2	13
PSM	ALDSFPGPPK	1170	sp|Q64462|CP4B1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2507.6	34.95735	2	1028.538647	1027.533846	R	H	42	52
PSM	LGGSAVISLEGKPL	1171	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.2991.11	48.49753	2	1339.768047	1339.771117	K	-	153	167
PSM	SHQTGIQASEDVK	1172	sp|Q91YR1|TWF1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:1	ms_run[1]:scan=1.1.2019.20	21.49008	2	1440.6794	1440.6840	M	E	2	15
PSM	DSETELLLSEEEVAK	1173	sp|Q8VDG5|PPCS_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3129.21	52.35405	2	1692.826247	1690.814892	K	G	273	288
PSM	SPAHGISLFLVENGMK	1174	sp|P51174|ACADL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.3019.4	49.2774	2	1700.866447	1698.876327	R	G	225	241
PSM	KAEAQIAAK	1175	sp|P05202|AATM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.1609.17	10.08807	2	928.527047	928.534181	R	N	82	91
PSM	KYEATLEK	1176	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.1743.18	13.789	2	980.512047	980.517862	K	C	376	384
PSM	SDRPELTGAK	1177	sp|Q99LC5|ETFA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.1743.19	13.78985	2	1072.544447	1072.551287	K	V	207	217
PSM	HSEVQQANLK	1178	sp|O55029|COPB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.1689.20	12.30302	2	1152.584447	1152.588736	K	A	319	329
PSM	IHMGNCAENTAK	1179	sp|Q8QZT1|THIL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	6-UNIMOD:4	ms_run[1]:scan=1.1.1729.16	13.3983	3	1344.585371	1344.591455	K	K	188	200
PSM	TATPQQAQEVHEK	1180	sp|P17751|TPIS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.1710.20	12.88677	2	1465.712647	1465.716121	K	L	226	239
PSM	RVLIAAHGNSLR	1181	sp|Q9DBJ1|PGAM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.1881.13	17.64668	3	1305.757571	1305.762952	K	G	180	192
PSM	VTDALNATR	1182	sp|P63038|CH60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.1924.14	18.83685	2	959.500447	959.503609	R	A	421	430
PSM	HNADFCYK	1183	sp|Q64442|DHSO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	6-UNIMOD:4	ms_run[1]:scan=1.1.1819.18	15.91587	2	1053.430447	1053.433815	K	L	135	143
PSM	HNADFCYK	1184	sp|Q64442|DHSO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	6-UNIMOD:4	ms_run[1]:scan=1.1.1825.20	16.08755	2	1053.430447	1053.433815	K	L	135	143
PSM	DGSVAIASKPR	1185	sp|Q9D0K2|SCOT1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.1811.6	15.68103	3	1099.588571	1099.598572	K	E	177	188
PSM	CCTLPEDQR	1186	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	1-UNIMOD:4,2-UNIMOD:4	ms_run[1]:scan=1.1.1901.20	18.21077	2	1177.482247	1177.485593	K	L	461	470
PSM	CCTLPEDQR	1187	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	1-UNIMOD:4,2-UNIMOD:4	ms_run[1]:scan=1.1.1908.19	18.39977	2	1177.482247	1177.485593	K	L	461	470
PSM	NHGVVMPDANK	1188	sp|Q9EQ20|MMSA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.1835.20	16.36847	2	1180.560847	1180.565892	K	E	288	299
PSM	VLVQNAAGSQEK	1189	sp|P26039|TLN1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.1871.21	17.37655	2	1242.653847	1242.656815	K	L	2032	2044
PSM	SHGQDYLVGNR	1190	sp|P10648|GSTA2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.1915.11	18.58462	3	1244.584871	1244.589798	K	L	142	153
PSM	TIEAEAAHGTVTR	1191	sp|P54071|IDHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.1913.21	18.5382	2	1354.683247	1354.684093	K	H	341	354
PSM	TCVADESAANCDK	1192	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	2-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=1.1.1806.21	15.55213	2	1439.564647	1439.565694	K	S	76	89
PSM	GKLDGNQDLIR	1193	sp|P54071|IDHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2088.8	23.37885	3	1227.649571	1227.657149	R	F	383	394
PSM	ATDVMIAGK	1194	sp|P50247|SAHH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2053.8	22.4141	2	904.464247	904.468803	R	V	206	215
PSM	AVEAFETAK	1195	sp|Q64442|DHSO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2054.11	22.44273	2	964.480647	964.486562	K	K	331	340
PSM	AGFAGDDAPR	1196	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.1969.14	20.09578	2	975.437647	975.441009	K	A	19	29
PSM	RPWFAGDK	1197	sp|P10649|GSTM1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2049.12	22.3092	2	975.488047	975.492650	K	V	145	153
PSM	RLQEENQVITPR	1198	sp|Q62468|VILI_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2032.15	21.84472	3	1481.788871	1481.795040	K	L	609	621
PSM	HVTLLVCGK	1199	sp|Q9JIL4|NHRF3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	7-UNIMOD:4	ms_run[1]:scan=1.1.2091.15	23.46893	2	1025.562447	1025.569186	K	M	449	458
PSM	TAVCDIPPR	1200	sp|P68372|TBB4B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	4-UNIMOD:4	ms_run[1]:scan=1.1.2130.16	24.54533	2	1027.507847	1027.512065	K	G	351	360
PSM	AAGAQVVAVSR	1201	sp|Q91X52|DCXR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2002.19	21.01383	2	1027.571847	1027.577443	K	T	29	40
PSM	HYGGLTGLNK	1202	sp|O70250|PGAM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.1973.15	20.20762	2	1058.547447	1058.550893	R	A	91	101
PSM	RDPSVGEHTVEVLR	1203	sp|O09174|AMACR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2154.21	25.23043	3	1592.822171	1592.827068	K	E	341	355
PSM	SPPGQVTEAVK	1204	sp|P45376|ALDR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.1988.19	20.62148	2	1111.583247	1111.587339	K	V	23	34
PSM	NAEGTWSVEK	1205	sp|P17563|SBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2131.20	24.57635	2	1119.514847	1119.519653	K	V	280	290
PSM	NAEGTWSVEK	1206	sp|P17563|SBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2137.19	24.7456	2	1119.514847	1119.519653	K	V	280	290
PSM	YIDQEELNK	1207	sp|P07901|HS90A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2121.18	24.30055	2	1150.549247	1150.550619	K	T	285	294
PSM	VPDDPEHLAAR	1208	sp|Q99KP3|CRYL1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2104.10	23.8203	3	1218.589871	1218.599300	K	R	288	299
PSM	QAASSLQQASLK	1209	sp|P38647|GRP75_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2059.20	22.58607	2	1230.654247	1230.656815	R	L	635	647
PSM	GEGMSQAATICR	1210	sp|P35505|FAAA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	11-UNIMOD:4	ms_run[1]:scan=1.1.2105.20	23.85632	2	1279.563247	1279.564906	K	S	305	317
PSM	MDSTANEVEAVK	1211	sp|P09103|PDIA1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2150.19	25.11458	2	1292.584047	1292.591832	K	V	427	439
PSM	AQSELSGAADEAAR	1212	sp|Q9D3D9|ATPD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2063.20	22.69692	2	1374.637647	1374.637536	K	A	137	151
PSM	AVVGSPHVSTASAVR	1213	sp|Q7TNG8|LDHD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2036.9	21.94895	3	1436.769971	1436.773576	K	E	37	52
PSM	QHLQIQSSQSDLGK	1214	sp|Q9DCY0|KEG1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2030.19	21.7925	3	1567.791971	1567.795434	K	V	99	113
PSM	LQEENQVITPR	1215	sp|Q62468|VILI_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2208.11	26.7477	2	1325.686447	1325.693929	R	L	610	621
PSM	KNPDSQYGELIEK	1216	sp|Q9DBP5|KCY_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2235.10	27.4846	2	1519.739047	1519.751838	R	Y	43	56
PSM	LSDGVAVLK	1217	sp|P63038|CH60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2332.9	30.1541	2	900.522447	900.528033	K	V	397	406
PSM	VAIEPGVPR	1218	sp|Q64442|DHSO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2289.6	28.9561	2	936.533847	936.539266	R	E	92	101
PSM	APEEILAEK	1219	tr|D3Z5G7|D3Z5G7_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2212.12	26.8478	2	998.528647	998.528427	K	S	332	341
PSM	GFEEAVAAGAK	1220	sp|P38060|HMGCL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2288.15	28.93673	2	1048.515447	1048.518925	K	E	112	123
PSM	SFVDQYGQR	1221	sp|P12658|CALB1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2290.7	28.98547	2	1098.505647	1098.509423	K	D	60	69
PSM	KQTALAELVK	1222	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2198.18	26.4706	2	1099.658047	1099.660110	K	H	549	559
PSM	SLSQNYGVLK	1223	sp|Q61171|PRDX2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2358.12	30.86715	2	1107.588047	1107.592424	K	N	110	120
PSM	LIEPNTAVTR	1224	sp|Q9DCU9|HOGA1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2233.11	27.42415	2	1112.614447	1112.618973	R	R	266	276
PSM	ILSTAQRPLE	1225	sp|Q3TNA1|XYLB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2263.16	28.24773	2	1126.629247	1126.634623	R	-	542	552
PSM	GYSFTTTAER	1226	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2252.16	27.94713	2	1131.517647	1131.519653	R	E	197	207
PSM	LQNLQLQPGK	1227	sp|P32020|NLTP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2322.17	29.8797	2	1137.645247	1137.650607	K	A	535	545
PSM	LVASAYSIAQK	1228	sp|Q9Z0S1|BPNT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2356.14	30.81422	2	1149.634047	1149.639374	R	A	11	22
PSM	LAAIQESGVER	1229	sp|Q60692|PSB6_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2190.18	26.24505	2	1171.617047	1171.619701	R	Q	209	220
PSM	VIATFACSGEK	1230	sp|Q9JLJ2|AL9A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	7-UNIMOD:4	ms_run[1]:scan=1.1.2251.19	27.92185	2	1181.574847	1181.575060	R	E	39	50
PSM	FAAATGATPIAGR	1231	sp|P14206|RSSA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2301.18	29.29657	2	1202.635647	1202.640771	K	F	90	103
PSM	EELGAQQPDLK	1232	sp|Q64105|SPRE_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2229.17	27.31908	2	1226.610047	1226.614282	K	V	53	64
PSM	GFGNIATNEDAK	1233	sp|Q8K0E8|FIBB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2226.18	27.23698	2	1235.574847	1235.578230	K	K	292	304
PSM	RPNKPLFTGLVTQCQK	1234	sp|Q8K4Z3|NNRE_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	22	14-UNIMOD:4	ms_run[1]:scan=1.1.2299.20	29.24153	3	1887.0212	1886.0192	K	M	139	155
PSM	VLETAEDIQER	1235	sp|P16546|SPTN1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2271.20	28.47233	2	1301.645847	1301.646310	K	R	8	19
PSM	IRYESLTDPSK	1236	sp|P07901|HS90A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2177.10	25.87417	3	1307.667371	1307.672131	K	L	59	70
PSM	YLIANATNPESK	1237	sp|P68254|1433T_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2330.20	30.10673	2	1319.671447	1319.672131	K	V	104	116
PSM	VASVAHSAPSEAPSCSPFGK	1238	sp|P70290|EM55_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	15-UNIMOD:4	ms_run[1]:scan=1.1.2296.18	29.15608	3	1984.936571	1984.931276	R	K	228	248
PSM	NINNDTTYCIK	1239	sp|Q99KR3|LACB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	9-UNIMOD:4	ms_run[1]:scan=1.1.2239.16	27.59078	2	1354.618847	1354.618715	K	K	92	103
PSM	INVYYNEATGNK	1240	sp|Q9CWF2|TBB2B_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2323.21	29.91113	2	1384.663847	1384.662294	R	Y	47	59
PSM	VCEWKEPEELK	1241	sp|Q9DBE0|CSAD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	2-UNIMOD:4	ms_run[1]:scan=1.1.2313.21	29.63217	2	1445.684847	1445.686067	K	Q	43	54
PSM	RVMVDANEVPIQK	1242	sp|Q9D964|GATM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2327.15	30.01805	3	1497.794471	1497.797348	K	M	369	382
PSM	IQHILCTGNLCTK	1243	sp|Q9QZ88|VPS29_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	6-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=1.1.2278.13	28.66075	3	1556.777471	1556.780318	K	E	31	44
PSM	AVDNQVYVATASPAR	1244	sp|Q9JHW2|NIT2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2367.17	31.11588	2	1560.785447	1560.789620	R	D	196	211
PSM	GAEAANVTGPGGVPVQGSK	1245	sp|P62960|YBOX1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2279.21	28.69538	2	1694.861447	1694.858763	K	Y	117	136
PSM	VMLGETNPADSKPGTIR	1246	sp|P15532|NDKA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2320.16	29.82255	3	1784.913371	1784.909084	R	G	89	106
PSM	KSQVFSTAADGQTQVEIK	1247	sp|P38647|GRP75_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2365.19	31.06025	3	1935.980471	1935.990171	K	V	468	486
PSM	VGLQVVAVK	1248	sp|P63038|CH60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2477.4	34.1251	2	911.575647	911.580403	K	A	293	302
PSM	FGLGPEPPR	1249	sp|P11930|NUD19_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2470.4	33.93485	2	968.503647	968.507966	R	Q	74	83
PSM	ANTFVAELK	1250	sp|P08249|MDHM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2479.6	34.18158	2	991.531047	991.533846	R	G	177	186
PSM	EGASILLDGR	1251	sp|Q9EQ20|MMSA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2573.9	36.80003	2	1029.541647	1029.545474	K	R	377	387
PSM	MFASFPTTK	1252	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	1-UNIMOD:35	ms_run[1]:scan=1.1.2421.13	32.6039	2	1044.492847	1044.495018	R	T	33	42
PSM	MFASFPTTK	1253	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	1-UNIMOD:35	ms_run[1]:scan=1.1.2427.10	32.7697	2	1044.492847	1044.495018	R	T	33	42
PSM	AYPGYYFTGDGAHR	1254	sp|Q99NB1|ACS2L_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2475.9	34.07395	3	1573.695371	1573.694992	R	T	517	531
PSM	QGLSSSIFTK	1255	sp|Q9DBF1|AL7A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2546.6	36.05317	2	1066.562047	1066.565875	K	D	453	463
PSM	AGLELSPEMK	1256	sp|P12658|CALB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2574.8	36.82733	2	1073.538647	1073.542697	K	S	50	60
PSM	ALGLSNFNSR	1257	sp|Q9JII6|AK1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2535.11	35.75132	2	1077.553247	1077.556707	K	Q	158	168
PSM	SSGGFVWACK	1258	sp|P54071|IDHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	9-UNIMOD:4	ms_run[1]:scan=1.1.2553.12	36.24473	2	1097.493247	1097.496415	K	N	300	310
PSM	SSGGFVWACK	1259	sp|P54071|IDHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	9-UNIMOD:4	ms_run[1]:scan=1.1.2546.8	36.0565	2	1097.493247	1097.496415	K	N	300	310
PSM	EPITVSSEQMSHFR	1260	sp|P00920|CAH2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2498.8	34.7094	3	1646.772671	1646.772256	R	T	213	227
PSM	TYFQGSLPAR	1261	sp|P52760|RIDA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2485.12	34.35108	2	1138.574647	1138.577108	K	A	98	108
PSM	LGTAAIQGAIEK	1262	sp|Q8QZT1|THIL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2484.13	34.32413	2	1170.657847	1170.660838	K	A	64	76
PSM	DGVANVSIEDR	1263	sp|P08228|SODC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2380.17	31.46893	2	1173.561047	1173.562580	K	V	93	104
PSM	ATISNDGATILK	1264	sp|P80313|TCPH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2375.17	31.33145	2	1202.650047	1202.650667	K	L	56	68
PSM	IFSSEHDIFR	1265	sp|P51174|ACADL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2517.2	35.23753	3	1249.601171	1249.609137	R	E	52	62
PSM	VPAINVNDSVTK	1266	sp|P50247|SAHH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2405.19	32.16595	2	1255.674047	1255.677216	K	S	175	187
PSM	AFSGYLGPDESK	1267	sp|Q9R0P3|ESTD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2493.13	34.5762	2	1269.585847	1269.587733	K	W	187	199
PSM	LSSTWEGIQAGK	1268	sp|Q93092|TALDO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2538.13	35.83685	2	1275.644447	1275.645916	K	E	143	155
PSM	EALQDVEDENQ	1269	sp|P62259|1433E_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2418.18	32.52542	2	1288.542047	1288.541905	K	-	245	256
PSM	TAVVVGTVTDDVR	1270	sp|P35980|RL18_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2529.20	35.59245	2	1330.705447	1330.709245	K	I	79	92
PSM	SALPAQSAATLPAR	1271	sp|Q62261|SPTB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2409.19	32.27682	2	1352.737447	1352.741213	K	T	2177	2191
PSM	NTGIICTIGPASR	1272	sp|P52480|KPYM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	6-UNIMOD:4	ms_run[1]:scan=1.1.2562.16	36.49688	2	1358.698647	1358.697634	R	S	44	57
PSM	NTGIICTIGPASR	1273	sp|P52480|KPYM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	6-UNIMOD:4	ms_run[1]:scan=1.1.2568.16	36.66503	2	1358.698647	1358.697634	R	S	44	57
PSM	TAACLAAGNTVVIK	1274	sp|Q8R0Y6|AL1L1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	4-UNIMOD:4	ms_run[1]:scan=1.1.2517.17	35.25005	2	1387.747247	1387.749336	K	P	584	598
PSM	LGESQTLQQFSR	1275	sp|P16546|SPTN1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2533.20	35.70363	2	1392.699247	1392.699743	K	D	1547	1559
PSM	AIEINPDSAQPYK	1276	sp|Q99L47|F10A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2540.21	35.89992	2	1444.722047	1444.719809	R	W	173	186
PSM	HVFGESDELIGQK	1277	sp|P17751|TPIS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2437.7	33.0407	3	1457.712371	1457.715058	R	V	151	164
PSM	GTFASLSELHCDK	1278	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	11-UNIMOD:4	ms_run[1]:scan=1.1.2473.5	34.01588	3	1463.672771	1463.671479	K	L	84	97
PSM	QEQDTYALSSYTR	1279	sp|Q8QZT1|THIL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2512.21	35.10998	2	1560.706447	1560.705616	R	S	206	219
PSM	VHACGVNPVETYIR	1280	sp|P47199|QOR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	4-UNIMOD:4	ms_run[1]:scan=1.1.2482.16	34.27153	3	1613.793971	1613.798411	K	S	42	56
PSM	KFEEFQTDLAAHEER	1281	sp|P16546|SPTN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2396.14	31.914	3	1848.874571	1848.864242	K	V	190	205
PSM	AAPTEPPEAPEATAAGGVTSK	1282	sp|Q8VC30|TKFC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2384.19	31.58245	3	1950.955271	1950.953451	R	Q	352	373
PSM	HGCAFLVDEVQTGGGCTGK	1283	sp|P61922|GABT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	3-UNIMOD:4,16-UNIMOD:4	ms_run[1]:scan=1.1.2528.18	35.56238	3	1991.884871	1991.882946	K	F	319	338
PSM	NQYDNDVTVWSPQGR	1284	sp|Q9R1P4|PSA1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2777.21	42.49268	2	1777.814647	1777.801976	R	I	4	19
PSM	HFSVEGQLEFR	1285	sp|P07901|HS90A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2652.5	38.99382	3	1347.653471	1347.657149	K	A	329	340
PSM	FGEPIPISK	1286	sp|P35505|FAAA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2576.9	36.88513	2	986.539247	986.543683	R	A	212	221
PSM	AILNYIATK	1287	tr|E9Q6L7|E9Q6L7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2649.9	38.91215	2	1005.582647	1005.585882	R	Y	70	79
PSM	DVNAAIATIK	1288	sp|P05213|TBA1B_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2596.8	37.44388	2	1014.568447	1014.570960	K	T	327	337
PSM	MFASFPTTK	1289	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2620.6	38.09953	2	1028.498047	1028.500103	R	T	33	42
PSM	LPEILVETK	1290	sp|Q7TNG8|LDHD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2776.4	42.4508	2	1040.609647	1040.611762	R	E	375	384
PSM	HDVVFLITK	1291	sp|Q68FD5|CLH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2597.10	37.4734	2	1070.605847	1070.612431	K	Y	270	279
PSM	LLADPTGAFGK	1292	sp|P99029|PRDX5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2724.8	41.0104	2	1088.584847	1088.586610	R	A	145	156
PSM	LLADPTGAFGK	1293	sp|P99029|PRDX5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2737.10	41.37113	2	1088.584847	1088.586610	R	A	145	156
PSM	VQGQNLFFR	1294	tr|A0A087WP24|A0A087WP24_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2710.6	40.60678	2	1107.581447	1107.582528	K	E	13	22
PSM	SSSEIYGLMK	1295	sp|Q64516|GLPK_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2607.11	37.74863	2	1113.534247	1113.537611	R	I	235	245
PSM	RLYATTSLYSAWDK	1296	sp|P17563|SBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2770.9	42.28675	3	1673.844971	1673.841322	K	Q	398	412
PSM	AASGSALLWPR	1297	sp|Q9DB29|IAH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2771.11	42.31628	2	1127.607847	1127.608743	R	V	7	18
PSM	LVQEVTDFAK	1298	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2585.9	37.13447	2	1148.605847	1148.607740	K	T	66	76
PSM	LDIDSAPITAR	1299	sp|P52480|KPYM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2653.13	39.02847	2	1170.623047	1170.624452	R	N	33	44
PSM	ISGDLEVLAEK	1300	sp|O35381|AN32A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2720.10	40.89765	2	1172.628047	1172.628869	R	C	76	87
PSM	DVRPITEQIAVTAGCK	1301	sp|Q91WU0|CES1F_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	15-UNIMOD:4	ms_run[1]:scan=1.1.2678.14	39.71786	3	1756.921871	1756.914169	K	T	259	275
PSM	LVQAFQFTDK	1302	sp|P35700|PRDX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2773.13	42.37447	2	1195.626047	1195.623724	R	H	159	169
PSM	AAVQVLDDIEK	1303	sp|P16332|MUTA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2731.9	41.20621	2	1199.633447	1199.639768	R	C	729	740
PSM	INFDDNAEFR	1304	sp|Q9Z2I8|SUCB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2681.12	39.80187	2	1239.549847	1239.552016	K	Q	261	271
PSM	LGGDLGTYVINK	1305	sp|O35943|FRDA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2775.15	42.43217	2	1248.673647	1248.671403	K	Q	133	145
PSM	ENIIDLSNANR	1306	sp|A2BIM8|MUP18_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2625.19	38.24586	2	1257.631647	1257.631329	R	C	165	176
PSM	FDALTMHVQPQVAAQQK	1307	sp|Q62468|VILI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2665.10	39.3562	3	1910.966171	1910.967267	K	M	375	392
PSM	LGFPMYAHVDK	1308	sp|Q9DCY0|KEG1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2632.5	38.42943	3	1276.623971	1276.627429	K	A	256	267
PSM	GVTFNVTTVDTK	1309	sp|Q9Z1Q5|CLIC1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2640.16	38.66272	2	1280.661247	1280.661232	K	R	38	50
PSM	KLETAVNLAWTAGNSNTR	1310	sp|Q60932|VDAC1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2706.18	40.50248	3	1945.006271	1945.001738	K	F	214	232
PSM	GAPTTSLVSVAVTK	1311	sp|Q9DBF1|AL7A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2651.17	38.97569	2	1329.749247	1329.750381	K	I	219	233
PSM	MLLQQDLSSYK	1312	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	1-UNIMOD:35	ms_run[1]:scan=1.1.2612.17	37.89308	2	1340.663647	1340.664603	R	F	318	329
PSM	FHADFLLQHVK	1313	sp|Q8R164|BPHL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2603.4	37.63305	3	1353.714671	1353.719356	R	G	250	261
PSM	AYSTDVCVPISR	1314	sp|Q7TNG8|LDHD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	7-UNIMOD:4	ms_run[1]:scan=1.1.2590.19	37.28227	2	1366.655847	1366.655101	K	L	363	375
PSM	ARPFPDGLAEDIDKGEVSAR	1315	sp|P58252|EF2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	22		ms_run[1]:scan=1.1.2742.17	41.51802	3	2142.0822	2142.0702	K	Q	606	626
PSM	APQVSTPTLVEAAR	1316	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2592.19	37.3394	2	1438.782047	1438.777993	K	N	439	453
PSM	EAGAGGLSIAVEGPSK	1317	sp|Q80X90|FLNB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2623.14	38.188	2	1441.739647	1441.741273	R	A	2220	2236
PSM	SPYQEFTDHLVK	1318	sp|P25444|RS2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2709.5	40.57742	3	1462.705871	1462.709245	K	T	264	276
PSM	GILAADESVGTMGNR	1319	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2647.20	38.8644	2	1489.725447	1489.719492	K	L	29	44
PSM	DIANENEAQFQIR	1320	sp|O35643|AP1B1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2744.20	41.5766	2	1546.739847	1546.737585	K	D	849	862
PSM	NSCPPTAELLGSPGR	1321	sp|P46412|GPX3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	3-UNIMOD:4	ms_run[1]:scan=1.1.2611.20	37.86747	2	1554.748447	1554.746041	K	L	154	169
PSM	GSNTCELVFEDCK	1322	sp|Q9JHI5|IVD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	5-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.2578.20	36.95063	2	1557.643647	1557.643944	R	V	248	261
PSM	VVEIAPATHLDPQLR	1323	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2702.10	40.38088	3	1657.920071	1657.915155	K	S	274	289
PSM	WIDIHNPATNEVVGR	1324	sp|Q9EQ20|MMSA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2769.10	42.25974	3	1719.873071	1719.869268	K	V	56	71
PSM	VIVVGNPANTNCLTASK	1325	sp|P14152|MDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	12-UNIMOD:4	ms_run[1]:scan=1.1.2625.21	38.24753	2	1756.923847	1756.914169	K	S	126	143
PSM	ILDSVGIEADDDRLNK	1326	sp|P99027|RLA2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2623.17	38.19302	2	1771.909847	1771.895208	K	V	26	42
PSM	SQVFSTAADGQTQVEIK	1327	sp|P38647|GRP75_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2635.21	38.52648	2	1807.902047	1807.895208	K	V	469	486
PSM	KGESVMVVPTLSEEEAK	1328	sp|O08709|PRDX6_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2648.13	38.88687	3	1831.928471	1831.923731	K	Q	183	200
PSM	SQIFSTASDNQPTVTIK	1329	sp|P20029|BIP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2752.16	41.79453	2	1835.933047	1835.926508	K	V	449	466
PSM	EAVCIVLSDDTCSDEK	1330	sp|Q01853|TERA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	4-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.2752.17	41.7962	2	1839.795047	1839.786645	R	I	66	82
PSM	MSSYAFFVQTCR	1331	sp|P30681|HMGB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	11-UNIMOD:4	ms_run[1]:scan=1.1.3014.9	49.1399	2	1495.654447	1495.658806	K	E	13	25
PSM	YLTVAAVFR	1332	sp|P68372|TBB4B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3032.2	49.61268	2	1038.582047	1038.586216	R	G	310	319
PSM	SGEYPFPLIK	1333	sp|P45952|ACADM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3075.4	50.8254	2	1149.607447	1149.607011	K	R	70	80
PSM	AGGLATTGDKDILDIVPTEIHQK	1334	sp|Q9QXD6|F16P1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3012.4	49.07943	4	2391.276494	2391.264555	K	A	292	315
PSM	LTPLDQQLFK	1335	sp|Q9DCY0|KEG1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3034.12	49.67643	2	1201.670847	1201.670674	K	F	159	169
PSM	TLMNLGGLAVAR	1336	sp|Q9WVA4|TAGL2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3059.9	50.37617	2	1214.675847	1214.680527	R	D	128	140
PSM	AVFADVAFVQR	1337	sp|Q80W22|THNS2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3003.11	48.83037	2	1221.649047	1221.650607	K	H	204	215
PSM	FLASVSTVLTSK	1338	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2999.7	48.71315	2	1251.707847	1251.707454	K	Y	129	141
PSM	FEELNADLFR	1339	sp|P17156|HSP72_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3141.10	52.68513	2	1252.608247	1252.608802	R	G	305	315
PSM	IVGAPMHDLLLWNNATVTTCHSK	1340	sp|Q922D8|C1TC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	20-UNIMOD:4	ms_run[1]:scan=1.1.3059.13	50.37952	4	2577.292094	2577.283199	K	T	176	199
PSM	DSVVAGFQWATK	1341	sp|P58252|EF2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3128.9	52.31568	2	1307.649447	1307.651001	K	E	677	689
PSM	LLYAFAEATVPK	1342	sp|Q99MN9|PCCB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3084.9	51.08513	2	1321.736847	1321.728189	K	I	417	429
PSM	LLSPGSVMLVSAR	1343	sp|Q64105|SPRE_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3063.13	50.49003	2	1328.748847	1328.748607	R	S	31	44
PSM	FLVYVANFDEK	1344	sp|Q61598|GDIB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3170.10	53.5041	2	1343.682647	1343.676154	K	D	143	154
PSM	DLGTDSQIFISR	1345	sp|Q61598|GDIB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3047.16	50.0503	2	1350.678647	1350.677945	K	A	391	403
PSM	ALGMTPAAFSALPR	1346	sp|Q62468|VILI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3176.13	53.67427	2	1401.746847	1401.743856	R	W	801	815
PSM	TVQGAFFGVPVYK	1347	sp|Q61838|PZP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3173.13	53.58995	2	1411.752247	1411.749987	K	D	625	638
PSM	GNWGYLDQAAALR	1348	sp|Q91WG0|EST2C_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3070.16	50.69307	2	1433.707447	1433.705162	R	W	196	209
PSM	FLTEELSLDQDR	1349	sp|O35215|DOPD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3030.13	49.5673	2	1464.713447	1464.709639	K	I	84	96
PSM	LADTLQILAQEGAK	1350	sp|Q60928|GGT1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3051.11	50.16068	2	1469.811047	1469.808959	K	A	212	226
PSM	VLGPLIGVQVPQEK	1351	sp|Q61133|GSTT2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3087.15	51.17685	2	1475.874447	1475.871165	K	V	118	132
PSM	GYSFSLTTFSPSGK	1352	sp|P49722|PSA2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3170.15	53.50827	2	1477.721047	1477.708910	R	L	5	19
PSM	NFNTVPYIVGINK	1353	tr|D3Z298|D3Z298_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3124.17	52.2086	2	1477.796047	1477.792915	K	Q	340	353
PSM	VFDYSEYWEGAR	1354	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3157.15	53.15162	2	1520.664847	1520.657209	R	G	831	843
PSM	DLGATWVVLGHSER	1355	sp|P17751|TPIS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3024.3	49.3968	3	1538.783771	1538.784141	K	R	136	150
PSM	DQGTYEDYVEGLR	1356	sp|Q60605|MYL6_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3020.11	49.29923	2	1543.683047	1543.679067	K	V	82	95
PSM	ALDIAENEMPGLMR	1357	sp|P50247|SAHH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3168.18	53.45567	2	1558.752247	1558.748349	K	M	21	35
PSM	YCLVVLNQPLDAR	1358	sp|Q9R0M5|TPK1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	2-UNIMOD:4	ms_run[1]:scan=1.1.3162.8	53.29183	2	1559.812447	1559.812999	K	F	19	32
PSM	LTLLEVGCGTGANFK	1359	tr|G3X9G9|G3X9G9_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	8-UNIMOD:4	ms_run[1]:scan=1.1.3099.17	51.51712	2	1578.806647	1578.807579	K	F	72	87
PSM	SQEQLAAELAEYTAK	1360	sp|P26040|EZRI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3100.21	51.548	2	1650.820247	1650.810081	K	I	413	428
PSM	GDNTISLISIDSGSGVK	1361	sp|Q5U5V2|HYKK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3055.14	50.27788	2	1661.855047	1661.847195	K	S	106	123
PSM	ADMGGAATICSAIVSAAK	1362	sp|Q9CPY7|AMPL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	10-UNIMOD:4	ms_run[1]:scan=1.1.3133.18	52.4646	2	1692.826247	1692.817492	R	L	304	322
PSM	VVEEAPSIFLDPETR	1363	sp|Q91ZA3|PCCA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3190.16	54.06535	2	1700.870247	1700.862117	K	Q	295	310
PSM	AFQFVETHGEVCPANWTPESPTIKPSPTASK	1364	sp|P20108|PRDX3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	12-UNIMOD:4	ms_run[1]:scan=1.1.2996.19	48.63973	4	3412.664094	3412.639792	K	E	219	250
PSM	DGTVTAGNASGVSDGAGAVIIASEDAVKK	1365	sp|Q8BWT1|THIM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3066.20	50.58123	3	2659.353671	2659.330068	K	H	242	271
PSM	TITLEVEPSDTIENVK	1366	tr|A0A0A6YW67|A0A0A6YW67_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3005.20	48.89448	2	1786.927647	1786.920025	K	A	12	28
PSM	SYELPDGQVITIGNER	1367	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3082.20	51.03672	2	1789.896047	1789.884643	K	F	239	255
PSM	SGNSVTLLVLDGDSYEK	1368	sp|Q9JIL4|NHRF3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3178.19	53.73638	2	1795.898847	1795.883974	K	A	78	95
PSM	LGPNYLQIPVNCPYR	1369	sp|P24270|CATA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	12-UNIMOD:4	ms_run[1]:scan=1.1.3177.20	53.70863	2	1802.925847	1802.913775	R	A	366	381
PSM	VGINYQPPTVVPGGDLAK	1370	sp|P05213|TBA1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3038.19	49.795	2	1823.989247	1823.978149	K	V	353	371
PSM	IHQYFGDLCSQLLSR	1371	sp|Q8JZZ0|UD3A2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	9-UNIMOD:4	ms_run[1]:scan=1.1.3059.10	50.377	3	1835.899871	1835.898853	K	K	112	127
PSM	AKPNEVVFLDDFGSNLK	1372	sp|P34914|HYES_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3124.8	52.20108	3	1891.975871	1891.967979	K	P	175	192
PSM	DATNVGDEGGFAPNILENK	1373	sp|P17182|ENOA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3140.21	52.66555	2	1959.932047	1959.917400	K	E	203	222
PSM	KIPIVSSMAEPLVAGPDEK	1374	sp|Q9JIL4|NHRF3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3005.10	48.88614	3	1980.061871	1980.060165	K	G	467	486
PSM	QAGIAQLYGIAGSTNVTGDQVK	1375	sp|Q9QXD6|F16P1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3141.15	52.6893	3	2190.138671	2190.128061	R	K	51	73
PSM	EGFGHLSPTGTTEFWLGNEK	1376	sp|Q8VCM7|FIBG_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3172.13	53.56202	3	2206.046771	2206.033098	K	I	238	258
PSM	DAEVVLCGGTESMSQSPYCVR	1377	sp|Q8BWT1|THIM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	7-UNIMOD:4,19-UNIMOD:4	ms_run[1]:scan=1.1.3048.20	50.08233	3	2344.023071	2344.013368	K	N	110	131
PSM	QYLVFHDGDSVVFAGPAGNSVETR	1378	sp|Q8R146|APEH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3113.10	51.89953	3	2564.245571	2564.229566	R	G	66	90
PSM	FVSISDLFVPK	1379	sp|Q61598|GDIB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3575.5	64.84963	2	1250.693047	1250.691075	K	D	380	391
PSM	FFPLEAWQIGK	1380	sp|O35215|DOPD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3558.8	64.37162	2	1334.706447	1334.702309	R	K	100	111
PSM	SSRPVFDWKDPLILEEQLTADEK	1381	sp|Q60759|GCDH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	22		ms_run[1]:scan=1.1.3484.9	62.26674	4	2715.3952	2715.3752	K	L	43	66
PSM	ELNDFISYLQR	1382	sp|P27773|PDIA3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3433.5	60.86243	2	1396.701247	1396.698680	R	E	472	483
PSM	LICCDILDVLDK	1383	sp|P62259|1433E_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	3-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=1.1.3577.6	64.90717	2	1475.741847	1475.736388	K	H	95	107
PSM	LVSDEMVVELIEK	1384	sp|Q9WTP6|KAD2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3505.8	62.86437	2	1502.796847	1502.790197	K	N	73	86
PSM	GSFVLLDGETFEVK	1385	sp|P17563|SBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3412.14	60.27957	2	1539.790047	1539.782075	K	G	161	175
PSM	DSLLQDGEFTMDLR	1386	sp|P62962|PROF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3519.8	63.24807	2	1638.765847	1638.755937	R	T	76	90
PSM	VSILIGASQDLIPQLK	1387	sp|O88587|COMT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3608.12	65.77657	2	1694.006247	1693.997822	K	K	155	171
PSM	VGLLEALLPGQPEAVAR	1388	sp|P51855|GSHB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3621.14	66.1567	2	1731.998847	1731.988320	R	L	314	331
PSM	YVWLVYEQEQPLSCDEPILSNK	1389	sp|P70296|PEBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	14-UNIMOD:4	ms_run[1]:scan=1.1.3608.14	65.77825	3	2709.322871	2709.299620	R	S	120	142
PSM	ENTLNQLVGAAFGAAGQR	1390	sp|Q9EQ20|MMSA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3557.4	64.33942	3	1815.933671	1815.922760	K	C	299	317
PSM	SLRPGVAIADFVIFPPR	1391	sp|O09173|HGD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3496.4	62.60515	3	1854.056471	1854.051589	K	W	305	322
PSM	SLRPGVAIADFVIFPPR	1392	sp|O09173|HGD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3510.2	62.99482	3	1854.058871	1854.051589	K	W	305	322
PSM	TLISLAPGSPNPSMFPFK	1393	sp|Q9WVM8|AADAT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3624.17	66.24673	2	1903.008447	1902.991357	K	S	32	50
PSM	FLDGNELTLADCNLLPK	1394	sp|Q9Z1Q5|CLIC1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	12-UNIMOD:4	ms_run[1]:scan=1.1.3561.21	64.46843	2	1931.976647	1931.966264	K	L	167	184
PSM	IPNIYAIGDVVAGPMLAHK	1395	sp|O08749|DLDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3521.8	63.30558	3	1978.085771	1978.071004	K	A	347	366
PSM	IPNIYAIGDVVAGPMLAHK	1396	sp|O08749|DLDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3533.8	63.65095	3	1978.085771	1978.071004	K	A	347	366
PSM	EILVGDVGQTVDDPYTTFVK	1397	sp|P18760|COF1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3469.6	61.84437	3	2195.113571	2195.099781	K	M	54	74
PSM	SVNESLNNLFITEEDYQALR	1398	sp|Q68FD5|CLH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3550.12	64.1449	3	2354.157071	2354.139020	K	T	1462	1482
PSM	ETVVEVPQVTWEDIGGLEDVKR	1399	sp|Q01853|TERA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3485.16	62.30085	3	2497.286471	2497.270034	R	E	466	488
PSM	AGWTIVTPPTPVIPDDHPLWMSSK	1400	sp|Q9D964|GATM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3617.12	66.0438	3	2644.356671	2644.335946	K	W	333	357
PSM	AVNACGINCSALLQDDITAAIQCAK	1401	sp|P08905|LYZ2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	5-UNIMOD:4,9-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=1.1.3596.17	65.43758	3	2676.288671	2676.266957	R	R	91	116
PSM	DDDIAALVVDNGSGMCK	1402	sp|P60710|ACTB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=1.1.3518.19	63.22865	2	1836.7860	1836.7865	M	A	2	19
PSM	AHRFPALTPEQK	1403	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1	ms_run[1]:scan=1.1.2303.11	29.3475	3	1435.7534	1435.7567	M	K	2	14
PSM	FPALTPEQK	1404	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2440.9	33.12577	2	1029.548447	1029.549496	R	K	5	14
PSM	FPGQLNADLR	1405	sp|A2AQ07|TBB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2641.12	38.68787	2	1129.585847	1129.588007	R	K	242	252
PSM	QVVDSAYEVIK	1406	sp|P06151|LDHA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:28	ms_run[1]:scan=1.1.3189.7	54.03048	2	1232.6275	1232.6283	K	L	233	244
PSM	SIVNNGHSFNVEFDDSQDNAVLK	1407	sp|P00920|CAH2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3121.19	52.12528	3	2549.183771	2548.183010	K	G	58	81
PSM	DMAAFNERPIIFALSNPTSK	1408	sp|P06801|MAOX_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3464.12	61.71247	3	2222.134871	2221.120139	K	A	393	413
PSM	ASGVQVADEVCR	1409	sp|Q9R0P5|DEST_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1,11-UNIMOD:4	ms_run[1]:scan=1.1.2741.17	41.48982	2	1331.6113	1331.6134	M	I	2	14
PSM	LENCGITAANCK	1410	sp|Q91VI7|RINI_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	4-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=1.1.2003.21	21.04392	2	1349.604247	1349.606771	K	D	201	213
PSM	VSFELFADK	1411	sp|P17742|PPIA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.3074.3	50.79638	2	1054.534847	1054.533512	R	V	20	29
PSM	VLQATVVAVGSGGK	1412	sp|Q64433|CH10_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2443.17	33.21463	2	1284.739647	1284.740151	K	G	41	55
PSM	VNIDGGAIALGHPLGASGCR	1413	sp|Q8CAY6|THIC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	22	19-UNIMOD:4	ms_run[1]:scan=1.1.2772.12	42.3453	3	1933.9849	1933.9787	K	I	342	362
PSM	IRVDILENQAMDTR	1414	sp|P15626|GSTM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.2771.10	42.31545	3	1673.844971	1672.856654	R	I	95	109
PSM	STEPCAHLLVSSIGVVGTAEQNR	1415	sp|O35215|DOPD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22	5-UNIMOD:4	ms_run[1]:scan=1.1.2999.16	48.72066	3	2427.213971	2424.206723	K	T	53	76
PSM	AGGLATTGDK	1416	sp|Q9QXD6|F16P1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.1693.17	12.41353	2	889.445647	889.450511	K	D	292	302
PSM	AADEVAEGK	1417	sp|P97807|FUMH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.1650.12	11.21478	2	888.411447	888.418876	K	L	120	129
PSM	VHLTDAEK	1418	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	21		ms_run[1]:scan=1.1.1715.11	13.01347	2	911.4649	911.4707	M	A	2	10
PSM	VHLTDAEK	1419	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	21		ms_run[1]:scan=1.1.1708.10	12.8283	2	911.4649	911.4707	M	A	2	10
PSM	FHVEEEGK	1420	sp|P09041|PGK2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.1763.12	14.3416	2	973.446247	973.450511	R	G	124	132
PSM	RQVEIAQR	1421	sp|P16460|ASSY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.1695.16	12.4692	2	998.555847	998.562127	R	E	101	109
PSM	HAYGDQYR	1422	sp|O88844|IDHC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.1700.20	12.61125	2	1008.436647	1008.441343	R	A	133	141
PSM	VRGEVASDAK	1423	sp|P16045|LEG1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.1578.19	9.227966	2	1030.533847	1030.540723	K	S	20	30
PSM	GVNTDSGSVCR	1424	sp|Q11136|PEPD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	10-UNIMOD:4	ms_run[1]:scan=1.1.1755.21	14.1241	2	1150.498647	1150.503686	R	E	149	160
PSM	LAGESESNLRK	1425	sp|Q01853|TERA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.1741.15	13.7357	2	1202.620847	1202.625515	K	A	278	289
PSM	NAGQTCVCSNR	1426	sp|Q8BWF0|SSDH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	6-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.1670.20	11.7729	2	1265.520047	1265.524104	R	F	323	334
PSM	TATPQQAQEVHEK	1427	sp|P17751|TPIS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.1715.14	13.0168	3	1465.710971	1465.716121	K	L	226	239
PSM	AGDEFVEK	1428	sp|Q61425|HCDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.1919.14	18.69752	2	893.408447	893.413063	K	T	88	96
PSM	AGDEFVEK	1429	sp|Q61425|HCDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.1925.13	18.86397	2	893.408447	893.413063	K	T	88	96
PSM	VGEFSGANK	1430	sp|P10639|THIO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.1810.14	15.65957	2	907.433847	907.439946	K	E	86	95
PSM	NNRPSEGPLQTR	1431	sp|Q68FD5|CLH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.1791.11	15.12325	3	1367.686871	1367.690575	K	L	572	584
PSM	AAQEEYIK	1432	tr|A6ZI46|A6ZI46_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.1891.15	17.92633	2	950.466447	950.470912	K	R	378	386
PSM	HQPTAIIAK	1433	sp|P40142|TKT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.1779.18	14.7947	2	977.561047	977.565815	K	T	233	242
PSM	CATITPDEK	1434	sp|O88844|IDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	1-UNIMOD:4	ms_run[1]:scan=1.1.1841.16	16.53253	2	1033.468847	1033.475011	K	R	73	82
PSM	TNCDLYEK	1435	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	3-UNIMOD:4	ms_run[1]:scan=1.1.1877.17	17.54002	2	1041.442447	1041.443711	K	L	414	422
PSM	TCVADESAANCDK	1436	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	2-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=1.1.1818.21	15.88995	2	1439.564647	1439.565694	K	S	76	89
PSM	AVTEQGHELSNEER	1437	sp|Q9CQV8|1433B_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.1825.21	16.08838	3	1597.729571	1597.733228	K	N	30	44
PSM	VDNSSLTGESEPQTR	1438	sp|Q64436|ATP4A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2092.20	23.50025	2	1618.755847	1618.743458	K	S	222	237
PSM	VGEVIVTK	1439	sp|P63038|CH60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2047.9	22.25217	2	843.499247	843.506569	K	D	345	353
PSM	LGVTADDVK	1440	sp|P14152|MDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2101.7	23.73452	2	916.480247	916.486562	K	N	171	180
PSM	KLDEAVAEAHLGK	1441	sp|P50247|SAHH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2113.10	24.0678	3	1379.733071	1379.740879	K	L	389	402
PSM	ELSEIAQR	1442	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2051.11	22.3637	2	944.488447	944.492710	K	I	15	23
PSM	RVTLELGGK	1443	sp|O35945|AL1A7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2045.14	22.20137	2	971.569847	971.576380	K	S	265	274
PSM	EGDPDQLSKEELK	1444	sp|P97816|S100G_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2127.10	24.45828	3	1486.712471	1486.715118	K	L	21	34
PSM	TAELLSHHQVEIK	1445	sp|Q64516|GLPK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2123.17	24.35527	3	1503.800171	1503.804542	K	Q	32	45
PSM	HELQANCYEEVK	1446	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	7-UNIMOD:4	ms_run[1]:scan=1.1.2029.11	21.7578	3	1518.675371	1518.677293	K	D	133	145
PSM	ITQSNAILR	1447	sp|P10649|GSTM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2105.15	23.85215	2	1014.576447	1014.582194	K	Y	70	79
PSM	TAVCDIPPR	1448	sp|P68372|TBB4B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	4-UNIMOD:4	ms_run[1]:scan=1.1.2148.16	25.05513	2	1027.507047	1027.512065	K	G	351	360
PSM	SVEAAAELSAK	1449	sp|Q9D0J8|PTMS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2135.18	24.68763	2	1074.551247	1074.555704	K	D	5	16
PSM	EGWVEQDPK	1450	sp|Q64516|GLPK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2141.15	24.85643	2	1086.494047	1086.498189	R	E	50	59
PSM	VCNLIDSGTK	1451	sp|Q9EQ20|MMSA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	2-UNIMOD:4	ms_run[1]:scan=1.1.2152.17	25.16997	2	1105.540047	1105.543759	R	E	367	377
PSM	FCETTIGCK	1452	sp|P13707|GPDA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	2-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.2106.19	23.88295	2	1114.474847	1114.478717	K	D	161	170
PSM	IAVAAQNCYK	1453	sp|P17751|TPIS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	8-UNIMOD:4	ms_run[1]:scan=1.1.2033.20	21.87627	2	1136.560447	1136.564829	K	V	110	120
PSM	LKDDEVAQLR	1454	sp|P16125|LDHB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2076.8	23.04687	3	1185.629471	1185.635351	K	K	309	319
PSM	LVEVNGENVEK	1455	sp|P70441|NHRF1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2145.20	24.97388	2	1228.625247	1228.629932	R	E	59	70
PSM	TESEGHCPTHIAVLCR	1456	sp|Q9DC50|OCTC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	7-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=1.1.2103.20	23.8009	3	1865.854271	1865.851252	K	G	182	198
PSM	EHCIVNYQVK	1457	sp|Q8R1G2|CMBL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	3-UNIMOD:4	ms_run[1]:scan=1.1.2113.20	24.07615	2	1288.619247	1288.623407	K	T	196	206
PSM	EVQGNESETFR	1458	sp|Q62468|VILI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.1975.18	20.26638	2	1294.577647	1294.578959	R	S	98	109
PSM	SRNDQVVTDLR	1459	sp|Q91YI0|ARLY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2007.10	21.14828	3	1301.661971	1301.668777	R	L	112	123
PSM	HGESAWNLENR	1460	sp|Q9DBJ1|PGAM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2129.8	24.51115	3	1311.587471	1311.595612	R	F	11	22
PSM	IYIDSNNNPER	1461	sp|Q68FD5|CLH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2156.20	25.2866	2	1333.623047	1333.626243	K	F	882	893
PSM	NNASTDYDLSDK	1462	sp|P27659|RL3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2083.20	23.24858	2	1341.565247	1341.568454	K	S	301	313
PSM	YAQVKPDGTYVK	1463	sp|Q9R0H0|ACOX1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2032.14	21.84388	3	1367.697671	1367.708516	K	P	256	268
PSM	LQTCCDKPLLK	1464	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	4-UNIMOD:4,5-UNIMOD:4	ms_run[1]:scan=1.1.2029.8	21.7553	3	1374.696071	1374.699943	K	K	299	310
PSM	TLEEDAHQQIAR	1465	sp|Q9DCG6|PBLD1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2055.11	22.46968	3	1409.692271	1409.689906	R	E	29	41
PSM	RDPHLACVAYER	1466	sp|Q68FD5|CLH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	7-UNIMOD:4	ms_run[1]:scan=1.1.2012.15	21.29373	3	1485.711071	1485.714681	K	G	912	924
PSM	FNSANEDNVTQVR	1467	sp|P24270|CATA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2153.20	25.20107	2	1492.691447	1492.690634	R	T	432	445
PSM	KLTEIINTQHENVK	1468	sp|P13707|GPDA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2066.20	22.78085	3	1665.903671	1665.904984	R	Y	49	63
PSM	QGTFHSQQALEYGTK	1469	sp|Q9WUM5|SUCA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2125.21	24.41308	2	1693.807247	1693.805999	K	L	67	82
PSM	IQVLQQQADDAEER	1470	tr|D3Z2H9|D3Z2H9_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2356.21	30.82005	2	1641.803247	1641.795828	K	A	14	28
PSM	KCPFTGNVSIR	1471	sp|P62281|RS11_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	2-UNIMOD:4	ms_run[1]:scan=1.1.2195.7	26.37713	3	1277.650271	1277.655041	K	G	59	70
PSM	ADEGISFR	1472	sp|P35700|PRDX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2264.6	28.26698	2	893.418847	893.424296	K	G	121	129
PSM	LSDGVAVLK	1473	sp|P63038|CH60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2326.7	29.98335	2	900.522447	900.528033	K	V	397	406
PSM	CLHSVGCPLPLK	1474	sp|Q9Z2V4|PCKGC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	1-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=1.1.2368.5	31.12965	3	1379.701271	1379.705363	K	K	192	204
PSM	DSQGNLFR	1475	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2242.12	27.6665	2	935.441847	935.446094	K	N	88	96
PSM	ALAVSDLNR	1476	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2287.7	28.9031	2	957.519847	957.524344	K	A	1062	1071
PSM	DGGGDVAFVK	1477	sp|Q921I1|TRFE_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2310.10	29.54122	2	963.462247	963.466161	K	H	216	226
PSM	LTAAVDELR	1478	sp|Q99MZ7|PECR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2370.12	31.1902	2	986.533247	986.539660	R	A	55	64
PSM	SCNCLLLK	1479	sp|P17182|ENOA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	2-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=1.1.2295.13	29.1244	2	1006.489847	1006.493973	K	V	336	344
PSM	IGGHGAEYGAEALER	1480	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2226.12	27.23198	3	1528.729271	1528.727020	K	M	18	33
PSM	NTYYASIAK	1481	sp|P45952|ACADM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2182.14	26.01552	2	1029.510447	1029.513111	R	A	350	359
PSM	LGPGVSDICK	1482	sp|Q61207|SAP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	9-UNIMOD:4	ms_run[1]:scan=1.1.2299.13	29.23568	2	1044.522847	1044.527381	R	N	232	242
PSM	HLFTGPALSK	1483	sp|P35505|FAAA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2238.9	27.56038	2	1069.588647	1069.592030	K	H	48	58
PSM	EVNLAVENAK	1484	sp|Q9JLJ2|AL9A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2175.19	25.82443	2	1085.566647	1085.571688	K	A	50	60
PSM	EALLSSAVDHGSDEAR	1485	sp|P80314|TCPB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2313.16	29.62798	3	1655.775371	1655.775092	R	F	139	155
PSM	VVAGVAAALAHK	1486	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2253.3	27.96397	3	1105.655771	1105.660778	K	Y	134	146
PSM	VVAGVAAALAHK	1487	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2226.13	27.23282	2	1105.658447	1105.660778	K	Y	134	146
PSM	LQNLQLQPGK	1488	sp|P32020|NLTP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2316.13	29.7083	2	1137.645247	1137.650607	K	A	535	545
PSM	RLPEAIEEVK	1489	sp|Q91Z53|GRHPR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2254.18	28.00408	2	1182.656847	1182.660838	R	N	125	135
PSM	QHGIPIPVTPK	1490	sp|P16460|ASSY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2316.2	29.69912	3	1185.681071	1185.686993	K	S	166	177
PSM	GLETTATYDPK	1491	sp|Q9R0H0|ACOX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2182.20	26.02052	2	1194.574647	1194.576833	R	T	149	160
PSM	TREDLDDLVR	1492	sp|Q91X52|DCXR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2364.15	31.03158	2	1230.619447	1230.620430	R	E	40	50
PSM	VAGQDGSVVQFK	1493	sp|P61957|SUMO2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2334.19	30.21937	2	1233.632247	1233.635351	K	I	22	34
PSM	SLNPELGTDADK	1494	sp|P06151|LDHA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2249.18	27.86475	2	1258.602447	1258.604111	K	E	213	225
PSM	ANIIYPGHGPVIHNAEAK	1495	sp|Q99KR3|LACB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2221.20	27.1003	3	1899.999671	1899.995531	K	I	192	210
PSM	ATAGAYIASQTVK	1496	sp|O55234|PSB5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2246.18	27.78125	2	1279.678247	1279.677216	R	K	79	92
PSM	DLGLAQDSATSTK	1497	sp|Q99L13|3HIDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2302.17	29.32407	2	1305.637247	1305.641225	K	T	284	297
PSM	GVQVETISPGDGR	1498	sp|P26883|FKB1A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	21		ms_run[1]:scan=1.1.2304.20	29.38343	2	1313.6561	1313.6570	M	T	2	15
PSM	EEAQAEIEQYR	1499	sp|Q9CR51|VATG1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2323.20	29.9103	2	1364.620647	1364.620824	K	L	38	49
PSM	LQPTDSFTQSSR	1500	sp|Q9DCG6|PBLD1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2274.20	28.5551	2	1365.649447	1365.652458	K	F	53	65
PSM	VSAQGITLTDNQR	1501	tr|E9Q0S6|E9Q0S6_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2350.19	30.6531	2	1401.728447	1401.721206	K	K	1794	1807
PSM	GGGALVENTTTGLSR	1502	sp|Q60866|PTER_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2353.21	30.73787	2	1431.731847	1431.731771	K	D	91	106
PSM	RVMVDANEVPIQK	1503	sp|Q9D964|GATM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2321.20	29.854	2	1497.797847	1497.797348	K	M	369	382
PSM	IWHHTFYNELR	1504	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2329.20	30.07852	3	1514.740271	1514.741882	K	V	85	96
PSM	SALEHSVQCAVDVK	1505	sp|P24270|CATA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	9-UNIMOD:4	ms_run[1]:scan=1.1.2330.21	30.10757	2	1541.750847	1541.750792	R	R	417	431
PSM	IQALQQQADDAEDR	1506	sp|Q6IRU2|TPM4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2197.21	26.44493	2	1599.748447	1599.748878	K	A	14	28
PSM	EIVHIQAGQCGNQIGAK	1507	sp|P99024|TBB5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	10-UNIMOD:4	ms_run[1]:scan=1.1.2279.16	28.69122	3	1821.916871	1821.915566	R	F	3	20
PSM	AVDNQVYVATASPARDDK	1508	sp|Q9JHW2|NIT2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2211.11	26.82508	3	1918.946171	1918.938469	R	A	196	214
PSM	ALEVLVAK	1509	sp|Q9JII6|AK1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2445.4	33.2588	2	841.522447	841.527304	K	G	146	154
PSM	INGEWHTIILASDKR	1510	sp|A2BIM8|MUP18_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2553.4	36.23805	4	1751.929294	1751.931868	K	E	34	49
PSM	AAVSGLWGK	1511	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2446.5	33.28728	2	887.482847	887.486502	K	V	10	19
PSM	SPAQILIR	1512	sp|Q9DCT1|AKCL2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2489.8	34.46033	2	896.539647	896.544351	K	F	229	237
PSM	SPAQILIR	1513	sp|Q9DCT1|AKCL2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2495.8	34.6272	2	896.539647	896.544351	K	F	229	237
PSM	FGEPIPISK	1514	sp|P35505|FAAA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2570.7	36.71397	2	986.539247	986.543683	R	A	212	221
PSM	PMQFLGDEETVRK	1515	sp|Q9DBJ1|PGAM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2435.10	32.98802	3	1548.761171	1548.760628	K	A	229	242
PSM	KPLIVFTPK	1516	tr|E9Q7L0|E9Q7L0_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2374.15	31.30253	2	1041.655247	1041.658653	R	S	857	866
PSM	GDFCIQVGR	1517	sp|P15532|NDKA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	4-UNIMOD:4	ms_run[1]:scan=1.1.2572.7	36.77037	2	1050.487847	1050.491664	R	N	106	115
PSM	GHILVDEFQNTNVK	1518	sp|P47791|GSHR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2520.9	35.32902	3	1612.818671	1612.820920	K	G	333	347
PSM	EIDGGLETLR	1519	sp|Q9DCW4|ETFB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2572.9	36.77203	2	1101.564247	1101.566603	R	L	165	175
PSM	TYFQGSLPAR	1520	sp|P52760|RIDA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2478.11	34.15842	2	1138.574647	1138.577108	K	A	98	108
PSM	LSASEALGSAALPSHSSAISQHSK	1521	sp|Q9CQX8|RT36_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2465.7	33.81388	4	2335.188094	2335.176802	K	G	33	57
PSM	SWNALAAPSEK	1522	sp|P28271|ACOC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2468.8	33.88605	2	1172.579847	1172.582588	K	L	622	633
PSM	NMEEEVAITR	1523	sp|Q60597|ODO1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2377.15	31.38453	2	1190.556647	1190.560138	R	I	920	930
PSM	SAGACTAAAFLR	1524	sp|Q9CPY7|AMPL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	5-UNIMOD:4	ms_run[1]:scan=1.1.2572.13	36.77538	2	1194.580047	1194.581542	R	E	458	470
PSM	HLSVNDLPVGR	1525	sp|P20108|PRDX3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2420.20	32.58208	2	1205.649047	1205.651670	K	S	198	209
PSM	LFEASVETGDR	1526	sp|Q9CPY7|AMPL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2408.16	32.24687	2	1222.580447	1222.582981	K	V	418	429
PSM	AGNLGGGVVTIER	1527	sp|P67984|RL22_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2487.18	34.412	2	1241.668647	1241.672800	K	S	53	66
PSM	VGGVQSLGGTGALR	1528	sp|P05201|AATC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2438.21	33.08028	2	1270.697247	1270.699349	R	I	101	115
PSM	LSSTWEGIQAGK	1529	sp|Q93092|TALDO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2531.18	35.64673	2	1275.644447	1275.645916	K	E	143	155
PSM	VNADEVGGEALGR	1530	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2373.19	31.27857	2	1285.624647	1285.626243	K	L	19	32
PSM	INQFYGAPTAVR	1531	sp|Q99NB1|ACS2L_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2549.19	36.14238	2	1335.692847	1335.693535	K	L	374	386
PSM	VSVISVEEPPQR	1532	sp|Q9DCW4|ETFB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2528.19	35.56322	2	1338.711847	1338.714330	K	S	222	234
PSM	ILYSQCGDVMR	1533	sp|Q60605|MYL6_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	6-UNIMOD:4	ms_run[1]:scan=1.1.2459.14	33.65043	2	1340.627447	1340.621692	K	A	27	38
PSM	EGLELPEDEEEK	1534	sp|P07901|HS90A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2558.19	36.38748	2	1415.631647	1415.630385	K	K	548	560
PSM	ASNTSEVYFDGVK	1535	sp|P50544|ACADV_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2504.17	34.88288	2	1415.658847	1415.656875	K	V	305	318
PSM	GAQVIENCAVTGIR	1536	sp|Q99LB7|SARDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	8-UNIMOD:4	ms_run[1]:scan=1.1.2527.20	35.53563	2	1486.755247	1486.756212	R	V	229	243
PSM	FHQLDIDNPQSIR	1537	sp|P48758|CBR1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2535.8	35.74882	3	1581.790871	1581.789955	R	A	59	72
PSM	SSVVPVEGCPELPHK	1538	sp|Q99K67|AASS_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	9-UNIMOD:4	ms_run[1]:scan=1.1.2470.7	33.93985	3	1633.813571	1633.813392	K	L	334	349
PSM	NVTELNEPLSNEER	1539	sp|P61982|1433G_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2472.21	34.00215	2	1642.785047	1642.779843	K	N	29	43
PSM	TFTTQETITNAETAK	1540	sp|P06745|G6PI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2408.21	32.25103	2	1654.808247	1654.804996	K	E	212	227
PSM	LSGAQADLHIGEGDSIR	1541	sp|Q9DCM0|ETHE1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2507.12	34.96237	3	1737.862571	1737.864576	R	F	105	122
PSM	KFNALFAQGNYSEAAK	1542	sp|Q68FD5|CLH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2550.15	36.17105	2	1757.868447	1757.873684	R	V	367	383
PSM	HLEINPDHPIVETLR	1543	sp|P11499|HS90B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2600.3	37.54987	4	1781.946094	1781.942433	K	Q	625	640
PSM	ALAEGVLLR	1544	sp|P51855|GSHB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2638.8	38.59925	2	940.566647	940.570566	R	S	26	35
PSM	IGLFGGAGVGK	1545	sp|P56480|ATPB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2722.10	40.95487	2	974.551047	974.554916	K	T	202	213
PSM	DVNAAIAAIK	1546	sp|P68368|TBA4A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2714.6	40.72128	2	984.557047	984.560395	K	T	327	337
PSM	KVNLAELFK	1547	sp|P99029|PRDX5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2741.8	41.4823	2	1060.626647	1060.628081	K	G	71	80
PSM	EIDGGLETLR	1548	sp|Q9DCW4|ETFB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2578.8	36.94062	2	1101.564247	1101.566603	R	L	165	175
PSM	EIEIDIEPTDKVER	1549	sp|P29595|NEDD8_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2698.8	40.26512	3	1684.850171	1684.851946	K	I	12	26
PSM	PAQVTPLTALK	1550	sp|Q8K009|AL1L2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2598.9	37.5001	2	1137.672447	1137.675760	K	F	619	630
PSM	VITSGFNALEK	1551	sp|Q9WVL0|MAAI_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2596.11	37.44638	2	1177.630647	1177.634289	K	I	134	145
PSM	GNPAAVCLLER	1552	sp|Q9CXN7|PBLD2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	7-UNIMOD:4	ms_run[1]:scan=1.1.2631.13	38.40803	2	1198.613047	1198.612842	R	T	18	29
PSM	ITVTSEVPFSK	1553	sp|P67984|RL22_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2700.11	40.32442	2	1206.648447	1206.649604	K	R	70	81
PSM	GVLFASGQNLAR	1554	sp|Q9CPY7|AMPL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2643.19	38.75037	2	1231.665447	1231.667320	K	H	189	201
PSM	PVIGSEYPLEK	1555	sp|P47199|QOR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2588.16	37.22362	2	1230.643847	1230.649604	K	A	299	310
PSM	KAVLGPLVGAVDQGTSSTR	1556	sp|Q64516|GLPK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2657.16	39.1421	3	1855.013171	1855.016326	K	F	6	25
PSM	YMACCLLYR	1557	sp|P05213|TBA1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	4-UNIMOD:4,5-UNIMOD:4	ms_run[1]:scan=1.1.2755.16	41.87375	2	1248.545847	1248.545356	K	G	312	321
PSM	DFTPAAQAAFQK	1558	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2674.11	39.60172	2	1293.637647	1293.635351	K	V	122	134
PSM	VAPEEHPVLLTEAPLNPK	1559	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2761.19	42.0438	3	1953.075671	1953.057128	R	A	96	114
PSM	IMNTFSVVPSPK	1560	sp|P68372|TBB4B_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	2-UNIMOD:35	ms_run[1]:scan=1.1.2661.7	39.24847	2	1334.687847	1334.690424	R	V	163	175
PSM	INDAFLHVMQR	1561	sp|Q3UNZ8|QORL2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2713.16	40.70075	2	1342.680047	1342.681590	K	K	329	340
PSM	ASDTSITWNNLK	1562	sp|Q921I1|TRFE_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2666.11	39.3848	2	1348.656047	1348.662294	K	G	456	468
PSM	LAGCTVFITGASR	1563	sp|Q2TPA8|HSDL2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	4-UNIMOD:4	ms_run[1]:scan=1.1.2686.9	39.94338	2	1351.696247	1351.691821	K	G	8	21
PSM	DIEPGSPAEAAGLK	1564	sp|Q9JIL4|NHRF3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2597.19	37.48092	2	1353.680247	1353.677610	K	N	270	284
PSM	AALEALGSCLNNK	1565	sp|Q9CZN7|GLYM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	9-UNIMOD:4	ms_run[1]:scan=1.1.2635.16	38.5223	2	1359.681447	1359.681650	R	Y	83	96
PSM	ISDEDWDIIHR	1566	sp|P51660|DHB4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2757.3	41.91817	3	1397.651771	1397.657543	R	V	111	122
PSM	YYVTIIDAPGHR	1567	sp|P10126|EF1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2587.8	37.189	3	1403.716571	1403.719750	K	D	85	97
PSM	TINEVENQILTR	1568	sp|P57780|ACTN4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2764.19	42.12783	2	1428.755047	1428.757257	R	D	747	759
PSM	LTGFHETSNINDFSAGVANR	1569	sp|P15105|GLNA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2713.18	40.70242	3	2149.027271	2149.018845	R	G	300	320
PSM	LVPGWTKPITIGR	1570	sp|P54071|IDHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2770.4	42.28259	3	1436.848571	1436.850370	R	H	160	173
PSM	THLPGFVEQAGALK	1571	sp|P99029|PRDX5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2668.5	39.43073	3	1466.787371	1466.788164	K	A	99	113
PSM	VWCTSLHPELVR	1572	sp|Q91WR5|AK1CL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	3-UNIMOD:4	ms_run[1]:scan=1.1.2657.10	39.1371	3	1495.756271	1495.760569	K	A	85	97
PSM	LINSLYPEGQAPVK	1573	sp|Q9WVA4|TAGL2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2713.20	40.70408	2	1527.832847	1527.829694	K	K	65	79
PSM	NSCPPTAELLGSPGR	1574	sp|P46412|GPX3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	3-UNIMOD:4	ms_run[1]:scan=1.1.2618.15	38.05824	2	1554.748447	1554.746041	K	L	154	169
PSM	LQCTYIEVEQVGK	1575	sp|Q8VCA8|SCRN2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	3-UNIMOD:4	ms_run[1]:scan=1.1.2702.20	40.38923	2	1565.779247	1565.775944	R	T	57	70
PSM	QDFPGQSSGFEYSR	1576	sp|Q8VCN5|CGL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2651.21	38.97902	2	1603.696047	1603.690300	K	S	48	62
PSM	MISSYVGENAEFER	1577	sp|Q9D0K2|SCOT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2725.21	41.04992	2	1630.735047	1630.729722	R	Q	111	125
PSM	NQVAMNPTNTVFDAK	1578	sp|P63017|HSP7C_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2693.15	40.1376	2	1648.792047	1648.787906	K	R	57	72
PSM	MDENQFVAVTSTNAAK	1579	sp|O08553|DPYL2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2681.21	39.80938	2	1724.816447	1724.803950	K	V	375	391
PSM	SSFANQGEICLCTSR	1580	sp|Q8BH00|AL8A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	10-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.2644.20	38.77937	2	1728.764247	1728.755954	R	I	278	293
PSM	VSHVSTGGGASLELLEGK	1581	sp|P09041|PGK2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2576.13	36.88847	3	1739.906471	1739.905378	K	I	389	407
PSM	NTYGTGCFLLCNTGHK	1582	sp|Q64516|GLPK_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	7-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=1.1.2576.14	36.8893	3	1841.822471	1841.818889	K	C	283	299
PSM	AGDELTKIEDEDEQGWCK	1583	sp|Q9WVE8|PACN2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	17-UNIMOD:4	ms_run[1]:scan=1.1.2771.19	42.32297	3	2121.922871	2121.916079	K	G	449	467
PSM	TSRPENAIIYSNNEDFQVGQAK	1584	sp|P40142|TKT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2640.21	38.6669	3	2480.214371	2480.193181	R	V	472	494
PSM	ITESIGCVMTGMTADSR	1585	sp|Q9QUM9|PSA6_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	7-UNIMOD:4	ms_run[1]:scan=1.1.2988.12	48.42522	2	1827.811447	1827.816505	K	S	72	89
PSM	DVTLGSVLGR	1586	sp|Q9R0H0|ACOX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2989.3	48.43873	2	1015.560447	1015.566209	K	Y	614	624
PSM	TCLLIVFSK	1587	sp|P62746|RHOB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	2-UNIMOD:4	ms_run[1]:scan=1.1.3175.3	53.63757	2	1079.603247	1079.604903	K	D	19	28
PSM	AVAIDLPGLGR	1588	sp|Q8VCR7|ABHEB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3078.3	50.90893	2	1080.625647	1080.629144	R	S	64	75
PSM	MLLFTEVTR	1589	sp|Q61598|GDIB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3065.5	50.54	2	1108.592647	1108.595066	K	Y	90	99
PSM	VLITTDLLAR	1590	sp|P10630|IF4A2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3060.5	50.40015	2	1113.671047	1113.675760	R	G	326	336
PSM	SGEYPFPLIK	1591	sp|P45952|ACADM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3081.5	50.9956	2	1149.607447	1149.607011	K	R	70	80
PSM	YIIWSPVCR	1592	sp|P11352|GPX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	8-UNIMOD:4	ms_run[1]:scan=1.1.3041.9	49.87248	2	1192.608047	1192.606300	K	N	147	156
PSM	IAEFAFEYAR	1593	sp|Q9D6R2|IDH3A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2997.10	48.65967	2	1215.591447	1215.592424	R	N	179	189
PSM	TDGLVSLLTTSK	1594	sp|Q9R0N0|GALK1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3140.9	52.65553	2	1233.678447	1233.681633	R	D	69	81
PSM	FLASVSTVLTSK	1595	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3012.5	49.08195	2	1251.707847	1251.707454	K	Y	129	141
PSM	AITGASLADIMAK	1596	sp|Q8BP67|RL24_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3047.12	50.04697	2	1260.673647	1260.674773	R	R	81	94
PSM	QLLCDLVGISR	1597	sp|Q99K67|AASS_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	4-UNIMOD:4	ms_run[1]:scan=1.1.3167.10	53.42145	2	1272.689847	1272.686007	K	S	762	773
PSM	IFNTWLGDPSK	1598	sp|P61922|GABT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3053.11	50.21528	2	1276.646247	1276.645188	R	N	378	389
PSM	GIVNEQFLLQR	1599	sp|P50544|ACADV_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2996.9	48.63138	2	1315.727647	1315.724835	K	L	558	569
PSM	DPSGGPVSLDFVK	1600	sp|Q99LB7|SARDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3086.12	51.14533	2	1316.662247	1316.661232	R	N	873	886
PSM	NATTDALTSVLTK	1601	sp|G5E8K5|ANK3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2999.10	48.71565	2	1333.703047	1333.708910	K	I	1536	1549
PSM	YQIPALAQAGFR	1602	sp|P34914|HYES_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3110.11	51.81685	2	1333.716447	1333.714270	R	V	274	286
PSM	VCLLGCGISTGYGAAVNTAK	1603	sp|P28474|ADHX_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	2-UNIMOD:4,6-UNIMOD:4	ms_run[1]:scan=1.1.3036.14	49.73418	3	2010.993371	2010.986683	K	V	169	189
PSM	LLLDGAPLIAIHK	1604	sp|Q3UGR5|HDHD2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3150.3	52.93835	3	1372.837871	1372.844222	R	A	133	146
PSM	DDGSWEVIEGYR	1605	sp|P26443|DHE3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3159.14	53.20682	2	1424.624447	1424.620824	R	A	125	137
PSM	AVAQAGTVGTLLIVK	1606	sp|Q8VC30|TKFC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3008.14	48.97323	2	1439.877847	1439.871165	R	N	95	110
PSM	LVTGWVKPIIIGR	1607	sp|O88844|IDHC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3014.7	49.13655	2	1450.907247	1450.902406	R	H	120	133
PSM	NFNTVPYIVGINK	1608	tr|D3Z298|D3Z298_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3130.15	52.37745	2	1477.796047	1477.792915	K	Q	340	353
PSM	EILQSVYECIEK	1609	sp|Q64516|GLPK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	9-UNIMOD:4	ms_run[1]:scan=1.1.3128.13	52.31902	2	1509.745647	1509.738496	K	T	59	71
PSM	LVWIETPTNPTLK	1610	sp|Q8VCN5|CGL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3131.17	52.40753	2	1510.843447	1510.839531	K	L	152	165
PSM	NSTLTFVTMSGELK	1611	sp|Q9DCG6|PBLD1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3114.11	51.92496	2	1526.767847	1526.765045	R	A	98	112
PSM	VPSENVLGEVGDGFK	1612	sp|P50544|ACADV_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3029.12	49.53923	2	1545.773447	1545.767488	K	V	318	333
PSM	QCFLYMVCQTAK	1613	sp|Q9DCY0|KEG1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	2-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.3002.17	48.80675	2	1547.697247	1547.693477	K	K	129	141
PSM	IIPGFMCQGGDFTR	1614	sp|P17742|PPIA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	7-UNIMOD:4	ms_run[1]:scan=1.1.3092.20	51.32347	2	1597.745447	1597.738119	R	H	56	70
PSM	VINEPTAAALAYGLDK	1615	sp|P38647|GRP75_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3085.19	51.12232	2	1644.882247	1644.872287	R	S	219	235
PSM	HSGNITFDEIVNIAR	1616	sp|P35979|RL12_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3124.5	52.19858	3	1684.856771	1684.853283	K	Q	100	115
PSM	LLGNMIVIVLGHHLGK	1617	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	5-UNIMOD:35	ms_run[1]:scan=1.1.3014.3	49.12988	3	1729.006271	1729.007282	R	D	106	122
PSM	LGPNYLQIPVNCPYR	1618	sp|P24270|CATA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	12-UNIMOD:4	ms_run[1]:scan=1.1.3183.20	53.87608	2	1802.925847	1802.913775	R	A	366	381
PSM	TFPTVNPSTGEVICQVAEGNKEDVDK	1619	sp|P47738|ALDH2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	14-UNIMOD:4	ms_run[1]:scan=1.1.3024.19	49.41182	3	2833.360271	2833.344004	K	A	55	81
PSM	ECDVLPDDTVSTLYNR	1620	sp|Q8R0Y6|AL1L1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	2-UNIMOD:4	ms_run[1]:scan=1.1.3054.21	50.25083	2	1895.865447	1895.857108	K	F	151	167
PSM	AGDEIICMDEVYGGTNR	1621	sp|Q8VCN5|CGL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	7-UNIMOD:4	ms_run[1]:scan=1.1.3030.19	49.5723	2	1898.828647	1898.813863	K	Y	102	119
PSM	TLSPGDSFSTFDTPYCK	1622	sp|Q9JHW2|NIT2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	16-UNIMOD:4	ms_run[1]:scan=1.1.3067.21	50.61083	2	1921.852047	1921.840395	K	V	131	148
PSM	IFNNGADLSGITEENAPLK	1623	sp|P07758|A1AT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3076.21	50.86768	2	2002.011447	2002.000735	R	L	329	348
PSM	AAVPSGASTGIYEALELRDNDK	1624	sp|P17182|ENOA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3002.16	48.80592	3	2276.139971	2276.128455	R	T	33	55
PSM	SHSNQLVTDCISAMNPDTVLR	1625	sp|Q9Z0S1|BPNT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	10-UNIMOD:4	ms_run[1]:scan=1.1.3031.17	49.59785	3	2357.121671	2357.110379	R	V	197	218
PSM	DDNPSLPPFERPEAEAMCTSFK	1626	sp|P07724|ALBU_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	18-UNIMOD:4	ms_run[1]:scan=1.1.3144.18	52.77794	3	2537.141471	2537.120275	K	E	131	153
PSM	AYHEQLSVAEITNACFEPANQMVK	1627	sp|P05213|TBA1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	15-UNIMOD:4	ms_run[1]:scan=1.1.3121.20	52.12612	3	2749.303571	2749.283987	K	C	281	305
PSM	HTGPGILSMANAGPNTNGSQFFICTAK	1628	sp|P17742|PPIA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	24-UNIMOD:4	ms_run[1]:scan=1.1.3168.21	53.45817	3	2790.349571	2790.321769	K	T	92	119
PSM	SRQDLFAVDTQTGSVTSLTAGGSAGSWK	1629	sp|Q8R146|APEH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3126.21	52.26877	3	2826.392771	2826.378415	R	L	384	412
PSM	VKPGYLGTAFAHYDVQVIDEQGNVLPPGK	1630	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3159.17	53.20932	4	3111.629694	3111.602936	K	E	379	408
PSM	DLEDLQILIK	1631	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3543.6	63.93758	2	1198.683847	1198.680905	K	V	578	588
PSM	LASDLLEWIR	1632	sp|P57780|ACTN4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3588.2	65.20465	2	1214.666847	1214.665923	R	R	302	312
PSM	DLFQVIYNVK	1633	sp|P98078|DAB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3558.6	64.36995	2	1237.673647	1237.670674	K	K	164	174
PSM	LLVPYLIEAVR	1634	sp|Q61425|HCDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3575.6	64.85046	2	1284.783847	1284.780559	R	L	222	233
PSM	LLVPYLIEAVR	1635	sp|Q61425|HCDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3581.3	65.01562	2	1284.783847	1284.780559	R	L	222	233
PSM	FFPLEAWQIGK	1636	sp|O35215|DOPD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3564.5	64.53985	2	1334.706447	1334.702309	R	K	100	111
PSM	HPDEPVLLEEPVVLALAEK	1637	sp|Q9JII6|AK1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3580.7	64.9915	3	2097.156371	2097.135772	R	H	222	241
PSM	GTIEILSDVQLIK	1638	sp|P14869|RLA0_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3449.10	61.29433	2	1427.827047	1427.823546	R	T	150	163
PSM	LICCDILDVLDK	1639	sp|P62259|1433E_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	3-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=1.1.3565.7	64.56955	2	1475.741847	1475.736388	K	H	95	107
PSM	LDQLIYIPLPDEK	1640	sp|Q01853|TERA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3527.11	63.48067	2	1555.858247	1555.849761	R	S	639	652
PSM	VVLAYEPVWAIGTGK	1641	sp|P17751|TPIS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3420.18	60.5143	2	1601.891047	1601.881730	K	T	211	226
PSM	HLVDPIDDIFLAAQK	1642	sp|Q8BH86|GLUCM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3461.2	61.62283	3	1693.908371	1693.903922	K	I	456	471
PSM	AVFVDLEPTVIDEVR	1643	sp|P05213|TBA1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3493.19	62.53082	2	1700.910047	1700.898502	R	T	65	80
PSM	AASDLQIAASTFTSFGK	1644	sp|Q9DC50|OCTC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3424.18	60.62638	2	1713.863447	1713.857366	K	K	390	407
PSM	ALALAQEILPQAPIAVR	1645	sp|Q3TLP5|ECHD2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3504.8	62.84137	2	1773.057247	1773.051255	R	L	228	245
PSM	QGLLPLTFADPSDYNK	1646	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3505.14	62.8702	2	1777.901247	1777.888666	K	I	702	718
PSM	DAGYEFDICFTSVQK	1647	sp|Q9DBJ1|PGAM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	9-UNIMOD:4	ms_run[1]:scan=1.1.3423.18	60.59865	2	1778.790647	1778.782152	R	R	47	62
PSM	EEFQQFAGLLQAGIEK	1648	sp|P47199|QOR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3608.5	65.77074	3	1806.918371	1806.915215	K	G	279	295
PSM	KEGGLGPLNIPLLADVTK	1649	sp|Q61171|PRDX2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3486.4	62.31893	3	1834.062971	1834.056400	R	S	92	110
PSM	SWIEEQEMGSFLSVAK	1650	sp|Q9CPY7|AMPL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3544.15	63.9741	2	1839.885447	1839.871301	K	G	238	254
PSM	SLRPGVAIADFVIFPPR	1651	sp|O09173|HGD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3517.6	63.18947	3	1854.058871	1854.051589	K	W	305	322
PSM	YVASYLLAALGGNSSPSAK	1652	tr|A0A5F8MPY2|A0A5F8MPY2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3465.21	61.7473	2	1867.974047	1867.967979	R	D	3	22
PSM	AMTTFLSTLGAQCVIASR	1653	sp|Q9CQ62|DECR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	13-UNIMOD:4	ms_run[1]:scan=1.1.3479.5	62.12107	3	1925.976071	1925.970304	K	N	74	92
PSM	FLDGNELTLADCNLLPK	1654	sp|Q9Z1Q5|CLIC1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	12-UNIMOD:4	ms_run[1]:scan=1.1.3555.14	64.29588	2	1931.976647	1931.966264	K	L	167	184
PSM	HGYPLILYDVFPDVCK	1655	sp|Q99L13|3HIDH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	15-UNIMOD:4	ms_run[1]:scan=1.1.3555.4	64.2817	3	1934.971871	1934.960057	K	E	60	76
PSM	VKPIWPIGMFSGYVDNPK	1656	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3502.8	62.78173	3	2047.071971	2047.060105	R	K	415	433
PSM	ISQAEEDDQQLLGHLLLVAK	1657	sp|Q9D0S9|HINT2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3464.11	61.71163	3	2219.198471	2219.179762	R	K	100	120
PSM	INESIGQGDLSELPELHALTAGLK	1658	sp|Q9R0H0|ACOX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3522.13	63.33853	3	2504.331371	2504.312233	R	A	355	379
PSM	IITITGTQDQIQNAQYLLQNSVK	1659	sp|P61979|HNRPK_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3560.20	64.4391	3	2588.400371	2588.380982	R	Q	434	457
PSM	CCSGSLVER	1660	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:4	ms_run[1]:scan=1.1.2452.8	33.4591	2	1049.4227	1049.4265	K	R	500	509
PSM	IGAEVYHNLK	1661	sp|P17182|ENOA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2098.4	23.64955	3	1142.610371	1142.608408	R	N	184	194
PSM	ANHAPFETDISTLTR	1662	sp|Q9QXD6|F16P1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:1	ms_run[1]:scan=1.1.3087.21	51.18185	2	1713.8413	1713.8317	M	F	2	17
PSM	QHGIPIPVTPK	1663	sp|P16460|ASSY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:28	ms_run[1]:scan=1.1.2709.13	40.5841	2	1168.6605	1168.6599	K	S	166	177
PSM	QLFHPEQLITGKEDAANNYAR	1664	sp|P68369|TBA1A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:28	ms_run[1]:scan=1.1.3114.15	51.92999	3	2397.1922	2397.1712	R	G	85	106
PSM	RTIQFVDWCPTGFK	1665	sp|P05214|TBA3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21	9-UNIMOD:4	ms_run[1]:scan=1.1.3070.5	50.68388	3	1753.863371	1753.861011	K	V	339	353
PSM	VNTNYRPGLPFSGQVLLVDEK	1666	sp|Q61838|PZP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3173.19	53.59495	3	2345.248571	2345.237946	K	G	354	375
PSM	RINVLPLGSGAIAGNPLGVDR	1667	sp|Q91YI0|ARLY_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3175.12	53.64508	3	2088.194171	2088.180372	K	E	193	214
PSM	VITAFNDGLNHLDSLK	1668	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3071.8	50.71502	3	1756.910471	1755.915549	K	G	68	84
PSM	LGDVYVNDAFGTAHR	1669	sp|P09041|PGK2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2666.7	39.37812	3	1633.788071	1633.784869	K	A	157	172
PSM	ASSHTVLMR	1670	sp|Q9Z0S1|BPNT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:1	ms_run[1]:scan=1.1.2180.14	25.96053	2	1042.5183	1042.5224	M	L	2	11
PSM	KFFQEEVIPHHTEWEK	1671	sp|P51174|ACADL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2469.9	33.91132	4	2083.021694	2083.016326	R	A	66	82
PSM	CLHSVGCPLPLK	1672	sp|Q9Z2V4|PCKGC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:385,1-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=1.1.2998.14	48.69083	2	1362.6771	1362.6783	K	K	192	204
PSM	QFSYTHICAGASAFGK	1673	sp|Q99LC5|ETFA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:28,8-UNIMOD:4	ms_run[1]:scan=1.1.3072.17	50.75125	2	1726.7833	1726.7768	K	N	102	118
PSM	FYDVALDTGDK	1674	sp|Q9DBE0|CSAD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2711.14	40.64205	2	1243.587247	1242.576833	K	V	342	353
PSM	SYDVPPPPMEPDHPFYSNISK	1675	sp|Q9DBJ1|PGAM1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2988.8	48.41853	3	2416.114271	2416.104549	R	D	118	139
PSM	AAGTLYTYPENWR	1676	sp|Q9D8N0|EF1G_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:1	ms_run[1]:scan=1.1.3441.5	61.07902	2	1582.7552	1582.7412	M	A	2	15
PSM	GIRPAINVGLSVSR	1677	sp|Q03265|ATPA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2602.6	37.60715	3	1437.836771	1437.841596	K	V	403	417
PSM	CCLGWDFSTQQVK	1678	sp|Q3TNA1|XYLB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:4	ms_run[1]:scan=1.1.3627.12	66.33065	2	1610.6952	1610.6852	R	V	24	37
PSM	IMEGPAFNFLDAPAVR	1679	sp|Q9D051|ODPB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	21		ms_run[1]:scan=1.1.3530.19	63.57385	2	1747.8992	1746.8762	R	V	309	325
PSM	SAQHWLLDGFPR	1680	sp|Q9WUR9|KAD4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2987.8	48.39573	2	1426.714447	1425.715333	R	T	81	93
PSM	AAQGEPQVQFK	1681	sp|P62827|RAN_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:1	ms_run[1]:scan=1.1.2676.17	39.66323	2	1243.6143	1243.6192	M	L	2	13
PSM	VPVENVLGEVGGGFK	1682	sp|Q8JZN5|ACAD9_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.3175.15	53.64758	2	1500.813047	1499.798394	R	V	284	299
PSM	VHLKPVLLQTEQEQVEHNLASER	1683	sp|Q9DBK0|ACO12_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2696.14	40.21427	4	2696.435294	2696.424578	K	R	122	145
PSM	ACGLVASNLNLKPGECLK	1684	sp|P16045|LEG1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:1,2-UNIMOD:4,16-UNIMOD:4	ms_run[1]:scan=1.1.3156.12	53.11992	3	1985.0141	1985.0069	M	V	2	20
PSM	VPEAVADVR	1685	sp|P46656|ADX_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.2136.11	24.71032	2	954.507647	954.513445	R	Q	171	180
PSM	HHPEDVEPALRK	1686	sp|Q9JII6|AK1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.1756.4	14.138	4	1426.728494	1426.731711	K	T	86	98
PSM	AEAQIAAK	1687	sp|P05202|AATM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.1683.11	12.12648	2	800.432647	800.439218	K	N	83	91
PSM	DGDGTITTK	1688	sp|P0DP26|CALM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.1701.13	12.63295	2	906.421647	906.429441	K	E	23	32
PSM	DGDGTITTK	1689	sp|P0DP26|CALM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.1707.16	12.80187	2	906.421647	906.429441	K	E	23	32
PSM	VHLTDAEK	1690	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	20		ms_run[1]:scan=1.1.1722.11	13.20272	2	911.4649	911.4707	M	A	2	10
PSM	HGVYNPNK	1691	sp|P08249|MDHM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.1620.18	10.39433	2	927.449647	927.456265	K	I	158	166
PSM	RTAEEEDEADPK	1692	sp|Q9D0J8|PTMS_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.1633.14	10.74785	3	1388.601071	1388.605567	K	R	80	92
PSM	FHVEEEGK	1693	sp|P09041|PGK2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.1761.19	14.29153	2	973.446247	973.450511	R	G	124	132
PSM	KYEATLEK	1694	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.1737.18	13.6232	2	980.512047	980.517862	K	C	376	384
PSM	RQVEIAQR	1695	sp|P16460|ASSY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.1701.18	12.63713	2	998.555847	998.562127	R	E	101	109
PSM	EDAANNYAR	1696	sp|P05213|TBA1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.1724.18	13.26325	2	1022.436847	1022.441737	K	G	97	106
PSM	TLYHSVHEK	1697	sp|Q9DCM0|ETHE1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.1653.20	11.30515	2	1112.556647	1112.561458	K	I	173	182
PSM	AKPAETPAPAHK	1698	sp|Q9D2G2|ODO2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.1576.21	9.17275	2	1216.651647	1216.656421	K	A	154	166
PSM	AECSAEQCYK	1699	sp|P06801|MAOX_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	3-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.1742.21	13.7644	2	1244.478047	1244.480173	K	V	413	423
PSM	LEGGSGGDSEVQR	1700	sp|P62196|PRS8_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.1771.20	14.57268	2	1289.580247	1289.584772	R	T	259	272
PSM	FGCQVAGK	1701	sp|P97328|KHK_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	3-UNIMOD:4	ms_run[1]:scan=1.1.1830.15	16.2243	2	865.405647	865.411623	R	K	280	288
PSM	LSSAMSAAK	1702	sp|P14152|MDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.1776.10	14.7042	2	864.430047	864.437503	K	A	240	249
PSM	AIVQEATR	1703	sp|Q8CHT0|AL4A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.1834.13	16.33455	2	886.479847	886.487230	K	M	487	495
PSM	TVEAEAAHGTVTR	1704	sp|O88844|IDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.1801.13	15.40462	3	1340.662271	1340.668442	K	H	302	315
PSM	HEAGDMMGGHAIR	1705	sp|P10605|CATB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.1881.16	17.64918	3	1380.598271	1380.602688	K	I	269	282
PSM	VGFGQCAGK	1706	sp|P35505|FAAA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	6-UNIMOD:4	ms_run[1]:scan=1.1.1904.14	18.28643	2	922.427247	922.433087	R	V	403	412
PSM	YKPESDELTAEK	1707	sp|P09103|PDIA1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.1954.14	19.67282	3	1408.666571	1408.672190	K	I	329	341
PSM	AMEAVAAQGK	1708	sp|O70250|PGAM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.1808.15	15.6037	2	974.478247	974.485516	K	A	242	252
PSM	TGTEVGDVAK	1709	sp|Q9WUR9|KAD4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.1826.15	16.11162	2	975.482247	975.487290	K	Q	46	56
PSM	VDVSPTSQR	1710	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.1846.16	16.6731	2	987.493647	987.498523	R	L	556	565
PSM	HISTDEALK	1711	sp|Q9DBM2|ECHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.1799.16	15.35067	2	1012.514247	1012.518925	R	L	155	164
PSM	CCSGSLVER	1712	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	1-UNIMOD:4,2-UNIMOD:4	ms_run[1]:scan=1.1.1864.18	17.17617	2	1066.449647	1066.453564	K	R	500	509
PSM	ASGTNDKPGGPHYILR	1713	sp|Q8CHT0|AL4A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.1953.21	19.65028	3	1681.851971	1681.853618	R	W	524	540
PSM	VEPVDASGTEK	1714	sp|Q9JLJ2|AL9A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.1837.21	16.42498	2	1130.539647	1130.545533	R	A	20	31
PSM	ACDEGHIIPK	1715	sp|Q9JHI5|IVD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	2-UNIMOD:4	ms_run[1]:scan=1.1.1896.19	18.07062	2	1138.540047	1138.544094	K	D	347	357
PSM	LEAADEGSGDMK	1716	sp|Q60597|ODO1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.1906.20	18.34597	2	1221.526047	1221.518332	K	Y	337	349
PSM	FQHYMVGPK	1717	sp|P40936|INMT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2059.7	22.57522	3	1105.532771	1105.537886	R	K	202	211
PSM	TFRPPYYHR	1718	sp|O09173|HGD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2020.8	21.50635	3	1235.613671	1235.619976	K	N	328	337
PSM	IPAGLENR	1719	sp|O35215|DOPD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2031.14	21.81625	2	868.470047	868.476666	R	L	15	23
PSM	LAVSQVPR	1720	sp|P40142|TKT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2130.9	24.5395	2	868.506447	868.513051	R	S	587	595
PSM	VLDSGAPIK	1721	sp|P56480|ATPB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2091.11	23.4656	2	898.505847	898.512383	K	I	125	134
PSM	TTAQVLIR	1722	sp|P45376|ALDR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2161.8	25.41683	2	900.532647	900.539266	K	F	244	252
PSM	IDGASPLDK	1723	sp|P00329|ADH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2034.14	21.89862	2	914.465447	914.470912	K	V	161	170
PSM	IDGASPLDK	1724	sp|P00329|ADH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2041.16	22.09202	2	914.465447	914.470912	K	V	161	170
PSM	KLTDIGIR	1725	tr|A0A0R4J083|A0A0R4J083_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2154.11	25.2221	2	914.547647	914.554916	K	R	43	51
PSM	AHSSMVGVNLPQK	1726	sp|P09411|PGK1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	5-UNIMOD:35	ms_run[1]:scan=1.1.1999.14	20.9247	3	1382.692571	1382.697634	R	A	172	185
PSM	HVLNVLNK	1727	sp|P51855|GSHB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2024.10	21.61785	2	935.550247	935.555250	R	T	165	173
PSM	NDEGIAYR	1728	sp|Q61171|PRDX2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.1968.9	20.06342	2	936.426447	936.430110	K	G	120	128
PSM	ELSEIAQR	1729	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2044.12	22.17195	2	944.488447	944.492710	K	I	15	23
PSM	LVAQGSPPLK	1730	sp|Q9DBM2|ECHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2094.15	23.55028	2	1008.589647	1008.596781	R	E	696	706
PSM	IICQGFTGK	1731	sp|Q9WUM5|SUCA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	3-UNIMOD:4	ms_run[1]:scan=1.1.2149.18	25.08525	2	1022.517847	1022.521902	K	Q	58	67
PSM	HVTLLVCGK	1732	sp|Q9JIL4|NHRF3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	7-UNIMOD:4	ms_run[1]:scan=1.1.2098.15	23.65873	2	1025.562447	1025.569186	K	M	449	458
PSM	TAVCDIPPR	1733	sp|P68372|TBB4B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	4-UNIMOD:4	ms_run[1]:scan=1.1.2111.14	24.0158	2	1027.508447	1027.512065	K	G	351	360
PSM	SSDEAYAIAK	1734	sp|Q9Z2I9|SUCB1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2055.15	22.47302	2	1053.495247	1053.497855	K	K	79	89
PSM	NQAPPGLYTK	1735	sp|P16460|ASSY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	20		ms_run[1]:scan=1.1.2089.17	23.41462	2	1087.5617	1087.5657	K	T	200	210
PSM	VCNLIDSGTK	1736	sp|Q9EQ20|MMSA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	2-UNIMOD:4	ms_run[1]:scan=1.1.2146.17	24.99963	2	1105.540047	1105.543759	R	E	367	377
PSM	CATITPDEAR	1737	sp|P54071|IDHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	1-UNIMOD:4	ms_run[1]:scan=1.1.1978.17	20.34565	2	1132.515647	1132.518273	K	V	113	123
PSM	YIDQEELNK	1738	sp|P07901|HS90A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2115.18	24.13043	2	1150.549247	1150.550619	K	T	285	294
PSM	GRNDLMEYAK	1739	sp|P16460|ASSY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2154.6	25.21792	3	1195.560671	1195.565557	K	Q	156	166
PSM	LFECSNQTGR	1740	sp|Q62468|VILI_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	4-UNIMOD:4	ms_run[1]:scan=1.1.2022.16	21.56757	2	1210.534047	1210.540071	R	F	621	631
PSM	MDSTEPPYSQK	1741	sp|P10126|EF1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2009.18	21.21195	2	1281.552047	1281.554718	K	R	155	166
PSM	LQTCCDKPLLK	1742	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	4-UNIMOD:4,5-UNIMOD:4	ms_run[1]:scan=1.1.2028.11	21.72983	3	1374.696071	1374.699943	K	K	299	310
PSM	GHQDVEAAQAEYVEK	1743	sp|Q99MN9|PCCB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2078.17	23.10962	3	1672.767371	1672.769279	K	F	477	492
PSM	RQAVTNPNNTFYATK	1744	sp|P38647|GRP75_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2073.18	22.9721	3	1723.866671	1723.864182	K	R	107	122
PSM	KIQVLQQQADDAEER	1745	tr|D3Z2H9|D3Z2H9_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2147.20	25.0303	3	1769.892071	1769.890791	R	A	13	28
PSM	IPAMTIAK	1746	sp|P63038|CH60_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2321.8	29.84398	2	843.483047	843.488810	K	N	474	482
PSM	VGASFLQR	1747	sp|P05202|AATM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2327.9	30.01305	2	876.475047	876.481751	R	F	140	148
PSM	QTVAVGVIK	1748	sp|P10126|EF1A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2234.5	27.44603	2	913.554047	913.559667	R	A	431	440
PSM	ATDFVVDR	1749	sp|P54071|IDHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2231.9	27.36695	2	921.449847	921.455596	K	A	181	189
PSM	DSQGNLFR	1750	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2235.4	27.47292	2	935.441847	935.446094	K	N	88	96
PSM	FDSQTVLK	1751	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2255.7	28.02228	2	936.487847	936.491647	K	V	292	300
PSM	IDPSAPLDK	1752	sp|P28474|ADHX_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2237.9	27.52842	2	954.497447	954.502212	K	V	160	169
PSM	MLEIDPQK	1753	sp|Q8QZT1|THIL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2355.14	30.78693	2	972.489447	972.495018	K	V	363	371
PSM	SDPVEEAIK	1754	sp|Q9DBM2|ECHP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2244.11	27.72028	2	986.488647	986.492041	K	F	173	182
PSM	FIPQMTAGK	1755	sp|P51174|ACADL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2334.12	30.21353	2	991.512447	991.516088	K	C	157	166
PSM	VLEALHSIK	1756	sp|P00920|CAH2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2217.12	26.98307	2	1008.593047	1008.596781	K	T	159	168
PSM	VTLVSAAPEK	1757	sp|Q9CQR4|ACO13_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2179.16	25.93478	2	1013.570247	1013.575711	K	L	28	38
PSM	LDGNQDLIR	1758	sp|P54071|IDHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2250.13	27.88877	2	1042.537647	1042.540723	K	F	385	394
PSM	HFVGMLPEK	1759	sp|Q9R0P5|DEST_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2255.13	28.02728	2	1056.538247	1056.542637	K	D	70	79
PSM	HLFTGPALSK	1760	sp|P35505|FAAA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2224.17	27.1812	2	1069.588647	1069.592030	K	H	48	58
PSM	TAAYVNAIEK	1761	sp|P26443|DHE3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2214.10	26.90253	2	1078.562647	1078.565875	R	V	536	546
PSM	LRVDPVNFK	1762	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2356.4	30.80587	3	1086.612071	1086.618579	K	L	92	101
PSM	GISEETTTGVHNLYK	1763	sp|P50247|SAHH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2321.16	29.85067	3	1647.810071	1647.810415	R	M	152	167
PSM	EGAVTSVNLTK	1764	sp|Q99JW2|ACY1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2200.18	26.52702	2	1117.594647	1117.597903	K	L	245	256
PSM	YNDEPVQIR	1765	sp|Q62468|VILI_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2240.18	27.61707	2	1132.550847	1132.551287	K	V	470	479
PSM	SQGEEVDFAR	1766	sp|Q9CWS0|DDAH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2185.17	26.1017	2	1136.505247	1136.509816	R	A	33	43
PSM	ILQEAGADISK	1767	sp|Q60866|PTER_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2212.16	26.85113	2	1143.608247	1143.613553	R	T	215	226
PSM	TGAEGAVLDEAK	1768	sp|P28738|KIF5C_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2176.17	25.85137	2	1159.566047	1159.572082	K	N	242	254
PSM	VVGDVAYDEAK	1769	sp|Q922D8|C1TC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2170.20	25.68227	2	1164.563847	1164.566269	K	E	252	263
PSM	ECCHGDLLECADDR	1770	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	2-UNIMOD:4,3-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.2220.15	27.06822	3	1748.655071	1748.655254	K	A	268	282
PSM	QHGIPIPVTPK	1771	sp|P16460|ASSY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2309.4	29.50908	3	1185.681071	1185.686993	K	S	166	177
PSM	NQFTVAQYEK	1772	sp|Q3UZZ6|ST1D1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2361.11	30.95103	2	1226.589047	1226.593152	K	F	266	276
PSM	VVSPWNSEDAK	1773	sp|Q9D051|ODPB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2320.17	29.82338	2	1230.586247	1230.588067	K	G	174	185
PSM	DQVANSAFVER	1774	sp|P07901|HS90A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2320.18	29.82422	2	1234.590847	1234.594215	K	L	501	512
PSM	YSTDVSVDEVK	1775	sp|P26443|DHE3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2349.20	30.6264	2	1240.581647	1240.582313	R	A	152	163
PSM	RALALGGTCTGEHGIGLGK	1776	sp|Q7TNG8|LDHD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	9-UNIMOD:4	ms_run[1]:scan=1.1.2306.17	29.43755	3	1866.973571	1866.973415	R	R	431	450
PSM	TCAELVQEAAR	1777	sp|Q8VDK1|NIT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	2-UNIMOD:4	ms_run[1]:scan=1.1.2239.14	27.58743	2	1246.598047	1246.597586	K	L	62	73
PSM	EQVANSAFVER	1778	sp|P11499|HS90B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2226.19	27.23782	2	1248.606247	1248.609865	K	V	492	503
PSM	ICNQVLVCER	1779	sp|Q9Z2I9|SUCB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	2-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.2272.18	28.49818	2	1289.620247	1289.622027	R	K	151	161
PSM	LGTVADCGVPEAR	1780	sp|Q8BWF0|SSDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	7-UNIMOD:4	ms_run[1]:scan=1.1.2325.21	29.9671	2	1343.649847	1343.650350	K	A	75	88
PSM	NINNDTTYCIK	1781	sp|Q99KR3|LACB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	9-UNIMOD:4	ms_run[1]:scan=1.1.2232.19	27.40225	2	1354.618847	1354.618715	K	K	92	103
PSM	IIAEGANGPTTPEADK	1782	sp|P26443|DHE3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2176.21	25.8547	2	1582.783247	1582.783866	K	I	400	416
PSM	HQAFEAELSANQSR	1783	sp|P16546|SPTN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2170.16	25.67892	3	1586.745671	1586.743733	K	I	614	628
PSM	IVAPISDSPKPPPQR	1784	sp|Q9CQ60|6PGL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2238.8	27.55872	3	1600.891571	1600.893691	K	V	171	186
PSM	EGYLHIGGTTQQAQR	1785	sp|Q91WU0|CES1F_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2194.16	26.35667	3	1657.814171	1657.817232	K	L	522	537
PSM	DELHHSGWNTCSSCFGDSTK	1786	sp|P17563|SBP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	11-UNIMOD:4,14-UNIMOD:4	ms_run[1]:scan=1.1.2322.18	29.88053	4	2323.925694	2323.922244	K	S	70	90
PSM	MMEVAAADVQR	1787	sp|Q9D1A2|CNDP2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2372.16	31.24863	2	1219.577647	1219.568928	R	L	44	55
PSM	AGLEQGSDAGYLAESQK	1788	sp|Q8BMS1|ECHA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2462.21	33.73312	2	1722.819447	1722.806058	K	F	310	327
PSM	AAVSGLWGK	1789	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2467.5	33.85422	2	887.482847	887.486502	K	V	10	19
PSM	QTALAELVK	1790	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2570.6	36.71313	2	971.562447	971.565147	K	H	550	559
PSM	LPLQDVYK	1791	sp|P10126|EF1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2540.9	35.8899	2	974.539247	974.543683	R	I	248	256
PSM	IGYPAPNFK	1792	sp|P35700|PRDX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2531.11	35.6409	2	1005.523047	1005.528367	K	A	8	17
PSM	LAQSNGWGVMVSHR	1793	sp|P17182|ENOA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2450.6	33.40297	3	1540.758671	1540.756880	K	S	359	373
PSM	HEDCYILDQGGLK	1794	sp|Q62468|VILI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	4-UNIMOD:4	ms_run[1]:scan=1.1.2508.9	34.9876	3	1546.709771	1546.708593	K	I	282	295
PSM	MFASFPTTK	1795	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	1-UNIMOD:35	ms_run[1]:scan=1.1.2546.5	36.0515	2	1044.490847	1044.495018	R	T	33	42
PSM	AAYQVAALPR	1796	sp|P52760|RIDA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2460.8	33.66817	2	1058.582447	1058.587279	R	G	108	118
PSM	ALGLSNFNSR	1797	sp|Q9JII6|AK1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2529.15	35.58827	2	1077.553247	1077.556707	K	Q	158	168
PSM	LDAAGGLQSLR	1798	sp|Q9DCQ2|ASPD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2568.10	36.66003	2	1099.596447	1099.598572	R	V	141	152
PSM	RPNSGSLIQVVTTDGK	1799	sp|Q8BVI4|DHPR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2491.12	34.5198	3	1670.889071	1670.895148	K	T	218	234
PSM	AVGWNEVEGR	1800	sp|P61458|PHS_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2392.15	31.80317	2	1115.533847	1115.535972	R	D	22	32
PSM	TGQEIPVNLR	1801	sp|Q9D1A2|CNDP2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2466.6	33.83323	2	1125.611847	1125.614222	K	F	150	160
PSM	VAVPSTIHCDHLIEAQVGGEK	1802	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	9-UNIMOD:4	ms_run[1]:scan=1.1.2570.11	36.71732	4	2259.136094	2259.131767	K	D	118	139
PSM	DAGMQLQGYR	1803	sp|P05202|AATM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2407.16	32.21962	2	1137.521847	1137.523692	R	Y	171	181
PSM	HIEIQVLGDK	1804	sp|Q91ZA3|PCCA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2415.15	32.4412	2	1150.630647	1150.634623	R	H	265	275
PSM	SIGVSNFNYR	1805	sp|Q91WR5|AK1CL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2566.11	36.6045	2	1155.565447	1155.567272	K	Q	162	172
PSM	AAATTVQEYLK	1806	sp|Q62468|VILI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2515.17	35.19285	2	1193.624647	1193.629203	K	T	673	684
PSM	FIQSPEDLEK	1807	tr|E9Q6L7|E9Q6L7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2509.15	35.02033	2	1204.595647	1204.597569	K	L	34	44
PSM	FIQSPEDLEK	1808	tr|E9Q6L7|E9Q6L7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2515.18	35.19368	2	1204.595647	1204.597569	K	L	34	44
PSM	AAPTEPPEAPEATAAGGVTSK	1809	sp|Q8VC30|TKFC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2390.18	31.74917	3	1950.955271	1950.953451	R	Q	352	373
PSM	IAPAIAAGNTVIAK	1810	sp|Q8BH00|AL8A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2567.15	36.6359	2	1308.774847	1308.776536	K	P	165	179
PSM	LPTQPSGISTVVK	1811	sp|A2ARV4|LRP2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2551.11	36.18973	2	1325.752447	1325.755467	R	T	2634	2647
PSM	AIAGTGANVIVTGGK	1812	sp|P42932|TCPQ_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2411.20	32.33338	2	1327.742847	1327.745965	K	V	282	297
PSM	ADDGRPFPQVIK	1813	tr|A6ZI46|A6ZI46_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2413.8	32.37988	3	1341.701771	1341.704100	K	S	143	155
PSM	ALIAAQYSGAQVR	1814	sp|Q9D8N0|EF1G_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2501.20	34.80183	2	1346.729047	1346.730649	K	V	18	31
PSM	EGVVECSFVQSK	1815	sp|P08249|MDHM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	6-UNIMOD:4	ms_run[1]:scan=1.1.2436.19	33.02295	2	1367.638647	1367.639116	K	E	270	282
PSM	ASVVYQDLQQGGR	1816	sp|Q3UFF7|LYPL1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2390.19	31.75	2	1419.710047	1419.710642	K	M	155	168
PSM	DLTTAGAVTQCYR	1817	sp|P62717|RL18A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	11-UNIMOD:4	ms_run[1]:scan=1.1.2562.19	36.49938	2	1454.684847	1454.682378	R	D	99	112
PSM	KGTDFQLNQLEGK	1818	sp|Q921I1|TRFE_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2452.6	33.45576	3	1476.758171	1476.757257	K	K	122	135
PSM	TDPTTLTDDEINR	1819	sp|Q922D8|C1TC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2496.18	34.66295	2	1489.697047	1489.689631	K	F	505	518
PSM	NVIIWGNHSSTQYPDVNHAK	1820	sp|P14152|MDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2472.20	34.00132	3	2279.116871	2279.108329	K	V	180	200
PSM	WLQTEVQNPSVTSK	1821	sp|P34914|HYES_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2567.19	36.63923	2	1615.821447	1615.820586	K	I	540	554
PSM	AGSDGESIGNCPFSQR	1822	sp|Q9QYB1|CLIC4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	11-UNIMOD:4	ms_run[1]:scan=1.1.2390.21	31.75167	2	1680.718447	1680.716198	K	L	25	41
PSM	NYEYYASHVPESVK	1823	sp|Q9Z0S1|BPNT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2443.21	33.21797	2	1684.777447	1684.773302	R	N	290	304
PSM	VVHSYEELEENYTR	1824	sp|Q05920|PYC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2482.17	34.27237	3	1766.813171	1766.811144	R	A	206	220
PSM	ALEHFTDLYDIKR	1825	sp|Q68FD5|CLH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2672.3	39.53922	4	1619.825694	1619.830757	R	A	626	639
PSM	TPALIALR	1826	sp|P70694|DHB5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2643.7	38.74035	2	853.533447	853.538538	R	Y	251	259
PSM	IILLAEGR	1827	sp|P50247|SAHH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2594.4	37.38408	2	883.544247	883.549102	R	L	336	344
PSM	SLMDEVVK	1828	sp|P09411|PGK1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2631.7	38.40303	2	919.466247	919.468469	K	A	354	362
PSM	AILAELTGR	1829	sp|P35486|ODPA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2730.4	41.1748	2	942.546847	942.549831	R	R	133	142
PSM	RHPDYSVSLLLR	1830	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2603.7	37.63555	3	1454.797271	1454.799397	R	L	361	373
PSM	LPEILVETK	1831	sp|Q7TNG8|LDHD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2770.7	42.28508	2	1040.609647	1040.611762	R	E	375	384
PSM	GIVVLNTSLK	1832	sp|Q91WR5|AK1CL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2728.6	41.12192	2	1042.636047	1042.638646	R	E	264	274
PSM	EATWVVDVK	1833	sp|P32020|NLTP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2690.5	40.04288	2	1045.541647	1045.544411	K	N	471	480
PSM	NCVILPHIGSATYK	1834	sp|Q91Z53|GRHPR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	2-UNIMOD:4	ms_run[1]:scan=1.1.2609.7	37.80052	3	1571.814071	1571.812999	K	T	287	301
PSM	LGVEFDEITADDRK	1835	sp|P04117|FABP4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2728.7	41.12275	3	1606.783871	1606.783866	K	V	67	81
PSM	VNFTVDQIR	1836	sp|P58252|EF2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	20		ms_run[1]:scan=1.1.2639.12	38.63085	2	1090.5755	1090.5766	M	A	2	11
PSM	YGLAATVWSK	1837	sp|Q8BH00|AL8A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2757.7	41.9215	2	1094.574247	1094.576046	R	D	417	427
PSM	ITALDEFATK	1838	sp|P16546|SPTN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2736.11	41.34423	2	1107.576647	1107.581191	K	L	523	533
PSM	HGYIGEFEIIDDHR	1839	sp|P62245|RS15A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2705.9	40.46635	3	1699.799471	1699.795434	K	A	44	58
PSM	YEWDVAEAR	1840	sp|P58252|EF2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2641.13	38.6887	2	1137.508847	1137.509088	K	K	639	648
PSM	YYTLEEIQK	1841	sp|P56395|CYB5_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2594.13	37.3916	2	1185.590047	1185.591755	K	H	11	20
PSM	LVQAFQFTDK	1842	sp|P35700|PRDX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2761.12	42.03797	2	1195.626047	1195.623724	R	H	159	169
PSM	SGAQATWTEVSWPHEK	1843	sp|Q91X72|HEMO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2715.13	40.756	3	1812.840671	1812.843112	K	V	385	401
PSM	LEAPDADELPR	1844	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2581.15	37.02925	2	1224.599847	1224.598632	K	S	524	535
PSM	SDDIILSSGYR	1845	sp|Q3UNX5|ACSM3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2637.18	38.57952	2	1224.602247	1224.598632	R	I	471	482
PSM	LTGSLSGWTSPK	1846	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2627.16	38.29878	2	1232.639447	1232.640102	K	D	234	246
PSM	INFDDNAEFR	1847	sp|Q9Z2I8|SUCB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2675.13	39.63152	2	1239.549847	1239.552016	K	Q	261	271
PSM	ENIIDLSNANR	1848	sp|A2BIM8|MUP18_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2630.12	38.37914	2	1257.631647	1257.631329	R	C	165	176
PSM	QFADIAYNYR	1849	sp|P16331|PH4H_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2739.15	41.43157	2	1259.603447	1259.593487	K	H	160	170
PSM	VAEEWAQGTFK	1850	sp|Q91YI0|ARLY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2579.17	36.97577	2	1264.611847	1264.608802	K	L	70	81
PSM	GVTFNVTTVDTK	1851	sp|Q9Z1Q5|CLIC1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2634.17	38.49527	2	1280.661247	1280.661232	K	R	38	50
PSM	EHALLAYTLGVK	1852	sp|P10126|EF1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2738.17	41.40495	2	1313.733047	1313.734337	R	Q	135	147
PSM	DATSLNQAALYR	1853	sp|P51660|DHB4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2610.15	37.83513	2	1321.659447	1321.662629	R	L	494	506
PSM	GAPTTSLVSVAVTK	1854	sp|Q9DBF1|AL7A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2661.6	39.2468	2	1329.749247	1329.750381	K	I	219	233
PSM	FLIPNASQPESK	1855	sp|P63101|1433Z_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2609.14	37.80637	2	1329.693647	1329.692866	K	V	104	116
PSM	SGALNSNDAFVLK	1856	sp|P13020|GELS_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2712.16	40.67213	2	1334.685647	1334.683030	K	T	583	596
PSM	TVIIEQSWGSPK	1857	sp|P63038|CH60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2701.16	40.3572	2	1343.708447	1343.708516	R	V	61	73
PSM	YLILNATQAESK	1858	sp|Q9CQV8|1433B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2623.13	38.18633	2	1349.715647	1349.719081	K	V	106	118
PSM	APNVLASEPEIPK	1859	sp|Q9WTP6|KAD2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	20		ms_run[1]:scan=1.1.2712.17	40.67297	2	1363.7335	1363.7342	M	G	2	15
PSM	HIDCASVYGNETEIGEALK	1860	sp|Q9JII6|AK1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	4-UNIMOD:4	ms_run[1]:scan=1.1.2772.19	42.35115	3	2104.983671	2104.973535	R	E	43	62
PSM	GNPTVEVDLYTAK	1861	sp|P17182|ENOA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2689.8	40.02431	2	1405.710847	1405.708910	R	G	16	29
PSM	PFETLLSQNQGGK	1862	sp|P19157|GSTP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2664.18	39.33345	2	1417.716847	1417.720144	K	A	129	142
PSM	PFETLLSQNQGGK	1863	sp|P19157|GSTP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2671.19	39.52482	2	1417.716847	1417.720144	K	A	129	142
PSM	TINEVENQILTR	1864	sp|P57780|ACTN4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2760.14	42.0115	2	1428.755047	1428.757257	R	D	747	759
PSM	GDVTTQVALQPALK	1865	sp|P09671|SODM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2689.9	40.02598	2	1439.801047	1439.798394	K	F	76	90
PSM	ECYQTWAQLER	1866	sp|Q9D826|SOX_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	2-UNIMOD:4	ms_run[1]:scan=1.1.2760.16	42.01317	2	1482.663647	1482.656163	K	E	70	81
PSM	ASSTANLIFEDCR	1867	sp|Q07417|ACADS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	12-UNIMOD:4	ms_run[1]:scan=1.1.2726.19	41.07705	2	1482.679847	1482.677293	R	I	235	248
PSM	TTPSYVAFTDTER	1868	sp|P16627|HS71L_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2652.18	39.00467	2	1486.694247	1486.693989	R	L	39	52
PSM	IFVGGLSPDTPEEK	1869	sp|Q60668|HNRPD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2763.19	42.09988	2	1487.755247	1487.750775	K	I	184	198
PSM	GATTNICYNVLDR	1870	sp|Q9QXG4|ACSA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	7-UNIMOD:4	ms_run[1]:scan=1.1.2715.18	40.76017	2	1495.715847	1495.708927	K	N	98	111
PSM	VDGVSAEPTPESWR	1871	sp|O35488|S27A2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2617.12	38.02628	2	1528.720847	1528.715787	K	S	198	212
PSM	IEDGNDFGVAIQEK	1872	sp|P97372|PSME2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2715.19	40.761	2	1533.733447	1533.731102	K	V	132	146
PSM	IEGRPGASLPPLNLK	1873	sp|Q05920|PYC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2654.8	39.05215	3	1560.898571	1560.898777	R	E	974	989
PSM	NAVTQEFGPVPDTAR	1874	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2691.6	40.0708	3	1600.788971	1600.784535	R	Y	634	649
PSM	ESAAIYFTSGTSGPPK	1875	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2697.21	40.2479	2	1611.781847	1611.778053	R	M	214	230
PSM	MQQVEASLQPETLR	1876	sp|P07759|SPA3K_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2664.21	39.33595	2	1628.823247	1628.819206	R	K	283	297
PSM	MQQVEASLQPETLR	1877	sp|P07759|SPA3K_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2657.21	39.14627	2	1628.823247	1628.819206	R	K	283	297
PSM	HGGTIPVVPTAEFQDR	1878	sp|P26443|DHE3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2666.9	39.38145	3	1722.871271	1722.868933	K	I	481	497
PSM	HFRDEELSCSVLELK	1879	sp|P07759|SPA3K_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	9-UNIMOD:4	ms_run[1]:scan=1.1.2690.9	40.04623	3	1860.912071	1860.903998	R	Y	252	267
PSM	EIIAVSCGPSQCQETIR	1880	sp|Q9DCW4|ETFB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	7-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.2631.21	38.41471	2	1946.930647	1946.918997	K	T	60	77
PSM	WSSCNIFSTQDHAAAAIAK	1881	sp|P50247|SAHH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	4-UNIMOD:4	ms_run[1]:scan=1.1.2780.18	42.57409	3	2076.972371	2076.968724	R	A	76	95
PSM	NVMLLPVGSADDGAHSQNEK	1882	sp|Q9D1A2|CNDP2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2626.17	38.27183	3	2080.992071	2080.984768	K	L	431	451
PSM	DLTDYLMK	1883	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3178.5	53.7247	2	997.477647	997.479034	R	I	184	192
PSM	LGFMSAFVK	1884	sp|Q9D2G2|ODO2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3141.4	52.68013	2	998.523647	998.525924	K	A	279	288
PSM	VVFIFGPDK	1885	sp|O08709|PRDX6_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3052.5	50.18298	2	1020.560047	1020.564418	R	K	133	142
PSM	GDFWLMGDR	1886	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3170.3	53.49827	2	1095.480247	1095.480765	R	G	440	449
PSM	MPTLGLGTWK	1887	sp|P45376|ALDR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3075.2	50.82373	2	1102.583847	1102.584502	K	S	13	23
PSM	ALTDELAALGR	1888	sp|Q9EQ06|DHB11_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3133.5	52.45375	2	1128.608447	1128.613888	R	T	198	209
PSM	TMEEILEGLK	1889	sp|P07759|SPA3K_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3179.3	53.75135	2	1161.596647	1161.595126	K	F	94	104
PSM	VDGMDILCVR	1890	sp|P35486|ODPA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	8-UNIMOD:4	ms_run[1]:scan=1.1.3045.6	49.9846	2	1176.562047	1176.563115	R	E	254	264
PSM	VANVSLLALYK	1891	sp|P62267|RS23_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3109.10	51.78828	2	1189.706447	1189.707060	K	G	125	136
PSM	EQIDIFEGIK	1892	sp|Q9Z2I8|SUCB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3141.6	52.6818	2	1190.618447	1190.618304	K	D	192	202
PSM	LKEEEVTFWTQSLAK	1893	sp|Q91WU0|CES1F_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3036.8	49.72918	3	1807.935671	1807.935616	R	K	537	552
PSM	LDTHPAMVTVLEMGAAR	1894	sp|Q9CQN1|TRAP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3076.5	50.85433	3	1810.910171	1810.906975	R	H	605	622
PSM	TLMNLGGLAVAR	1895	sp|Q9WVA4|TAGL2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3066.8	50.57122	2	1214.675847	1214.680527	R	D	128	140
PSM	FSMVIDNGIVK	1896	sp|P99029|PRDX5_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2993.4	48.54657	2	1221.639047	1221.642745	R	A	177	188
PSM	FSVDVFEETR	1897	sp|O09173|HGD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3040.12	49.84633	2	1227.577247	1227.577168	R	G	188	198
PSM	YIVPMITVDGK	1898	sp|Q9JII6|AK1A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3114.5	51.91997	2	1234.664047	1234.663146	R	R	298	309
PSM	DFANVYVDAVK	1899	sp|Q00623|APOA1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3002.7	48.7984	2	1239.615047	1239.613553	K	D	36	47
PSM	TFESLVDFCK	1900	sp|Q61425|HCDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	9-UNIMOD:4	ms_run[1]:scan=1.1.3094.7	51.36952	2	1244.575847	1244.574725	K	T	193	203
PSM	NISAMGLYWGR	1901	sp|Q3UNZ8|QORL2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3151.6	52.96982	2	1266.619647	1266.617927	K	Y	281	292
PSM	ELLLQPVTISR	1902	sp|P59999|ARPC4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3052.12	50.18882	2	1267.745647	1267.749987	K	N	45	56
PSM	NLGVSIQLQTLK	1903	sp|Q3UP75|UD3A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3015.8	49.1634	2	1312.768447	1312.771451	K	A	405	417
PSM	TVTNAVVTVPAYFNDSQR	1904	sp|P63017|HSP7C_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3080.10	50.97127	3	1981.000571	1980.990505	K	Q	138	156
PSM	LAENFCVCHLATGDMLR	1905	sp|Q9WTP6|KAD2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	6-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.2999.11	48.71648	3	2005.920071	2005.917223	K	A	35	52
PSM	DLQILAEFHEK	1906	sp|P07759|SPA3K_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3034.16	49.67978	2	1341.693847	1341.692866	K	T	145	156
PSM	TLTIVDTGIGMTK	1907	sp|P07901|HS90A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3008.13	48.9724	2	1348.728447	1348.727203	R	A	88	101
PSM	ITQLTPFIGYAGGK	1908	sp|O35488|S27A2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3106.16	51.7099	2	1464.803647	1464.797666	K	T	429	443
PSM	QDVSPFNVVAWHGNYTPYK	1909	sp|O09173|HGD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3176.15	53.67593	3	2221.073771	2221.059253	K	Y	258	277
PSM	VKPGYLGTAFAHYDVQVIDEQGNVLPPGK	1910	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3166.16	53.39907	4	3111.629694	3111.602936	K	E	379	408
PSM	SVIGMGTGAGAYILTR	1911	sp|Q62433|NDRG1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3133.16	52.46293	2	1565.827447	1565.823563	K	F	133	149
PSM	VVDLLAQDADIVCR	1912	sp|P46664|PURA2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	13-UNIMOD:4	ms_run[1]:scan=1.1.3171.15	53.53598	2	1585.813047	1585.813392	K	C	46	60
PSM	VINEPTAAALAYGLDK	1913	sp|P38647|GRP75_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3088.19	51.2089	2	1644.882247	1644.872287	R	S	219	235
PSM	TQEFILNSPTVTSIK	1914	sp|Q9R0H0|ACOX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3022.8	49.35546	2	1676.901247	1676.898502	K	W	160	175
PSM	VTGTQFPEAPLPVPCNPNDVSHGYVTVKPGIR	1915	sp|P34914|HYES_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	15-UNIMOD:4	ms_run[1]:scan=1.1.3082.18	51.03505	4	3445.775294	3445.745260	K	L	216	248
PSM	VGDAIPSVEVFEGEPGK	1916	sp|P99029|PRDX5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3125.18	52.23782	2	1728.867447	1728.857031	K	K	54	71
PSM	VFLTTAEVISQQVSDK	1917	sp|P06801|MAOX_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3128.20	52.32485	2	1763.939447	1763.930531	K	H	477	493
PSM	ASTLHLQTGNLLNWGR	1918	sp|O09172|GSH0_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3054.11	50.2425	3	1779.941771	1779.938016	R	L	15	31
PSM	QNPDIPQLEPSDYLR	1919	sp|Q9DBM2|ECHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3182.18	53.84705	2	1783.880647	1783.874078	R	R	680	695
PSM	IYGADDIELLPEAQNK	1920	sp|Q922D8|C1TC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3177.19	53.7078	2	1787.903447	1787.894145	R	A	833	849
PSM	AINPENGFFGVAPGTSVK	1921	sp|Q9Z2V4|PCKGC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3103.20	51.63008	2	1803.922247	1803.915549	R	T	325	343
PSM	MVIWGANAYVTEEDSR	1922	sp|Q8R164|BPHL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3135.20	52.52227	2	1839.857247	1839.846149	K	I	159	175
PSM	SLPAGSLISLHIYALHR	1923	sp|Q64462|CP4B1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3067.10	50.60165	3	1847.046671	1847.041753	R	N	398	415
PSM	AGAPPGLFNVVQGGAATGQFLCHHR	1924	sp|Q9JLJ2|AL9A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	22-UNIMOD:4	ms_run[1]:scan=1.1.3069.11	50.66013	4	2561.284494	2561.270995	K	E	199	224
PSM	YFHVVIAGPQDSPFEGGTFK	1925	sp|P61089|UBE2N_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3188.12	54.00715	3	2195.085371	2195.068755	R	L	34	54
PSM	VIISAPSADAPMFVMGVNHEK	1926	tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3144.12	52.77293	3	2212.111571	2212.102046	R	Y	117	138
PSM	GFCHLCDGQEACCVGLEAGINPTDHLITAYR	1927	sp|P35486|ODPA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	3-UNIMOD:4,6-UNIMOD:4,12-UNIMOD:4,13-UNIMOD:4	ms_run[1]:scan=1.1.3142.17	52.71973	4	3533.592894	3533.558465	R	A	89	120
PSM	TDLALILSAGDN	1928	sp|P12658|CALB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3603.3	65.62552	2	1201.620647	1201.619033	R	-	250	262
PSM	DFQLFSSPLGK	1929	sp|Q921I1|TRFE_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3439.2	61.01802	2	1237.638247	1237.634289	K	D	300	311
PSM	DLFQVIYNVK	1930	sp|P98078|DAB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3564.4	64.53902	2	1237.673647	1237.670674	K	K	164	174
PSM	SWAMLFASGGFK	1931	sp|Q99KP3|CRYL1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3512.4	63.05053	2	1300.629847	1300.627429	R	V	20	32
PSM	SVDPTLALSVYLR	1932	sp|Q68FD5|CLH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3532.11	63.62478	2	1432.798247	1432.792580	K	A	469	482
PSM	MGLPICLVVAVNR	1933	sp|Q80W22|THNS2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	6-UNIMOD:4	ms_run[1]:scan=1.1.3548.7	64.08373	2	1440.801447	1440.794512	K	N	275	288
PSM	GVYVLMSGLDLER	1934	sp|Q9JHI5|IVD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3418.10	60.45022	2	1450.752247	1450.749001	K	L	273	286
PSM	GIDYEIVPINLIK	1935	sp|Q9WVL0|MAAI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3605.12	65.69033	2	1485.851247	1485.844282	K	D	28	41
PSM	ICTVQPNPDYGGAITFLEER	1936	sp|Q99JW2|ACY1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	2-UNIMOD:4	ms_run[1]:scan=1.1.3421.13	60.53845	3	2279.106371	2279.089233	R	A	22	42
PSM	VTMWVFEEDIGGR	1937	sp|P13707|GPDA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3464.14	61.71413	2	1537.728447	1537.723515	R	K	36	49
PSM	DNVINLEVVLPDGR	1938	sp|Q7TNG8|LDHD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3524.13	63.396	2	1551.836047	1551.825671	R	L	185	199
PSM	EILVGDVGATITDPFK	1939	sp|Q9R0P5|DEST_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3526.17	63.4569	2	1673.898647	1673.887603	K	H	54	70
PSM	LTFFNSTLNTSGLVAQGEALPIPGAHRPGLVTK	1940	sp|Q8R0Y6|AL1L1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3439.7	61.02803	4	3405.869694	3405.840875	K	A	242	275
PSM	IEFLDDVMMDACNR	1941	sp|Q7TNG8|LDHD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	12-UNIMOD:4	ms_run[1]:scan=1.1.3493.20	62.53165	2	1727.742847	1727.731713	R	H	276	290
PSM	LSIWGFFSTGDEHSR	1942	sp|Q91WU0|CES1F_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3463.4	61.68108	3	1737.816671	1737.811084	R	G	172	187
PSM	DAGYEFDICFTSVQK	1943	sp|Q9DBJ1|PGAM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	9-UNIMOD:4	ms_run[1]:scan=1.1.3417.18	60.428	2	1778.790647	1778.782152	R	R	47	62
PSM	EEFQQFAGLLQAGIEK	1944	sp|P47199|QOR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3608.15	65.77908	2	1806.927447	1806.915215	K	G	279	295
PSM	AIFASGSPFDPVTLPDGR	1945	sp|P06801|MAOX_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3472.20	61.93808	2	1845.937847	1845.926114	R	T	428	446
PSM	FFNQLFSGLDPHALAGR	1946	sp|Q9DBE0|CSAD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3512.3	63.04887	3	1888.967171	1888.958417	R	I	89	106
PSM	LIALSIDSVEDHLAWSK	1947	sp|O08709|PRDX6_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3426.8	60.67362	3	1896.009671	1895.999279	K	D	68	85
PSM	SLPADILYEDQQCLVFR	1948	sp|Q9D0S9|HINT2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	13-UNIMOD:4	ms_run[1]:scan=1.1.3607.8	65.74447	3	2066.025371	2066.014277	R	D	63	80
PSM	LFLYEPAGTETFSVESISK	1949	sp|Q91XE4|ACY3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3512.6	63.05387	3	2117.071271	2117.056853	R	N	153	172
PSM	LAPITSDPTEAAAVGAVEASFK	1950	sp|P52480|KPYM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3536.5	63.73458	3	2144.115071	2144.100115	R	C	401	423
PSM	FASLDVTHAALVNSLWHFGGNEK	1951	sp|Q9DCY0|KEG1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3448.4	61.26162	4	2512.269294	2512.249908	K	S	169	192
PSM	TFSHELSDFGLESTTGEVPVVAIR	1952	sp|P27773|PDIA3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3415.18	60.37015	3	2590.302971	2590.291498	K	T	306	330
PSM	VAPEEVSEVIFGHVLTAGCGQNPTR	1953	tr|Q80X81|Q80X81_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	19-UNIMOD:4	ms_run[1]:scan=1.1.3482.19	62.21853	3	2666.333771	2666.312250	K	Q	47	72
PSM	SGPFGQIFRPDNFVFGQSGAGNNWAK	1954	sp|P68372|TBB4B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3533.19	63.66013	3	2797.363871	2797.336097	R	G	78	104
PSM	IVGDLAQFMVQNGLSR	1955	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3530.19	63.57385	2	1746.896047	1746.908690	K	A	913	929
PSM	FGANAILGVSLAVCK	1956	sp|P17182|ENOA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	14-UNIMOD:4	ms_run[1]:scan=1.1.3408.18	60.16677	2	1519.823047	1518.822835	K	A	106	121
PSM	HIADLAGNPEVILPVPAFNVINGGSHAGNK	1957	sp|P17182|ENOA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3473.10	61.95728	4	3021.600094	3020.583204	R	L	133	163
PSM	IGAEVYHNLK	1958	sp|P17182|ENOA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2091.6	23.46143	3	1142.610371	1142.608408	R	N	184	194
PSM	VITAFNDGLNHLDSLK	1959	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3092.8	51.31345	3	1756.903571	1755.915549	K	G	68	84
PSM	CVIAEGDLGIVQK	1960	sp|Q9Z0S1|BPNT1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.3505.6	62.8627	2	1383.7125	1383.7063	R	T	28	41
PSM	VPEANSSWMDTVIR	1961	sp|Q8BMF4|ODP2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3101.15	51.57057	2	1603.772647	1603.766442	K	Q	486	500
PSM	VGHSELVGEIIR	1962	sp|P50516|VATA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2499.18	34.7452	2	1307.719047	1307.719750	R	L	45	57
PSM	GITINAAHVEYSTAAR	1963	sp|Q8BFR5|EFTU_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2460.11	33.67233	3	1672.850771	1672.853283	R	H	105	121
PSM	MQLIMLCYNPDFTR	1964	tr|F6WHQ7|F6WHQ7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	7-UNIMOD:4	ms_run[1]:scan=1.1.3503.19	62.81918	2	1800.844047	1800.836119	R	T	50	64
PSM	AINPENGFFGVAPGTSVK	1965	sp|Q9Z2V4|PCKGC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3123.21	52.18368	2	1804.909447	1803.915549	R	T	325	343
PSM	HLGLPVFNTVK	1966	sp|Q9WUM5|SUCA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2742.11	41.51302	2	1223.700447	1223.702643	K	E	95	106
PSM	MDASASAASVR	1967	sp|Q8CG76|ARK72_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.1949.19	19.53603	2	1065.492247	1064.492058	R	A	59	70
PSM	RTIAQDYGVLK	1968	sp|P35700|PRDX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2302.4	29.31322	3	1262.690171	1262.698286	K	A	110	121
PSM	KYNLGAPVAGTCYQAEWDDYVPK	1969	sp|P70296|PEBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	12-UNIMOD:4	ms_run[1]:scan=1.1.3158.20	53.18448	3	2644.250771	2644.226789	K	L	157	180
PSM	EEASDYLELDTIK	1970	sp|P08113|ENPL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3057.6	50.3286	2	1525.724047	1524.719535	K	N	253	266
PSM	VDVHFCGVNFADILACR	1971	sp|Q3UNZ8|QORL2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	6-UNIMOD:4,16-UNIMOD:4	ms_run[1]:scan=1.1.3538.7	63.79362	3	1991.946371	1991.934587	R	G	56	73
PSM	AGSDPVVIVSAAR	1972	sp|Q8CAY6|THIC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	20		ms_run[1]:scan=1.1.2532.16	35.67272	2	1240.6763	1240.6770	N	T	3	16
PSM	VFEFQLASEDMK	1973	tr|Q91WT7|Q91WT7_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3131.15	52.40587	2	1443.674447	1442.675167	K	V	283	295
PSM	ASGNAQIGK	1974	sp|Q61171|PRDX2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1	ms_run[1]:scan=1.1.1929.9	18.97372	2	886.4469	886.4503	M	S	2	11
PSM	IQIWDTAGQER	1975	sp|Q8K386|RAB15_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2692.14	40.1054	2	1315.651647	1315.652064	R	Y	59	70
PSM	ADLEEQLSDEEK	1976	sp|P47754|CAZA2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1	ms_run[1]:scan=1.1.3096.13	51.43092	2	1446.6492	1446.6352	M	V	2	14
PSM	AFIVLSPAYASHDPEALTR	1977	sp|Q8BGA8|ACSM5_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3069.14	50.66263	3	2057.066771	2057.058191	K	E	515	534
PSM	GAVDGGLSIPHSTK	1978	sp|P47962|RL5_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2239.7	27.58077	3	1337.689271	1337.693929	K	R	165	179
PSM	GAVEAAHQAAPGWGAQSPR	1979	sp|Q571I9|A16A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2246.15	27.77873	3	1859.909771	1859.902693	R	A	568	587
PSM	LSSAMSAAK	1980	sp|P14152|MDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.1770.14	14.5395	2	863.427047	864.437503	K	A	240	249
PSM	TDLTAVPASR	1981	sp|Q9JHI5|IVD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2188.16	26.18633	2	1030.540247	1029.545474	K	G	212	222
PSM	TRPTVAAGAVGLAQR	1982	sp|P45952|ACADM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2196.10	26.40762	3	1468.827971	1466.831760	R	A	280	295
PSM	LFGAAEVQR	1983	sp|P16546|SPTN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2340.5	30.37675	2	990.529847	989.529430	K	F	251	260
PSM	MGLDGLQQDYIRK	1984	sp|Q80XR2|AT2C1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	1-UNIMOD:35	ms_run[1]:scan=1.1.2430.14	32.86155	2	1550.772047	1551.771528	K	A	436	449
PSM	VAMSHFEPSEYIR	1985	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	3-UNIMOD:35	ms_run[1]:scan=1.1.2456.13	33.56477	3	1583.734571	1580.729329	K	Y	32	45
PSM	INFDDNAEFR	1986	sp|Q9Z2I8|SUCB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.2682.17	39.83443	2	1239.549847	1239.552016	K	Q	261	271
PSM	VNINGGAIALGHPLGASGCR	1987	tr|Q80X81|Q80X81_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	19-UNIMOD:4	ms_run[1]:scan=1.1.2772.12	42.3453	3	1933.985471	1932.995213	K	I	342	362
PSM	VTNGAFTGEISPGMIK	1988	sp|P17751|TPIS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.3011.16	49.05836	2	1621.806647	1620.818143	K	D	120	136
PSM	GGNASNSCTVLSLLGAR	1989	sp|P97328|KHK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20	8-UNIMOD:4	ms_run[1]:scan=1.1.3428.4	60.73435	2	1676.817847	1675.831168	R	C	40	57
PSM	AAVAAGCR	1990	sp|Q9CPY7|AMPL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	7-UNIMOD:4	ms_run[1]:scan=1.1.1625.11	10.52818	2	774.373247	774.380657	R	Q	123	131
PSM	LGIHEDSQNR	1991	sp|P07901|HS90A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1749.9	13.94563	3	1167.555671	1167.563249	K	K	448	458
PSM	KLEDGPK	1992	sp|P10126|EF1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1577.12	9.193916	2	785.420647	785.428319	K	F	386	393
PSM	SAAETVTK	1993	sp|Q64433|CH10_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1616.10	10.27612	2	805.411847	805.418148	R	G	21	29
PSM	ILAEGGGAK	1994	sp|Q8BFR5|EFTU_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1737.10	13.61652	2	814.447447	814.454868	K	F	80	89
PSM	SGVEAMNK	1995	sp|Q9CQ62|DECR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1703.11	12.68693	2	834.382847	834.390553	K	S	215	223
PSM	ILSNNPSK	1996	sp|P51855|GSHB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1703.14	12.68943	2	871.470047	871.476331	K	G	179	187
PSM	HALSAGYR	1997	sp|Q9JII6|AK1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1715.9	13.0118	2	873.439647	873.445700	K	H	35	43
PSM	RGYPVYSHTEK	1998	sp|Q91XE0|GLYAT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1728.16	13.37105	3	1335.650471	1335.657149	K	S	257	268
PSM	RGYPVYSHTEK	1999	sp|Q91XE0|GLYAT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1721.14	13.17793	3	1335.650471	1335.657149	K	S	257	268
PSM	ASLDHTVR	2000	sp|Q9DBM2|ECHP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1696.19	12.50002	2	897.460247	897.466829	K	A	39	47
PSM	RGSVSLGNK	2001	sp|Q64442|DHSO_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1648.18	11.1634	2	916.501847	916.509029	R	V	167	176
PSM	HGVYNPNK	2002	sp|P08249|MDHM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1626.17	10.5613	2	927.449647	927.456265	K	I	158	166
PSM	SAEAAAEATK	2003	sp|Q8VC30|TKFC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1650.15	11.21728	2	947.447247	947.455990	K	N	526	536
PSM	GENCIAAGR	2004	sp|Q8K009|AL1L2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	4-UNIMOD:4	ms_run[1]:scan=1.1.1742.19	13.76273	2	946.421847	946.429064	K	L	725	734
PSM	KVQQELSR	2005	sp|P51855|GSHB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1652.15	11.27302	2	986.542847	986.550893	K	V	306	314
PSM	NQAADQITK	2006	sp|Q9Z2I8|SUCB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1724.15	13.26075	2	987.490847	987.498523	K	L	220	229
PSM	VIAATGSDEK	2007	sp|Q3UNZ8|QORL2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1713.9	12.96323	2	989.496247	989.502940	K	C	192	202
PSM	HHVLHDQNVDKR	2008	sp|Q60597|ODO1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1578.17	9.2263	3	1496.754071	1496.759657	R	T	687	699
PSM	LKEEEEDK	2009	sp|P14211|CALR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1574.20	9.115784	2	1018.478447	1018.481870	R	K	367	375
PSM	NLQAQVSHR	2010	sp|Q9R0H0|ACOX1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1727.20	13.34703	2	1051.545247	1051.552290	K	K	501	510
PSM	KHGVYNPNK	2011	sp|P08249|MDHM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1575.19	9.142867	2	1055.544447	1055.551228	K	I	157	166
PSM	SHDQEQLKK	2012	sp|Q3UNX5|ACSM3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1566.20	8.898067	2	1111.557647	1111.562186	K	E	526	535
PSM	GSGTAEVELKK	2013	sp|P52480|KPYM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1762.20	14.3204	2	1117.590847	1117.597903	K	G	126	137
PSM	EGVHGGLINKK	2014	sp|P62962|PROF1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1683.20	12.13398	2	1150.641247	1150.645856	K	C	117	128
PSM	SCCSCCPVGCSK	2015	sp|P02802|MT1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	2-UNIMOD:4,3-UNIMOD:4,5-UNIMOD:4,6-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.1759.21	14.2366	2	1460.492447	1460.497497	K	C	32	44
PSM	KHNLCGETEEER	2016	sp|O35660|GSTM6_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	5-UNIMOD:4	ms_run[1]:scan=1.1.1643.19	11.02435	3	1500.654371	1500.662705	R	I	83	95
PSM	HQIVEVAGDDK	2017	sp|Q5FWK3|RHG01_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1896.21	18.0723	2	1209.596847	1209.598966	R	Y	70	81
PSM	LGVIEDHSNR	2018	sp|P08113|ENPL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1872.7	17.39302	3	1138.566071	1138.573085	K	T	494	504
PSM	GAGTDDHTLIR	2019	sp|P48036|ANXA5_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1887.7	17.8081	3	1154.562071	1154.568000	K	V	259	270
PSM	ALQASALK	2020	tr|A6ZI46|A6ZI46_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1930.9	19.00195	2	800.468647	800.475603	R	A	360	368
PSM	GASIVEDK	2021	sp|P26443|DHE3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1772.12	14.59425	2	817.410847	817.418148	R	L	77	85
PSM	RALANSLACQGK	2022	tr|A6ZI46|A6ZI46_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	9-UNIMOD:4	ms_run[1]:scan=1.1.1843.12	16.5857	3	1287.660671	1287.671754	K	Y	386	398
PSM	DNHVVAAGSMER	2023	sp|Q91X91|NADC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1918.11	18.66708	3	1284.590771	1284.588084	K	A	172	184
PSM	HLAPDYR	2024	sp|Q9D964|GATM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1786.17	14.99065	2	870.427647	870.434801	R	V	284	291
PSM	SAIGEGMTR	2025	sp|P62814|VATB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1945.11	19.41797	2	920.433247	920.438566	K	K	404	413
PSM	GCEVVVSGK	2026	sp|P62908|RS3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	2-UNIMOD:4	ms_run[1]:scan=1.1.1833.14	16.30725	2	933.453247	933.458967	K	L	133	142
PSM	SGKPAELLK	2027	sp|P40142|TKT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1808.14	15.60287	2	941.547847	941.554582	R	M	595	604
PSM	VNVVEQEK	2028	sp|P17182|ENOA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1803.17	15.46442	2	943.491047	943.497461	K	I	82	90
PSM	YYGAQTVR	2029	sp|P97807|FUMH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1935.13	19.14538	2	956.467447	956.471580	K	S	64	72
PSM	VLENAEGAR	2030	sp|P38647|GRP75_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1789.20	15.076	2	957.481047	957.487959	K	T	77	86
PSM	EGDPDQLSK	2031	sp|P97816|S100G_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1782.20	14.88045	2	987.444647	987.450905	K	E	21	30
PSM	AAASTDYYK	2032	sp|P35486|ODPA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1859.16	17.03398	2	988.449847	988.450176	R	R	236	245
PSM	TNADTDGMVK	2033	sp|O08749|DLDH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1819.17	15.91503	2	1050.457247	1050.465174	K	I	431	441
PSM	MDASASAASVR	2034	sp|Q8CG76|ARK72_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1954.18	19.67615	2	1064.488047	1064.492058	R	A	59	70
PSM	LSGTGSAGATIR	2035	sp|Q9D0F9|PGM1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1925.19	18.86898	2	1089.572847	1089.577836	R	L	504	516
PSM	LHPNDEDIHTANER	2036	sp|Q91YI0|ARLY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1812.19	15.7198	3	1659.757571	1659.760111	K	R	81	95
PSM	SVIGHLHPHGG	2037	tr|Q91VA7|Q91VA7_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1774.21	14.65787	2	1109.562047	1109.573026	K	-	374	385
PSM	AIDVEQGQTR	2038	sp|P35505|FAAA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1924.17	18.83935	2	1115.555247	1115.557101	K	T	372	382
PSM	NHGVVMPDANK	2039	sp|Q9EQ20|MMSA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1841.17	16.53337	2	1180.560847	1180.565892	K	E	288	299
PSM	GVSQAVEHINK	2040	sp|P17182|ENOA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1889.5	17.86227	3	1180.618271	1180.620036	K	T	61	72
PSM	DSYVGDEAQSK	2041	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1913.20	18.53735	2	1197.513247	1197.514961	K	R	51	62
PSM	MQHLEQTLSK	2042	sp|P07758|A1AT1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1930.18	19.00947	2	1213.610047	1213.612507	K	E	278	288
PSM	DGASEEETNLSK	2043	sp|Q8VCT4|CES1D_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1935.21	19.15205	2	1278.557447	1278.557555	K	M	481	493
PSM	QYDISNPQKPR	2044	sp|P17563|SBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1949.12	19.53018	3	1344.673271	1344.678613	R	L	334	345
PSM	QHLQIQSSQSHLNK	2045	sp|Q91XE0|GLYAT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1795.20	15.24153	3	1646.845571	1646.848866	K	T	100	114
PSM	HHAAYVNNLNATEEK	2046	sp|P09671|SODM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1847.21	16.70508	2	1709.811247	1709.812147	K	Y	54	69
PSM	KHEAFETDFTVHK	2047	sp|P16546|SPTN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2056.11	22.49667	4	1587.768894	1587.768157	K	D	1911	1924
PSM	DAIVQAVK	2048	sp|P40142|TKT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2124.8	24.37505	2	842.479247	842.486168	K	G	610	618
PSM	CAADLGLK	2049	sp|P70349|HINT1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	1-UNIMOD:4	ms_run[1]:scan=1.1.2123.9	24.3486	2	846.420247	846.426939	K	R	84	92
PSM	YGLQVGGAACHR	2050	sp|Q91X91|NADC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	10-UNIMOD:4	ms_run[1]:scan=1.1.2058.10	22.55022	3	1287.607871	1287.614239	K	Y	150	162
PSM	LAVSQVPR	2051	sp|P40142|TKT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2123.12	24.3511	2	868.506447	868.513051	R	S	587	595
PSM	TALAMGADR	2052	sp|Q9DCW4|ETFB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2004.13	21.06553	2	904.438847	904.443651	R	G	77	86
PSM	ATQEAFMK	2053	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1983.14	20.47805	2	924.431847	924.437503	K	R	323	331
PSM	VCNPIITK	2054	sp|P63017|HSP7C_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	2-UNIMOD:4	ms_run[1]:scan=1.1.2119.9	24.23613	2	943.511247	943.516088	K	L	602	610
PSM	AVEAFETAK	2055	sp|Q64442|DHSO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2061.11	22.63398	2	964.480647	964.486562	K	K	331	340
PSM	LVAQGSPPLK	2056	sp|Q9DBM2|ECHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2101.10	23.73703	2	1008.589647	1008.596781	R	E	696	706
PSM	ITQSNAILR	2057	sp|P10649|GSTM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2098.14	23.6579	2	1014.576447	1014.582194	K	Y	70	79
PSM	TQVQSVIDK	2058	sp|Q00623|APOA1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2026.15	21.67753	2	1016.544447	1016.550225	K	A	248	257
PSM	RNELWAAR	2059	sp|Q7TNG8|LDHD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2028.16	21.734	2	1014.531447	1014.535912	K	H	340	348
PSM	TAVCDIPPR	2060	sp|P68372|TBB4B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	4-UNIMOD:4	ms_run[1]:scan=1.1.2142.16	24.88568	2	1027.507047	1027.512065	K	G	351	360
PSM	TAVCDIPPR	2061	sp|P68372|TBB4B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	4-UNIMOD:4	ms_run[1]:scan=1.1.2123.18	24.3561	2	1027.508447	1027.512065	K	G	351	360
PSM	LMHTHQTVDFVSR	2062	sp|Q9QXN5|MIOX_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2093.15	23.52323	3	1569.768971	1569.772196	K	K	46	59
PSM	NMMAACDPR	2063	sp|P68372|TBB4B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	6-UNIMOD:4	ms_run[1]:scan=1.1.2017.18	21.43315	2	1064.416447	1064.420156	K	H	298	307
PSM	EGSSIGAIDSR	2064	sp|Q9CZU6|CISY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2084.20	23.27625	2	1090.521447	1090.525467	R	L	223	234
PSM	FQHYMVGPK	2065	sp|P40936|INMT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2061.16	22.63817	2	1105.534247	1105.537886	R	K	202	211
PSM	CATITPDEAR	2066	sp|P54071|IDHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	1-UNIMOD:4	ms_run[1]:scan=1.1.1971.20	20.1566	2	1132.515647	1132.518273	K	V	113	123
PSM	VTLTPEEEAR	2067	sp|P06151|LDHA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2155.17	25.25558	2	1143.574647	1143.577168	K	L	306	316
PSM	SGTVDPQELQK	2068	sp|Q6P069|SORCN_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2092.18	23.49858	2	1200.596847	1200.598632	R	A	117	128
PSM	TNEAQAIETAR	2069	sp|P61089|UBE2N_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2029.18	21.76365	2	1202.581247	1202.589129	K	A	131	142
PSM	EGALCEENMR	2070	sp|P58252|EF2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	5-UNIMOD:4	ms_run[1]:scan=1.1.2052.18	22.39472	2	1207.496447	1207.496157	K	G	689	699
PSM	AEMDAAVESCK	2071	sp|Q9EQ20|MMSA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	10-UNIMOD:4	ms_run[1]:scan=1.1.2009.17	21.21112	2	1209.496847	1209.500574	K	R	77	88
PSM	GVDLQESNPASR	2072	sp|P35278|RAB5C_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2137.21	24.74727	2	1271.609247	1271.610593	R	S	199	211
PSM	AVYQGPGSSPVKS	2073	sp|O88587|COMT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2117.20	24.18848	2	1275.639447	1275.645916	K	-	253	266
PSM	AQEIDQTNDFK	2074	sp|Q9JHI5|IVD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2142.21	24.88985	2	1307.598447	1307.599360	K	N	66	77
PSM	HGESAWNLENR	2075	sp|Q9DBJ1|PGAM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2122.11	24.32302	3	1311.587471	1311.595612	R	F	11	22
PSM	IYIDSNNNPER	2076	sp|Q68FD5|CLH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2150.21	25.11625	2	1333.623047	1333.626243	K	F	882	893
PSM	SLQEQADAAEER	2077	tr|E9Q453|E9Q453_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2037.20	21.9855	2	1345.608247	1345.610987	R	A	16	28
PSM	YMCENQATISSK	2078	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	3-UNIMOD:4	ms_run[1]:scan=1.1.2069.21	22.8649	2	1430.616847	1430.617001	K	L	287	299
PSM	EVYQQQQYGSGGR	2079	sp|Q99020|ROAA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1969.21	20.10162	2	1498.672247	1498.680070	K	G	238	251
PSM	TAELLSHHQVEIK	2080	sp|Q64516|GLPK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2130.14	24.54367	3	1503.800171	1503.804542	K	Q	32	45
PSM	VCHAHPTLSEAFR	2081	sp|O08749|DLDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	2-UNIMOD:4	ms_run[1]:scan=1.1.2066.17	22.77833	3	1523.727071	1523.730331	R	E	483	496
PSM	AVTEQGAELSNEER	2082	sp|P68254|1433T_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2087.21	23.36143	2	1531.709847	1531.711430	K	N	28	42
PSM	LFQECCPHSTDR	2083	sp|P61979|HNRPK_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	5-UNIMOD:4,6-UNIMOD:4	ms_run[1]:scan=1.1.1970.17	20.12627	3	1548.644171	1548.644947	K	V	180	192
PSM	ALLATASQCQQPAGNK	2084	sp|P40124|CAP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	9-UNIMOD:4	ms_run[1]:scan=1.1.2156.21	25.28743	2	1656.825247	1656.825354	R	L	84	100
PSM	TVAVYSEQDTGQMHR	2085	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2117.17	24.18598	3	1720.784471	1720.783883	R	Q	63	78
PSM	ALKPGEENFPVDEHGK	2086	sp|Q91WR5|AK1CL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1000663, ProteinPilot, ]	19		ms_run[1]:scan=1.1.2115.19	24.13127	3	1765.8543706434903	1765.8635130256903	M	L	121	137
PSM	GQAVNDLITNR	2087	sp|Q91WU0|CES1F_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2364.13	31.02825	2	1199.625447	1199.625849	R	K	94	105
PSM	VVAGVAAALAHK	2088	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2247.5	27.79808	3	1105.655771	1105.660778	K	Y	134	146
PSM	APIIAVTR	2089	sp|P52480|KPYM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2271.3	28.45815	2	839.515847	839.522888	R	N	448	456
PSM	ALDLDPSK	2090	sp|Q8BWT1|THIM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2236.7	27.49978	2	857.443847	857.449448	K	T	333	341
PSM	AFAENLGR	2091	sp|Q7TNG8|LDHD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2164.11	25.5043	2	876.440647	876.445366	K	R	423	431
PSM	ALIADSGLK	2092	sp|Q9Z2I9|SUCB1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2302.5	29.31405	2	886.507247	886.512383	K	I	418	427
PSM	KFPPDGSAPYGAR	2093	sp|Q9QXD6|F16P1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2294.9	29.09367	3	1361.678471	1361.672800	K	Y	232	245
PSM	ATDFVVDR	2094	sp|P54071|IDHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2224.11	27.1762	2	921.449847	921.455596	K	A	181	189
PSM	YLAEFATGNDRK	2095	sp|P62259|1433E_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2192.13	26.29797	3	1383.674171	1383.678279	R	E	131	143
PSM	RLFLHESIHNEVVDR	2096	sp|Q9DBF1|AL7A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2243.11	27.69298	4	1862.971294	1862.975130	R	L	335	350
PSM	EVGVGFATR	2097	sp|P04117|FABP4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2305.5	29.39928	2	934.480047	934.487231	K	K	23	32
PSM	FDSQTVLK	2098	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2249.11	27.8589	2	936.487847	936.491647	K	V	292	300
PSM	IIALDGDTK	2099	sp|P40142|TKT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2281.12	28.74383	2	944.513247	944.517862	R	N	335	344
PSM	AAEDYGVIK	2100	sp|P37804|TAGL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2180.12	25.95887	2	964.479247	964.486562	K	T	100	109
PSM	DPAQGQLLK	2101	sp|P13707|GPDA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2165.13	25.53435	2	968.524447	968.529095	K	D	170	179
PSM	NIMALSDGGK	2102	sp|P12658|CALB1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2321.13	29.84817	2	1004.491647	1004.496081	K	L	237	247
PSM	VHQILEGSNEVMR	2103	sp|Q9D7B6|ACAD8_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2244.14	27.7228	3	1510.753871	1510.756212	R	M	391	404
PSM	VTLVSAAPEK	2104	sp|Q9CQR4|ACO13_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2186.13	26.12673	2	1013.570247	1013.575711	K	L	28	38
PSM	SLHTLFGDK	2105	sp|P07724|ALBU_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2265.2	28.29138	3	1016.522771	1016.529095	K	L	89	98
PSM	TAVCDIPPR	2106	sp|P68372|TBB4B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	4-UNIMOD:4	ms_run[1]:scan=1.1.2172.17	25.73697	2	1027.510047	1027.512065	K	G	351	360
PSM	TAVCDIPPR	2107	sp|P68372|TBB4B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	4-UNIMOD:4	ms_run[1]:scan=1.1.2166.16	25.56518	2	1027.510047	1027.512065	K	G	351	360
PSM	SGEIEPVSVK	2108	sp|Q64433|CH10_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2170.15	25.67808	2	1043.547247	1043.549890	K	V	57	67
PSM	TYVGVVDGEK	2109	sp|Q62468|VILI_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2176.14	25.84887	2	1065.530847	1065.534240	R	E	206	216
PSM	INAVDYASVK	2110	sp|Q8VCR7|ABHEB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2356.13	30.81338	2	1078.559647	1078.565875	K	T	142	152
PSM	LRVDPVNFK	2111	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2354.4	30.75115	3	1086.612071	1086.618579	K	L	92	101
PSM	FNSSISYDR	2112	sp|Q91YI0|ARLY_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2216.18	26.96092	2	1087.490047	1087.493438	K	H	24	33
PSM	IGFTGSTEVGK	2113	sp|Q8R0Y6|AL1L1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2313.15	29.62715	2	1094.558847	1094.560789	K	H	646	657
PSM	LHIVQVVCK	2114	sp|Q9Z1Q5|CLIC1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	8-UNIMOD:4	ms_run[1]:scan=1.1.2203.17	26.60982	2	1094.624047	1094.627036	K	K	184	193
PSM	LHVDPENFR	2115	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2284.2	28.81812	3	1125.551771	1125.556707	K	L	97	106
PSM	IDVSVEAASGGK	2116	sp|O08749|DLDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2280.16	28.71915	2	1131.571847	1131.577168	K	A	289	301
PSM	VNVPVIGGHAGK	2117	sp|P08249|MDHM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2209.11	26.76958	2	1146.647447	1146.650942	R	T	192	204
PSM	PFFHSLCDK	2118	sp|P10639|THIO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	7-UNIMOD:4	ms_run[1]:scan=1.1.2303.3	29.34082	3	1149.521171	1149.527715	K	Y	40	49
PSM	ATAVMPDGQFK	2119	sp|P35700|PRDX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2359.7	30.8956	2	1163.562047	1163.564495	K	D	17	28
PSM	HIYFITGETK	2120	sp|P07901|HS90A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2353.18	30.73535	2	1207.620647	1207.623724	K	D	491	501
PSM	SNFEEALAAHK	2121	sp|P09103|PDIA1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2240.19	27.6179	2	1215.583247	1215.588401	K	Y	34	45
PSM	ANIIYPGHGPVIHNAEAK	2122	sp|Q99KR3|LACB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2228.18	27.29222	3	1899.999671	1899.995531	K	I	192	210
PSM	ELISNSSDALDK	2123	sp|P07901|HS90A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2341.15	30.40955	2	1290.627247	1290.630326	R	I	47	59
PSM	ITWSNPPAQGAR	2124	sp|P05201|AATC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2336.16	30.27247	2	1296.654847	1296.657484	R	I	294	306
PSM	EDQTEYLEER	2125	sp|P07901|HS90A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2281.20	28.75052	2	1310.559847	1310.562640	K	R	192	202
PSM	NDIGATVHELSR	2126	sp|P16331|PH4H_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2324.18	29.93667	2	1310.653847	1310.657878	R	D	100	112
PSM	HQTVLDNTEGKNPAEWAK	2127	sp|Q921I1|TRFE_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2283.19	28.8053	3	2037.010571	2036.991568	K	N	555	573
PSM	AHSSMVGVNLPQK	2128	sp|P09411|PGK1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2183.21	26.04902	2	1366.701447	1366.702719	R	A	172	185
PSM	SEPIPESNEGPVK	2129	sp|P27773|PDIA3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2190.21	26.24755	2	1381.671447	1381.672525	K	V	367	380
PSM	NFTDVHPDYGAR	2130	sp|P24270|CATA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2264.20	28.27867	2	1390.624447	1390.626578	K	I	481	493
PSM	NFTDVHPDYGAR	2131	sp|P24270|CATA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2257.20	28.08747	2	1390.624447	1390.626578	K	I	481	493
PSM	RYTMGDAPDFDR	2132	sp|P10649|GSTM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2367.14	31.11088	2	1442.622847	1442.624863	K	S	32	44
PSM	TRPTVAAGAVGLAQR	2133	sp|P45952|ACADM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2204.14	26.63435	3	1466.829371	1466.831760	R	A	280	295
PSM	GDGPVQGTIHFEQK	2134	sp|P08228|SODC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2284.10	28.82563	3	1511.737871	1511.736856	K	A	11	25
PSM	IECESAETTEDCIEK	2135	sp|Q921I1|TRFE_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	3-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.2228.21	27.29472	2	1812.750647	1812.739361	K	I	384	399
PSM	SQLCSQSLEITR	2136	sp|Q9Z1Z0|USO1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	4-UNIMOD:4	ms_run[1]:scan=1.1.2463.18	33.75763	2	1420.687647	1420.698028	K	L	799	811
PSM	ALEVLVAK	2137	sp|Q9JII6|AK1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2452.3	33.45075	2	841.522447	841.527304	K	G	146	154
PSM	LAILGIHNEVSK	2138	sp|Q7TPR4|ACTN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2530.3	35.60637	3	1292.737871	1292.745236	R	I	566	578
PSM	LNFAVASR	2139	sp|P27773|PDIA3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2383.8	31.5451	2	876.475647	876.481751	K	K	297	305
PSM	SPAQILIR	2140	sp|Q9DCT1|AKCL2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2502.7	34.81865	2	896.539647	896.544351	K	F	229	237
PSM	VTLITENLGHPR	2141	sp|A2ARV4|LRP2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2418.5	32.51457	3	1348.741571	1348.746299	R	G	501	513
PSM	VGLQVVAVK	2142	sp|P63038|CH60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2484.4	34.31664	2	911.575647	911.580403	K	A	293	302
PSM	VGDVYIPR	2143	sp|Q62093|SRSF2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2396.5	31.90648	2	917.493047	917.497067	R	D	40	48
PSM	VFIEDVSK	2144	sp|P16460|ASSY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2393.6	31.82428	2	935.492047	935.496398	K	E	59	67
PSM	AHGGYSVFAGVGER	2145	sp|P56480|ATPB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2387.8	31.65725	3	1405.670471	1405.673862	K	T	226	240
PSM	FSGVYLEK	2146	sp|P40936|INMT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2415.6	32.43368	2	941.481447	941.485834	K	E	212	220
PSM	LPLQDVYK	2147	sp|P10126|EF1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2547.6	36.08012	2	974.539247	974.543683	R	I	248	256
PSM	TDEYLLAR	2148	sp|P98078|DAB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2427.7	32.7672	2	979.495447	979.497461	K	F	35	43
PSM	EVGVYEALK	2149	sp|P14152|MDHC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2469.6	33.90882	2	1006.526247	1006.533512	K	D	206	215
PSM	LISEVIGER	2150	sp|P13707|GPDA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2506.11	34.93362	2	1014.566047	1014.570960	K	L	131	140
PSM	FPALTPEQK	2151	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2447.11	33.31987	2	1029.548447	1029.549496	R	K	5	14
PSM	MESALDQLK	2152	sp|Q93092|TALDO_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2448.10	33.34667	2	1033.508047	1033.511396	R	Q	11	20
PSM	FSGDVVLAAR	2153	sp|P48758|CBR1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2554.8	36.26855	2	1033.552447	1033.555644	K	D	29	39
PSM	MFASFPTTK	2154	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	1-UNIMOD:35	ms_run[1]:scan=1.1.2567.7	36.62923	2	1044.493047	1044.495018	R	T	33	42
PSM	QLLLTADDR	2155	tr|A6ZI46|A6ZI46_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2450.7	33.40547	2	1043.558047	1043.561124	R	V	116	125
PSM	LSPVAEEFR	2156	sp|Q00623|APOA1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2476.13	34.10497	2	1046.531447	1046.539660	R	D	164	173
PSM	ALGLSNFNSR	2157	sp|Q9JII6|AK1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2541.14	35.92212	2	1077.553247	1077.556707	K	Q	158	168
PSM	VLLPEYGGTK	2158	sp|Q64433|CH10_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2526.10	35.49868	2	1075.587247	1075.591361	K	V	71	81
PSM	DTQDILYAR	2159	sp|Q8R4N0|CLYBL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2552.7	36.2184	2	1093.535847	1093.540388	K	Q	216	225
PSM	ATQALVLAPTR	2160	sp|P60843|IF4A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2451.7	33.43062	2	1139.659447	1139.666258	K	E	100	111
PSM	DTTASAVAVGLR	2161	sp|Q8BMS1|ECHA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2538.9	35.83352	2	1159.619247	1159.619701	K	Q	520	532
PSM	LDDCGLTEVR	2162	sp|Q91VI7|RINI_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	4-UNIMOD:4	ms_run[1]:scan=1.1.2420.18	32.58042	2	1176.540247	1176.544488	R	C	30	40
PSM	SEFYADEISK	2163	sp|O55137|ACOT1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2466.7	33.83573	2	1187.532847	1187.534634	K	R	329	339
PSM	IDVVNLEGNQR	2164	sp|A2ARV4|LRP2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2560.14	36.43907	2	1255.651847	1255.652064	R	V	490	501
PSM	LMIEMDGTENK	2165	sp|P17182|ENOA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2561.16	36.46887	2	1279.577247	1279.578824	K	S	93	104
PSM	ILACDDLDEAAK	2166	sp|Q9Z2I9|SUCB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	4-UNIMOD:4	ms_run[1]:scan=1.1.2474.16	34.05233	2	1332.621447	1332.623132	K	M	427	439
PSM	GISQEQMQEFR	2167	sp|P57780|ACTN4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2427.20	32.77805	2	1351.620647	1351.619049	K	A	762	773
PSM	LGGTCVNVGCVPK	2168	sp|P47791|GSHR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	5-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.2415.20	32.44537	2	1359.662647	1359.663892	K	K	76	89
PSM	LGESQTLQQFSR	2169	sp|P16546|SPTN1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2527.18	35.53397	2	1392.699247	1392.699743	K	D	1547	1559
PSM	RYTMGDAPDFDR	2170	sp|P10649|GSTM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2374.11	31.2992	3	1442.620571	1442.624863	K	S	32	44
PSM	VHFLVDEGYEDR	2171	sp|Q60866|PTER_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2562.8	36.4902	3	1477.683671	1477.683758	R	I	281	293
PSM	GAQVIENCAVTGIR	2172	sp|Q99LB7|SARDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	8-UNIMOD:4	ms_run[1]:scan=1.1.2521.20	35.36643	2	1486.755247	1486.756212	R	V	229	243
PSM	ELSTTLNADEAVTR	2173	sp|Q61316|HSP74_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2550.12	36.16603	2	1518.749647	1518.752566	K	G	361	375
PSM	AFVDSCLQLHETK	2174	sp|P51174|ACADL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	6-UNIMOD:4	ms_run[1]:scan=1.1.2493.6	34.57037	3	1546.740671	1546.744979	R	R	346	359
PSM	NQVAMNPTNTVFDAK	2175	sp|P63017|HSP7C_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	5-UNIMOD:35	ms_run[1]:scan=1.1.2445.21	33.27298	2	1664.786447	1664.782821	K	R	57	72
PSM	FSVCVLGDQQHCDEAK	2176	tr|A0A3B2W820|A0A3B2W820_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	4-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.2516.17	35.2215	3	1891.820171	1891.819283	K	A	63	79
PSM	VAVTGGTHGNEMCGVYLAR	2177	sp|Q91XE4|ACY3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	13-UNIMOD:4	ms_run[1]:scan=1.1.2474.21	34.05652	2	1990.942047	1990.935315	R	Y	14	33
PSM	EATQAVLDKPETLSSDASTR	2178	sp|P50544|ACADV_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2400.18	32.02672	3	2118.048071	2118.044057	R	E	44	64
PSM	ALEHFTDLYDIKR	2179	sp|Q68FD5|CLH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2678.2	39.70785	4	1619.825694	1619.830757	R	A	626	639
PSM	HFSVEGQLEFR	2180	sp|P07901|HS90A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2658.4	39.15988	3	1347.653471	1347.657149	K	A	329	340
PSM	FHADFLLQHVK	2181	sp|Q8R164|BPHL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2611.8	37.85745	3	1353.714671	1353.719356	R	G	250	261
PSM	VAIDLGYR	2182	sp|P45376|ALDR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2607.4	37.74278	2	905.491447	905.497067	K	H	34	42
PSM	RFSMVIDNGIVK	2183	sp|P99029|PRDX5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2703.5	40.40552	3	1377.741371	1377.743856	K	A	176	188
PSM	IAQNFGLQHLSSGHLLR	2184	sp|Q9WUR9|KAD4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2667.3	39.40351	4	1890.022094	1890.022414	R	E	25	42
PSM	VDFNVPMK	2185	sp|P09041|PGK2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2641.4	38.68118	2	948.469647	948.473889	R	N	23	31
PSM	FFVGGNWK	2186	sp|P17751|TPIS_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2769.4	42.25473	2	953.473847	953.475938	K	M	57	65
PSM	LCAIPNLR	2187	sp|P07724|ALBU_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	2-UNIMOD:4	ms_run[1]:scan=1.1.2579.4	36.96492	2	955.523447	955.527321	K	E	98	106
PSM	YDGIILPGK	2188	sp|Q9CXW4|RL11_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2691.5	40.06997	2	974.538647	974.543683	K	-	170	179
PSM	SPWWVQVTSTGKPGHASR	2189	tr|A0A087WPX1|A0A087WPX1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2578.3	36.93645	4	1979.989694	1979.996593	R	F	192	210
PSM	EGGLLTLAGAK	2190	sp|Q8BVI4|DHPR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2734.3	41.28271	2	1028.582847	1028.586610	K	A	125	136
PSM	NLHHEVELGVLLGK	2191	sp|Q8R0F8|FAHD1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2641.9	38.68537	3	1556.865971	1556.867477	R	R	70	84
PSM	RIPQSTLSEFYPR	2192	sp|P62814|VATB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2703.12	40.41137	3	1592.833571	1592.831091	K	D	494	507
PSM	EIIDPVLDR	2193	sp|P68368|TBA4A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2765.8	42.14665	2	1068.577847	1068.581525	K	I	113	122
PSM	LGDVYVNDAFGTAHR	2194	sp|P09041|PGK2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2677.9	39.68515	3	1633.788071	1633.784869	K	A	157	172
PSM	AELNEFLTR	2195	sp|P62908|RS3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2759.10	41.98005	2	1091.558847	1091.561124	K	E	19	28
PSM	IEAACFATIK	2196	sp|Q9D6R2|IDH3A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	5-UNIMOD:4	ms_run[1]:scan=1.1.2604.13	37.66803	2	1122.573647	1122.574331	K	D	327	337
PSM	LSISGEYNLK	2197	sp|P07758|A1AT1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2591.12	37.30499	2	1122.589047	1122.592090	R	T	309	319
PSM	LYTLVLTDPDAPSRK	2198	sp|P70296|PEBP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2762.14	42.06777	3	1687.917371	1687.914486	K	D	63	78
PSM	ALTGGIAHLFK	2199	sp|O08749|DLDH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2692.2	40.09455	3	1126.644371	1126.649879	K	Q	133	144
PSM	IIFVVGGPGSGK	2200	sp|Q9R0Y5|KAD1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2773.10	42.37197	2	1129.640647	1129.649545	K	G	10	22
PSM	EAESIYSLAR	2201	sp|Q9JIL4|NHRF3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2592.13	37.3344	2	1137.563447	1137.566603	K	F	323	333
PSM	ILEATAHAQAQLGCPVIIHPGR	2202	sp|Q60866|PTER_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	14-UNIMOD:4	ms_run[1]:scan=1.1.2666.10	39.38312	4	2351.258894	2351.253219	K	N	183	205
PSM	FVGAVDPIMEK	2203	sp|Q91YI0|ARLY_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2750.5	41.73043	2	1204.614647	1204.616196	R	F	13	24
PSM	HSQAVEELADQLEQTK	2204	sp|Q8VDD5|MYH9_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2769.11	42.26057	3	1824.888071	1824.885371	K	R	1194	1210
PSM	ENVLIGEGAGFK	2205	sp|P45952|ACADM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2724.12	41.01373	2	1232.641047	1232.640102	K	I	260	272
PSM	KLGESCIFAPANVTSEK	2206	sp|O08756|HCD2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	6-UNIMOD:4	ms_run[1]:scan=1.1.2587.15	37.19485	3	1849.927571	1849.924400	K	E	53	70
PSM	VFVTGPLPAEGR	2207	sp|Q91Z53|GRHPR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2701.13	40.3547	2	1241.676247	1241.676822	K	A	9	21
PSM	EVDIGIPDATGR	2208	sp|Q01853|TERA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2776.11	42.45665	2	1241.626647	1241.625181	R	L	366	378
PSM	VTIEYYSQLK	2209	sp|Q9JLJ2|AL9A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2692.11	40.10205	2	1242.653447	1242.649604	R	T	472	482
PSM	YMACCLLYR	2210	sp|P05213|TBA1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	4-UNIMOD:4,5-UNIMOD:4	ms_run[1]:scan=1.1.2748.11	41.67943	2	1248.545847	1248.545356	K	G	312	321
PSM	EKLEASITEYA	2211	sp|P10639|THIO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2700.15	40.32775	2	1252.617247	1252.618698	K	-	95	106
PSM	TVLVSEGIVTPR	2212	sp|A2ARV4|LRP2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2713.15	40.69992	2	1269.727247	1269.729252	R	G	2227	2239
PSM	LLVVDPETDER	2213	sp|P70441|NHRF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2620.14	38.10622	2	1284.656847	1284.656146	R	L	88	99
PSM	HALIIYDDLSK	2214	sp|Q03265|ATPA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2629.15	38.35367	2	1286.689247	1286.687053	K	Q	306	317
PSM	KAPDFVFYAPR	2215	sp|P26040|EZRI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2733.6	41.2622	2	1309.684047	1309.681908	K	L	263	274
PSM	LADIQIEQLNR	2216	sp|Q9CWM4|PFD1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2779.14	42.54258	2	1311.719847	1311.714664	K	T	29	40
PSM	HLGFQSAVEALR	2217	tr|A0A0J9YTU1|A0A0J9YTU1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2694.2	40.14895	3	1326.704171	1326.704434	K	G	198	210
PSM	IGAFGYMECSAK	2218	sp|Q9QUI0|RHOA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	9-UNIMOD:4	ms_run[1]:scan=1.1.2682.19	39.8361	2	1332.589247	1332.584244	R	T	151	163
PSM	TDTDAELDLVSR	2219	sp|Q922D8|C1TC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2704.14	40.44182	2	1333.639047	1333.636139	K	L	761	773
PSM	GTDFQLNQLEGK	2220	sp|Q921I1|TRFE_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2744.18	41.57493	2	1348.662847	1348.662294	K	K	123	135
PSM	VIDPATATSVDLR	2221	sp|P80315|TCPD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2728.17	41.1311	2	1356.724047	1356.724895	K	D	194	207
PSM	LTLAQEDLISNR	2222	sp|Q8BL66|EEA1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2772.17	42.34947	2	1371.734447	1371.735794	K	N	1056	1068
PSM	VLAVNQENEHLMEDYER	2223	sp|P57780|ACTN4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2655.19	39.08907	3	2087.963771	2087.958219	K	L	285	302
PSM	GAAIEALNDGELQK	2224	sp|Q99L47|F10A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2589.18	37.25327	2	1427.720847	1427.725623	K	A	118	132
PSM	LQAFSAAIESCNK	2225	sp|P30416|FKBP4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	11-UNIMOD:4	ms_run[1]:scan=1.1.2586.20	37.17125	2	1437.695847	1437.692215	K	A	332	345
PSM	TTPSVVAFTADGER	2226	sp|P38647|GRP75_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2671.21	39.52648	2	1449.711047	1449.709973	R	L	86	100
PSM	NVETMNYADIER	2227	sp|Q9D2G2|ODO2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2602.20	37.61883	2	1453.650647	1453.650744	R	T	335	347
PSM	TVFGELPSGGGTVEK	2228	sp|Q8K157|GALM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2691.18	40.08082	2	1476.747447	1476.746024	R	F	7	22
PSM	ASSTANLIFEDCR	2229	sp|Q07417|ACADS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	12-UNIMOD:4	ms_run[1]:scan=1.1.2720.19	40.90517	2	1482.679847	1482.677293	R	I	235	248
PSM	AVFQYIDENQDR	2230	sp|Q9D1A2|CNDP2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2703.20	40.41803	2	1496.691047	1496.689572	K	Y	6	18
PSM	FKLEAPDADELPR	2231	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2774.20	42.4085	2	1499.765647	1499.762009	K	S	522	535
PSM	SINRPMLQAAIALK	2232	sp|P34914|HYES_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2727.5	41.09381	3	1524.878471	1524.881018	R	K	100	114
PSM	EAVAVAPPPSPSLPAK	2233	sp|A2ARV4|LRP2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2675.19	39.63652	2	1529.850647	1529.845344	K	A	4615	4631
PSM	EAYPGDVFYLHSR	2234	sp|Q03265|ATPA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2777.10	42.4835	3	1552.729271	1552.731043	R	L	335	348
PSM	GSNTCELVFEDCK	2235	sp|Q9JHI5|IVD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	5-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.2585.19	37.14282	2	1557.643647	1557.643944	R	V	248	261
PSM	FEPQINAEESEIR	2236	sp|Q64516|GLPK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2652.20	39.00633	2	1560.744847	1560.742001	R	Y	493	506
PSM	EQWSNCPTIGQIR	2237	sp|P10605|CATB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	6-UNIMOD:4	ms_run[1]:scan=1.1.2695.19	40.19067	2	1587.747247	1587.746375	R	D	88	101
PSM	NAVTQEFGPVPDTAR	2238	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2682.21	39.83777	2	1600.787047	1600.784535	R	Y	634	649
PSM	MDATANDVPSPYEVK	2239	sp|P27773|PDIA3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2629.21	38.35868	2	1635.749847	1635.745038	K	G	434	449
PSM	MAPYQGPDAAPGALDYK	2240	sp|P57780|ACTN4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2758.19	41.95948	2	1763.830247	1763.818872	R	S	884	901
PSM	SQVFSTAADGQTQVEIK	2241	sp|P38647|GRP75_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2641.21	38.69538	2	1807.902047	1807.895208	K	V	469	486
PSM	ELQELVQYPVEHPDK	2242	sp|Q01853|TERA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2710.10	40.61012	3	1822.914071	1822.910129	R	F	488	503
PSM	LSLCGEESFGTGSDHIR	2243	sp|Q9D0F9|PGM1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	4-UNIMOD:4	ms_run[1]:scan=1.1.2623.9	38.183	3	1863.852971	1863.842126	K	E	371	388
PSM	EVYMGNVIQGGEGQAPTR	2244	sp|Q8QZT1|THIL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2698.10	40.2668	3	1904.912471	1904.905061	K	Q	85	103
PSM	QATVGDVNTDRPGLLDLK	2245	sp|P31786|ACBP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2765.14	42.15165	3	1911.018371	1911.006155	K	G	34	52
PSM	FFQEEVIPHHTEWEK	2246	sp|P51174|ACADL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2621.5	38.13557	3	1954.931471	1954.921363	K	A	67	82
PSM	ALQHIICQLGGTVCDGEK	2247	sp|Q9D826|SOX_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	7-UNIMOD:4,14-UNIMOD:4	ms_run[1]:scan=1.1.2767.20	42.2125	3	1997.977571	1997.966281	R	V	157	175
PSM	AQTLPTSVVTITSESSPGKR	2248	sp|Q62261|SPTB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2648.19	38.89186	3	2058.101171	2058.095698	R	E	2325	2345
PSM	LFLEQIHVLEK	2249	tr|A2BIN1|A2BIN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3015.9	49.16507	2	1367.785047	1367.781287	R	S	58	69
PSM	LEDTLWAGLTDQHVK	2250	sp|Q8BWT1|THIM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3024.17	49.40848	2	1724.864447	1724.873350	K	L	144	159
PSM	VNLAELFK	2251	sp|P99029|PRDX5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3180.2	53.7785	2	932.531847	932.533118	K	G	72	80
PSM	LSVLLLER	2252	sp|Q8VC30|TKFC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3004.2	48.8512	2	941.585247	941.590967	R	M	435	443
PSM	FIIPNIVK	2253	sp|P06151|LDHA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3088.2	51.19472	2	942.587847	942.590239	K	Y	119	127
PSM	FIIPQIVK	2254	sp|P16125|LDHB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3095.2	51.39371	2	956.603247	956.605889	K	Y	120	128
PSM	LFPSLLDTK	2255	sp|Q91XE0|GLYAT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3059.3	50.37117	2	1032.582647	1032.585548	K	N	143	152
PSM	LPFPIIDDK	2256	sp|O08709|PRDX6_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3120.4	52.08462	2	1056.585247	1056.585548	K	G	98	107
PSM	LPFPIIDDK	2257	sp|O08709|PRDX6_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3126.5	52.2554	2	1056.585247	1056.585548	K	G	98	107
PSM	ADVLLEPFR	2258	sp|O09174|AMACR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3041.3	49.86747	2	1058.573847	1058.576046	R	C	72	81
PSM	LILPGLISSR	2259	sp|P17563|SBP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3167.4	53.41645	2	1067.668847	1067.670280	K	I	94	104
PSM	KQGGLGPMNIPLISDPK	2260	sp|P35700|PRDX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2999.4	48.71065	3	1763.951471	1763.960391	K	R	93	110
PSM	IAEFAFEYAR	2261	sp|Q9D6R2|IDH3A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2990.9	48.46893	2	1215.591447	1215.592424	R	N	179	189
PSM	IIQLLDDYPK	2262	sp|P14869|RLA0_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3024.6	49.3993	2	1216.667847	1216.670340	K	C	17	27
PSM	IPFLLSGTSYK	2263	sp|Q99JY0|ECHB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3111.5	51.83885	2	1224.675447	1224.675425	R	D	63	74
PSM	ISEQFTAMFR	2264	sp|P68372|TBB4B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3025.4	49.42698	2	1228.591047	1228.591044	R	R	381	391
PSM	ISEQFTAMFR	2265	sp|P68372|TBB4B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3018.4	49.24055	2	1228.591047	1228.591044	R	R	381	391
PSM	AITGASLADIMAK	2266	sp|Q8BP67|RL24_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3041.11	49.87415	2	1260.673647	1260.674773	R	R	81	94
PSM	IFNTWLGDPSK	2267	sp|P61922|GABT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3047.13	50.0478	2	1276.646247	1276.645188	R	N	378	389
PSM	ALSDALTELGYK	2268	sp|P50431|GLYC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3165.6	53.366	2	1279.667447	1279.665983	R	I	331	343
PSM	SLFFPDEAINK	2269	sp|P97494|GSH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3105.11	51.67798	2	1279.648247	1279.644853	K	H	172	183
PSM	VPTPNVSVVDLTCRLEK	2270	sp|P16858|G3P_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	13-UNIMOD:4	ms_run[1]:scan=1.1.3038.9	49.78667	3	1926.027371	1926.024448	R	P	233	250
PSM	GVVQDLQQAISK	2271	sp|P57776|EF1D_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3038.10	49.7875	2	1284.702847	1284.703765	R	L	96	108
PSM	IVGAPMHDLLLWNNATVTTCHSK	2272	sp|Q922D8|C1TC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	20-UNIMOD:4	ms_run[1]:scan=1.1.3059.12	50.37868	4	2577.292094	2577.283199	K	T	176	199
PSM	GFAFVQYVNER	2273	sp|Q9Z204|HNRPC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3042.10	49.902	2	1328.651047	1328.651336	K	N	51	62
PSM	YQIPALAQAGFR	2274	sp|P34914|HYES_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3117.13	52.00858	2	1333.716447	1333.714270	R	V	274	286
PSM	IFNNGADLSGITEENAPLK	2275	sp|P07758|A1AT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3077.12	50.88828	3	2001.999671	2002.000735	R	L	329	348
PSM	DTLYFMDDAEK	2276	sp|O35488|S27A2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3020.9	49.2959	2	1346.572047	1346.570034	K	T	590	601
PSM	AQLFALTGVQPAR	2277	sp|Q9JMA1|UBP14_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3009.14	49.00113	2	1370.764447	1370.767034	K	Q	31	44
PSM	AEMQQILQGLDK	2278	sp|Q91YI0|ARLY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3069.15	50.66347	2	1372.703447	1372.702051	K	V	58	70
PSM	CDVIAQGIVMAVK	2279	sp|Q9Z2I9|SUCB1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	1-UNIMOD:4	ms_run[1]:scan=1.1.3125.10	52.23115	2	1402.736847	1402.731243	R	D	384	397
PSM	TGIIFMPGTTQLK	2280	sp|Q91VA0|ACSM1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3143.11	52.7434	2	1405.762847	1405.763923	R	A	130	143
PSM	PLSIEEIEVAPPK	2281	sp|P28474|ADHX_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3060.12	50.406	2	1420.783247	1420.781347	K	A	19	32
PSM	ANDDIIVNWVNR	2282	sp|Q99K51|PLST_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3159.15	53.20765	2	1427.723047	1427.715727	K	T	519	531
PSM	GFVDDIIQPSSTR	2283	sp|Q99MN9|PCCB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2998.16	48.6925	2	1433.714847	1433.715058	R	A	502	515
PSM	FTQAGSEVSALLGR	2284	sp|P56480|ATPB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3005.13	48.88863	2	1434.747447	1434.746693	R	I	311	325
PSM	DGQAMLWDLNEGK	2285	sp|P68040|RACK1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3188.13	54.00798	2	1475.676647	1475.671479	K	H	213	226
PSM	AGGIETIANEFSDR	2286	sp|Q61699|HS105_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3028.19	49.51972	2	1478.700847	1478.700137	R	C	20	34
PSM	GLELIASENFCSR	2287	sp|Q9CZN7|GLYM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	11-UNIMOD:4	ms_run[1]:scan=1.1.3025.8	49.43365	2	1494.714247	1494.713678	R	A	70	83
PSM	DAILFPSFIHSQK	2288	sp|P24270|CATA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3172.4	53.5545	3	1501.795571	1501.792915	R	R	157	170
PSM	ITFDDYIACCVK	2289	sp|Q6P069|SORCN_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	9-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.3138.14	52.60233	2	1503.677247	1503.673788	K	L	154	166
PSM	GVVDSEDIPLNLSR	2290	sp|Q9CQN1|TRAP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3029.11	49.5384	2	1512.782647	1512.778387	R	E	391	405
PSM	SIITLDGGALVQVQK	2291	sp|P04117|FABP4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3160.15	53.23493	2	1540.886247	1540.882458	K	W	83	98
PSM	YYVGDTEDVLFEK	2292	sp|Q78JT3|3HAO_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3091.16	51.29172	2	1576.738047	1576.729705	R	W	118	131
PSM	TFLLDGDEVIITGHCQGDGYR	2293	sp|P35505|FAAA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	15-UNIMOD:4	ms_run[1]:scan=1.1.3160.17	53.23829	3	2365.112771	2365.100860	R	V	382	403
PSM	YSSPTTIATVMSLSK	2294	sp|Q9DBM2|ECHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3114.13	51.92665	2	1584.812047	1584.806910	R	R	445	460
PSM	FLHDPSATQGFVGCALSSNIQR	2295	sp|P17563|SBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	14-UNIMOD:4	ms_run[1]:scan=1.1.2991.18	48.50337	3	2404.167671	2404.159378	R	F	255	277
PSM	CQLEINFNTLQTK	2296	sp|O88990|ACTN3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	1-UNIMOD:4	ms_run[1]:scan=1.1.3053.19	50.22195	2	1607.802047	1607.797742	K	L	345	358
PSM	GVNLPGAAVDLPAVSEK	2297	sp|P52480|KPYM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3096.16	51.43342	2	1635.889647	1635.883186	K	D	208	225
PSM	GDNTISLISIDSGSGVK	2298	sp|Q5U5V2|HYKK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3049.18	50.10938	2	1661.855047	1661.847195	K	S	106	123
PSM	ADMGGAATICSAIVSAAK	2299	sp|Q9CPY7|AMPL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	10-UNIMOD:4	ms_run[1]:scan=1.1.3138.17	52.60483	2	1692.826247	1692.817492	R	L	304	322
PSM	YLLETSGNLDGLEYK	2300	sp|Q99KQ4|NAMPT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3136.17	52.5479	2	1713.854247	1713.846132	K	L	175	190
PSM	VTGTQFPEAPLPVPCNPNDVSHGYVTVKPGIR	2301	sp|P34914|HYES_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	15-UNIMOD:4	ms_run[1]:scan=1.1.3076.18	50.86517	4	3445.775294	3445.745260	K	L	216	248
PSM	GAGAFGYFEVTHDITR	2302	sp|P24270|CATA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2991.20	48.50505	2	1739.836247	1739.826734	K	Y	78	94
PSM	RSIQFVDWCPTGFK	2303	sp|P05213|TBA1B_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	9-UNIMOD:4	ms_run[1]:scan=1.1.3046.6	50.01318	3	1739.847671	1739.845361	K	V	339	353
PSM	TLNEWSSQISPDLVR	2304	sp|O09172|GSH0_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3146.20	52.83708	2	1743.886247	1743.879164	K	E	50	65
PSM	LISWYDNEYGYSNR	2305	tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3023.4	49.37075	3	1778.790971	1778.790014	K	V	308	322
PSM	NGGLGHMNITLLSDITK	2306	sp|P20108|PRDX3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3167.8	53.41978	3	1782.931871	1782.929819	K	Q	151	168
PSM	AYHEQLTVAEITNACFEPANQMVK	2307	sp|P68373|TBA1C_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	15-UNIMOD:4	ms_run[1]:scan=1.1.3136.19	52.54957	3	2763.319571	2763.299637	K	C	281	305
PSM	ISGETIFVTAPHEATAGIIGVNR	2308	sp|Q68FD5|CLH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3137.18	52.57712	3	2352.253571	2352.243760	R	K	298	321
PSM	VVAGVLHLGNIDFEEAGSTSGGCNLK	2309	tr|E9PVU0|E9PVU0_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	23-UNIMOD:4	ms_run[1]:scan=1.1.3177.18	53.70697	3	2643.308171	2643.296266	R	N	340	366
PSM	ANWYFLLAR	2310	sp|P45952|ACADM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3467.3	61.78698	2	1152.608847	1152.608014	K	S	198	207
PSM	ALLLLCGGEDD	2311	sp|P48036|ANXA5_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	6-UNIMOD:4	ms_run[1]:scan=1.1.3419.3	60.47315	2	1174.554847	1174.553990	K	-	309	320
PSM	LASDLLEWIR	2312	sp|P57780|ACTN4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3595.3	65.39809	2	1214.666847	1214.665923	R	R	302	312
PSM	DFQLFSSPLGK	2313	sp|Q921I1|TRFE_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3446.4	61.20695	2	1237.638247	1237.634289	K	D	300	311
PSM	IILDLISESPIK	2314	sp|P61979|HNRPK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3483.5	62.23513	2	1339.798647	1339.796269	K	G	208	220
PSM	NLQNLLILTAIK	2315	sp|Q68FD5|CLH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3605.5	65.68449	2	1352.843047	1352.839137	R	A	1023	1035
PSM	AVVLPISLATTFK	2316	sp|Q8VCN5|CGL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3520.5	63.27425	2	1358.822847	1358.817339	R	Q	35	48
PSM	AVLDVAETGTEAAAATGVIGGIR	2317	sp|P07759|SPA3K_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3438.2	60.99212	3	2141.142071	2141.132812	K	K	361	384
PSM	GIDYEIVPINLIK	2318	sp|Q9WVL0|MAAI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3611.11	65.8621	2	1485.851247	1485.844282	K	D	28	41
PSM	GSFVLLDGETFEVK	2319	sp|P17563|SBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3424.10	60.6197	2	1539.790047	1539.782075	K	G	161	175
PSM	LYSPSQIGAFVLMK	2320	sp|P38647|GRP75_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3509.3	62.96953	2	1552.835847	1552.832337	K	M	160	174
PSM	MFVLDEADEMLSR	2321	sp|P10630|IF4A2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3535.13	63.71253	2	1554.712047	1554.705816	K	G	179	192
PSM	LDQLIYIPLPDEK	2322	sp|Q01853|TERA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3520.12	63.28008	2	1555.858247	1555.849761	R	S	639	652
PSM	LLGQFTLIGIPPAPR	2323	sp|P38647|GRP75_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3600.12	65.54915	2	1591.952047	1591.944999	K	G	499	514
PSM	TIQFVDWCPTGFK	2324	sp|P05214|TBA3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	8-UNIMOD:4	ms_run[1]:scan=1.1.3411.14	60.25042	2	1597.769047	1597.759900	R	V	340	353
PSM	VGVDPLIIPTDYWK	2325	sp|Q6P1B1|XPP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3632.10	66.47243	2	1614.875247	1614.865745	R	K	117	131
PSM	GGLPSQAFEYILYNK	2326	sp|P49935|CATH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3513.9	63.08593	2	1698.875047	1698.861723	K	G	181	196
PSM	IITLEEGDLILTGTPK	2327	sp|Q8R0F8|FAHD1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3424.17	60.62555	2	1711.971047	1711.960768	K	G	182	198
PSM	SIGPLTFVFTGTGNVSK	2328	sp|Q99K67|AASS_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3525.16	63.42723	2	1723.929247	1723.914486	K	G	213	230
PSM	TLASLSPETSLFIIASK	2329	sp|P06745|G6PI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3628.16	66.35957	2	1777.001247	1776.987317	K	T	195	212
PSM	AYLPVNESFGFTADLR	2330	sp|P58252|EF2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3474.20	61.99315	2	1798.898247	1798.889000	K	S	786	802
PSM	ILGTLALIDQSETDWK	2331	sp|Q91VM9|IPYR2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3522.17	63.34187	2	1801.955247	1801.946181	K	I	183	199
PSM	KFPLDPLITHVLPFEK	2332	sp|P00329|ADH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3414.5	60.3302	3	1893.087071	1893.076407	K	I	340	356
PSM	SLDLFNCEVTNLNAYR	2333	sp|O35381|AN32A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	7-UNIMOD:4	ms_run[1]:scan=1.1.3448.21	61.2758	2	1927.926647	1927.909812	K	E	117	133
PSM	ILADSINSEVGILCHALQK	2334	sp|P16331|PH4H_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	14-UNIMOD:4	ms_run[1]:scan=1.1.3414.10	60.33438	3	2080.111871	2080.098676	K	I	432	451
PSM	KAQGTGELTQLLNSLCTAIK	2335	sp|Q9QXD6|F16P1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	16-UNIMOD:4	ms_run[1]:scan=1.1.3605.11	65.68948	3	2145.158771	2145.146354	R	A	24	44
PSM	WGEAGAEYVVESTGVFTTMEK	2336	tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3605.14	65.692	3	2290.062971	2290.046365	K	A	85	106
PSM	ETAMINWDQPAEAIHNWIR	2337	sp|Q8R0Y6|AL1L1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3555.9	64.28754	3	2294.105171	2294.090236	K	G	207	226
PSM	IDATQVEVNPFGETPEGQVVCFDAK	2338	sp|Q9Z2I8|SUCB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	21-UNIMOD:4	ms_run[1]:scan=1.1.3516.21	63.1739	3	2749.315871	2749.290512	K	I	236	261
PSM	SGDAAIVDMVPGKPMCVESFSDYPPLGR	2339	sp|P10126|EF1A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	16-UNIMOD:4	ms_run[1]:scan=1.1.3482.21	62.2202	3	2994.421571	2994.392551	K	F	396	424
PSM	IVGDLAQFMVQNGLSR	2340	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3510.7	63.00483	2	1747.901647	1746.908690	K	A	913	929
PSM	LLDPEDISVDHPDEK	2341	sp|Q62261|SPTB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2671.12	39.51898	3	1720.821371	1720.815560	K	S	250	265
PSM	ASIHEAWTDGK	2342	sp|P57780|ACTN4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2032.10	21.84055	3	1214.573771	1213.572751	K	E	423	434
PSM	SDSRDPASDQMK	2343	sp|P24270|CATA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:1	ms_run[1]:scan=1.1.1899.21	18.15653	2	1377.5821	1377.5825	M	Q	2	14
PSM	ANHAPFETDISTLTR	2344	sp|Q9QXD6|F16P1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:1	ms_run[1]:scan=1.1.3081.20	51.00812	2	1713.8413	1713.8317	M	F	2	17
PSM	QEYDESGPSIVHRK	2345	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:28	ms_run[1]:scan=1.1.2175.19	25.82443	3	1628.7662	1626.7632	K	C	360	374
PSM	QEYDESGPSIVHR	2346	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:28	ms_run[1]:scan=1.1.2478.20	34.16593	2	1498.6695	1498.6683	K	K	360	373
PSM	AHRFPALTPEQK	2347	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:1	ms_run[1]:scan=1.1.2322.9	29.87302	3	1435.7534	1435.7567	M	K	2	14
PSM	QEGQNYGFFLR	2348	sp|Q9JIL4|NHRF3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:28	ms_run[1]:scan=1.1.3495.9	62.58035	2	1340.6193	1340.6144	K	I	15	26
PSM	VNTNYRPGLPFSGQVLLVDEK	2349	sp|Q61838|PZP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	19		ms_run[1]:scan=1.1.3175.17	53.64925	3	2345.2482	2345.2372	K	G	354	375
PSM	VGAFTVVCK	2350	sp|P05202|AATM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	8-UNIMOD:4	ms_run[1]:scan=1.1.2379.9	31.43447	2	979.513247	979.516088	R	D	288	297
PSM	CREVAENCK	2351	sp|Q9D6R2|IDH3A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:385,1-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.1833.19	16.31142	2	1147.4669	1147.4745	K	D	215	224
PSM	NPAIIFEDANLEECIPATVR	2352	sp|Q8BH00|AL8A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	14-UNIMOD:4	ms_run[1]:scan=1.1.3536.11	63.73958	3	2274.135671	2271.120533	K	S	258	278
PSM	QHLQIQSSQSHLNK	2353	sp|Q91XE0|GLYAT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:28	ms_run[1]:scan=1.1.2088.18	23.3872	3	1629.8216	1629.8218	K	T	100	114
PSM	HSENILYVSSETIK	2354	sp|Q91XE0|GLYAT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2555.10	36.29747	3	1618.821071	1618.820252	K	K	128	142
PSM	SIVNNGHSFNVEFDDSQDNAVLK	2355	sp|P00920|CAH2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3114.17	51.93332	3	2549.183771	2548.183010	K	G	58	81
PSM	TYFPHFDVSHGSAQVK	2356	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2544.4	35.99498	4	1819.871694	1818.868933	K	G	42	58
PSM	AGTTTIEAVKR	2357	sp|P21107-2|TPM3-2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:1	ms_run[1]:scan=1.1.2257.18	28.08578	2	1187.6479	1187.6505	M	K	2	13
PSM	KQGGLGPMNIPLISDPK	2358	sp|P35700|PRDX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3002.5	48.79673	3	1763.951471	1763.960391	K	R	93	110
PSM	ATSWGSILQDEK	2359	sp|P51855|GSHB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:1	ms_run[1]:scan=1.1.3481.10	62.18252	2	1375.6667	1375.6614	M	Q	2	14
PSM	IFNSGADLSGITEENAPLK	2360	sp|Q00898|A1AT5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3092.13	51.31763	3	1974.998171	1974.989836	R	L	329	348
PSM	AVIFCLSADKK	2361	sp|Q9R0P5|DEST_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	5-UNIMOD:4	ms_run[1]:scan=1.1.2463.4	33.74595	3	1250.670071	1250.669294	K	C	35	46
PSM	HALIIYDDLSK	2362	sp|Q03265|ATPA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2622.8	38.15759	2	1286.689247	1286.687053	K	Q	306	317
PSM	SSGAGWQSQASAK	2363	sp|Q5U5V2|HYKK_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:1	ms_run[1]:scan=1.1.2269.19	28.41655	2	1305.5893	1305.5944	M	P	2	15
PSM	CYEMASHLR	2364	sp|P62962|PROF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.2693.7	40.12592	2	1148.4741	1148.4738	K	R	128	137
PSM	IGNCPFSQR	2365	sp|Q9Z1Q5|CLIC1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	4-UNIMOD:4	ms_run[1]:scan=1.1.2101.15	23.7412	2	1077.499447	1077.502563	K	L	21	30
PSM	AQERPSCAVEPEHVQR	2366	sp|P56389|CDD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:1,7-UNIMOD:4	ms_run[1]:scan=1.1.2074.21	23.00218	3	1933.9084	1933.9059	M	L	2	18
PSM	ISQAEEDDQQLLGHLLLVAK	2367	sp|Q9D0S9|HINT2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3457.13	61.52335	3	2219.198471	2219.179762	R	K	100	120
PSM	SYPYPALTPEQK	2368	tr|A6ZI47|A6ZI47_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:1	ms_run[1]:scan=1.1.2309.9	29.51327	3	1434.6980	1434.7026	M	K	2	14
PSM	HGYIGEFEIIDDHR	2369	sp|P62245|RS15A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2712.11	40.66795	3	1699.799471	1699.795434	K	A	44	58
PSM	DVTDEDLNSYFK	2370	sp|Q8QZS1|HIBCH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	19		ms_run[1]:scan=1.1.3096.12	51.43008	2	1445.6542	1444.6352	K	S	365	377
PSM	VDTWFNQPAR	2371	sp|P47963|RL13_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2662.4	39.27042	2	1233.607647	1232.593821	R	K	22	32
PSM	IQFHNVKPECLDAYNSLTEAVLPK	2372	sp|O55125|NIPS1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	10-UNIMOD:4	ms_run[1]:scan=1.1.3184.15	53.89942	4	2785.437294	2785.410902	K	L	74	98
PSM	ALSDADVQK	2373	sp|P50518|VATE1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:1	ms_run[1]:scan=1.1.2414.13	32.41232	2	987.4824	987.4868	M	Q	2	11
PSM	SCVITYLAQVDPK	2374	sp|Q9JMD3|STA10_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19	2-UNIMOD:4	ms_run[1]:scan=1.1.3069.18	50.66599	2	1493.769847	1492.759566	K	G	180	193
PSM	AADMLSGPR	2375	sp|Q8CHT0|AL4A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2094.10	23.54612	2	917.441447	916.443651	K	R	130	139
PSM	TDLTAVPASR	2376	sp|Q9JHI5|IVD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.2194.13	26.35415	2	1030.540247	1029.545474	K	G	212	222
PSM	AVEEIWFETAK	2377	sp|Q5U5V2|HYKK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.3050.11	50.1322	2	1320.650847	1321.655418	K	S	358	369
PSM	KPFDPENTK	2378	sp|Q00898|A1AT5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1768.7	14.4776	3	1074.528071	1074.534575	K	Q	214	223
PSM	PAVAAAPK	2379	sp|P23927|CRYAB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1711.8	12.9039	2	723.421047	723.427925	K	K	167	175
PSM	SAAETVTK	2380	sp|Q64433|CH10_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1622.11	10.44418	2	805.411847	805.418148	R	G	21	29
PSM	YHEALAK	2381	sp|P09671|SODM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1665.13	11.63002	2	830.423047	830.428653	K	G	69	76
PSM	TVAHIQTVQHK	2382	sp|P51174|ACADL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1678.11	11.98595	3	1260.687371	1260.693869	K	L	323	334
PSM	KLGGNPEK	2383	sp|P28271|ACOC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1576.13	9.166083	2	841.459647	841.465767	K	I	106	114
PSM	SNVTAVHK	2384	sp|Q9D6R2|IDH3A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1578.11	9.221283	2	854.454847	854.461016	R	A	193	201
PSM	HALSAGYR	2385	sp|Q9JII6|AK1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1708.9	12.82663	2	873.439647	873.445700	K	H	35	43
PSM	VVSSIEQK	2386	sp|P63101|1433Z_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1769.13	14.51057	2	888.484647	888.491647	R	T	61	69
PSM	IENHEGVR	2387	sp|P52480|KPYM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1600.13	9.8383	2	952.466047	952.472643	K	R	271	279
PSM	RVQANMGAK	2388	sp|Q9EQ20|MMSA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1612.15	10.16902	2	973.504247	973.512734	K	N	279	288
PSM	GLQTSQDAR	2389	sp|P14211|CALR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1679.19	12.02067	2	974.471447	974.478122	K	F	65	74
PSM	KHHLDGETEEER	2390	sp|P10649|GSTM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1597.7	9.753217	3	1478.668871	1478.674984	R	I	83	95
PSM	TSEIQSQAK	2391	sp|P09813|APOA2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1654.17	11.32988	2	990.489447	990.498189	K	A	54	63
PSM	LRGDHSDQQAELGR	2392	sp|Q9EPL9|ACOX3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1732.19	13.48373	3	1580.760071	1580.765531	R	E	385	399
PSM	NSSQAVQAVR	2393	sp|Q99K67|AASS_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1756.21	14.15218	2	1058.539247	1058.546871	R	D	190	200
PSM	NIIHGSDSVK	2394	sp|P15532|NDKA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1763.16	14.34495	2	1068.550247	1068.556373	R	S	115	125
PSM	NNQITNNQR	2395	sp|P09041|PGK2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1633.19	10.75202	2	1100.525047	1100.532283	K	I	31	40
PSM	RATVVESSEK	2396	sp|P61982|1433G_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1615.20	10.25655	2	1104.567647	1104.577502	K	A	143	153
PSM	RLDSGSASMAK	2397	sp|P51174|ACADL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1710.19	12.88593	2	1121.540647	1121.549907	K	Y	359	370
PSM	HESQVDSVVK	2398	sp|Q60870|REEP5_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1753.21	14.06778	2	1126.557647	1126.561852	R	D	144	154
PSM	KVQEAVEENR	2399	sp|Q64516|GLPK_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1663.20	11.58013	2	1200.601247	1200.609865	K	A	163	173
PSM	TAEEEDEADPK	2400	sp|Q9D0J8|PTMS_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1691.21	12.36038	2	1232.500847	1232.504456	R	R	81	92
PSM	EQHGHDESMHR	2401	sp|Q7TNG8|LDHD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1564.14	8.837466	3	1361.549171	1361.553095	R	C	52	63
PSM	TATPQQAQEVHEK	2402	sp|P17751|TPIS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1717.21	13.0754	2	1465.712647	1465.716121	K	L	226	239
PSM	NQTAEKEEFEHQQK	2403	sp|P63017|HSP7C_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1691.20	12.35955	3	1744.800671	1744.801642	K	E	584	598
PSM	ALVSSVR	2404	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1902.6	18.22535	2	730.427447	730.433738	K	Q	213	220
PSM	LATDLTK	2405	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1940.9	19.28007	2	760.427047	760.433070	K	V	258	265
PSM	MQHLEQTLNK	2406	sp|P22599|A1AT2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1911.10	18.4743	3	1240.619171	1240.623406	K	E	278	288
PSM	HHAAYVNNLNATEEK	2407	sp|P09671|SODM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1851.12	16.80903	4	1709.805694	1709.812147	K	Y	54	69
PSM	TQLAPHSEQMR	2408	sp|Q00623|APOA1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1818.13	15.88328	3	1296.617171	1296.624469	R	E	184	195
PSM	GSAITGPVAK	2409	sp|P62830|RL23_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1899.12	18.14903	2	899.499447	899.507632	K	E	114	124
PSM	TIEAEAAHGTVTR	2410	sp|P54071|IDHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1920.15	18.7263	3	1354.680071	1354.684093	K	H	341	354
PSM	IEEELGSK	2411	sp|P17182|ENOA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1885.11	17.7557	2	903.450647	903.454927	R	A	413	421
PSM	GSVLPNSDK	2412	sp|P32020|NLTP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1860.13	17.0592	2	915.460647	915.466161	K	K	483	492
PSM	AVELAANTK	2413	sp|P40142|TKT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1877.15	17.53835	2	915.494647	915.502546	K	G	457	466
PSM	LLEGEESR	2414	sp|P11679|K2C8_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1872.15	17.3997	2	931.459247	931.461075	K	L	400	408
PSM	NDEGIAYR	2415	sp|Q61171|PRDX2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1962.11	19.89687	2	936.426447	936.430110	K	G	120	128
PSM	AAQEEYIK	2416	tr|A6ZI46|A6ZI46_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1897.16	18.09635	2	950.466447	950.470912	K	R	378	386
PSM	AMEAVAAQGK	2417	sp|O70250|PGAM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1814.15	15.7723	2	974.478247	974.485516	K	A	242	252
PSM	VDVSPTSQR	2418	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1840.16	16.50442	2	987.493647	987.498523	R	L	556	565
PSM	EGDPDQLSK	2419	sp|P97816|S100G_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1776.17	14.71003	2	987.444647	987.450905	K	E	21	30
PSM	YALQSQQR	2420	sp|Q8BWT1|THIM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1856.17	16.95132	2	992.495847	992.503943	R	W	182	190
PSM	ETPQEIASK	2421	sp|Q64442|DHSO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1867.17	17.26065	2	1001.499847	1001.502940	K	V	227	236
PSM	AKFENLCK	2422	sp|P11499|HS90B_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	7-UNIMOD:4	ms_run[1]:scan=1.1.1824.17	16.05683	2	1008.499447	1008.506252	K	L	558	566
PSM	IHPVSTMVK	2423	sp|P16125|LDHB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1899.19	18.15487	2	1010.555647	1010.558287	R	G	271	280
PSM	GEGQLSAAER	2424	sp|P58252|EF2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1816.19	15.83168	2	1016.483047	1016.488687	K	A	240	250
PSM	VSGGPSLEQR	2425	sp|Q8QZY1|EIF3L_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1924.16	18.83852	2	1028.518247	1028.525073	K	F	144	154
PSM	KIITSTLEK	2426	sp|Q9DBM2|ECHP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1890.18	17.90095	2	1031.618447	1031.622661	K	E	336	345
PSM	NVTAIQGPGGK	2427	sp|Q9D6R2|IDH3A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1953.20	19.64945	2	1040.558047	1040.561458	R	W	67	78
PSM	VYSTSVTGSR	2428	sp|Q91VW3|SH3L3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1890.21	17.90347	2	1055.519847	1055.524738	R	E	6	16
PSM	EDKYEEEIK	2429	tr|D3Z2H9|D3Z2H9_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1906.19	18.34513	2	1181.543847	1181.545199	K	I	182	191
PSM	KLQDQPNIQR	2430	sp|Q61838|PZP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1841.19	16.53503	2	1238.667047	1238.673134	K	T	1417	1427
PSM	RSGQVLEVSGSK	2431	sp|P62814|VATB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1797.20	15.29762	2	1245.658847	1245.667714	K	A	82	94
PSM	KGDEYVINGQK	2432	sp|P45952|ACADM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1833.21	16.31308	2	1249.623447	1249.630266	K	M	179	190
PSM	EGASEEETNLSK	2433	sp|P23953|EST1C_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1855.21	16.9269	2	1292.566847	1292.573205	K	M	470	482
PSM	GTVTGQVQGPEEK	2434	sp|P56375|ACYP2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1924.21	18.8427	2	1328.653847	1328.657209	K	V	53	66
PSM	QYDISNPQKPR	2435	sp|P17563|SBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1942.8	19.33352	3	1344.673271	1344.678613	R	L	334	345
PSM	IRDESASCSWNK	2436	sp|Q3TNA1|XYLB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	8-UNIMOD:4	ms_run[1]:scan=1.1.1868.16	17.28812	3	1451.655971	1451.646327	K	F	361	373
PSM	HEQNIDCGGGYVK	2437	sp|P14211|CALR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	7-UNIMOD:4	ms_run[1]:scan=1.1.1914.21	18.56558	2	1475.645647	1475.646327	K	L	99	112
PSM	DGVDFGK	2438	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2077.7	23.0738	2	736.332847	736.339169	K	W	141	148
PSM	AAGALLAR	2439	sp|O09172|GSH0_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2002.7	21.00383	2	741.443047	741.449723	R	A	7	15
PSM	SFGGVTHGLPEK	2440	sp|P50544|ACADV_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2154.7	25.21875	3	1227.618971	1227.624787	R	K	288	300
PSM	TGLSQLGR	2441	sp|Q9Z2V4|PCKGC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2078.7	23.10127	2	830.454047	830.461016	K	W	108	116
PSM	TGLSQLGR	2442	sp|Q9Z2V4|PCKGC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2071.8	22.90885	2	830.454047	830.461016	K	W	108	116
PSM	SSDILYR	2443	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2126.6	24.42777	2	852.428047	852.434132	R	L	142	149
PSM	IDIVENR	2444	sp|P16460|ASSY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2124.9	24.37588	2	857.454247	857.460681	R	F	266	273
PSM	LPANHPLLTGQR	2445	sp|P50516|VATA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2076.14	23.05188	3	1315.729571	1315.736068	K	V	221	233
PSM	RALVILAK	2446	sp|Q99LX0|PARK7_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2112.7	24.03755	2	882.593847	882.601472	K	G	5	13
PSM	AYEFAER	2447	sp|Q68FD5|CLH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2128.7	24.48297	2	884.398847	884.402832	R	C	1095	1102
PSM	VGNLTVVGK	2448	sp|P05201|AATC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2141.9	24.85142	2	885.521847	885.528367	R	E	268	277
PSM	KLEEEGEQFVK	2449	sp|P32020|NLTP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2151.12	25.13727	3	1334.667671	1334.671797	K	K	443	454
PSM	EAILAIHK	2450	sp|P57780|ACTN4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2091.10	23.46477	2	893.527247	893.533452	R	E	586	594
PSM	TQLVSNLK	2451	sp|P05202|AATM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2088.11	23.38135	2	901.517847	901.523282	R	K	356	364
PSM	LLVSENSR	2452	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1972.13	20.17847	2	916.492247	916.497795	K	E	181	189
PSM	KLDEAVAEAHLGK	2453	sp|P50247|SAHH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2111.11	24.0133	3	1379.733071	1379.740879	K	L	389	402
PSM	FDAQGNLR	2454	sp|Q9Z2V4|PCKGC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2046.11	22.22642	2	919.445647	919.451179	K	A	317	325
PSM	TGGVLYADK	2455	sp|Q9D826|SOX_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2011.13	21.26465	2	922.470847	922.475997	K	A	145	154
PSM	LYEQLSGK	2456	sp|P70296|PEBP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2085.14	23.2992	2	936.487047	936.491647	K	-	180	188
PSM	ADGYVLEGK	2457	sp|P62242|RS8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2131.14	24.57133	2	950.471447	950.470912	R	E	185	194
PSM	TVISQSLSK	2458	sp|P50516|VATA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2068.14	22.83145	2	961.537247	961.544411	K	Y	257	266
PSM	DFAPGKPLK	2459	sp|Q99KI0|ACON_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2059.13	22.58022	2	971.539647	971.544017	K	C	731	740
PSM	KQDFPLVK	2460	sp|P50518|VATE1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2124.12	24.37838	2	973.553047	973.559667	R	A	138	146
PSM	AGFAGDDAPR	2461	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1982.15	20.45135	2	975.437647	975.441009	K	A	19	29
PSM	SAFEYGGQK	2462	sp|Q8CHT0|AL4A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2030.17	21.79083	2	985.453647	985.450511	R	C	338	347
PSM	SSQIGAVVSR	2463	sp|Q91XF0|PNPO_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2062.16	22.66585	2	1002.540047	1002.545808	K	Q	164	174
PSM	AGTHILCIK	2464	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	7-UNIMOD:4	ms_run[1]:scan=1.1.2053.2	22.40827	3	1011.549371	1011.553536	R	D	733	742
PSM	TAVCDIPPR	2465	sp|P68372|TBB4B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	4-UNIMOD:4	ms_run[1]:scan=1.1.2127.12	24.45995	2	1027.508447	1027.512065	K	G	351	360
PSM	TAVCDIPPR	2466	sp|P68372|TBB4B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	4-UNIMOD:4	ms_run[1]:scan=1.1.2136.17	24.71532	2	1027.507847	1027.512065	K	G	351	360
PSM	GTVVTGTLER	2467	sp|Q8BFR5|EFTU_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2132.16	24.60092	2	1031.553047	1031.561124	R	G	272	282
PSM	DHENIIIAK	2468	sp|P09103|PDIA1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2066.19	22.78	2	1051.561447	1051.566209	K	M	418	427
PSM	LGGPQEEQIK	2469	sp|Q93092|TALDO_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2000.19	20.95717	2	1097.562047	1097.571688	K	N	72	82
PSM	RSEEALALPR	2470	sp|P34914|HYES_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2150.5	25.1029	3	1140.614771	1140.625121	R	D	25	35
PSM	NSDEADLVPAK	2471	sp|P83917|CBX1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2157.14	25.30993	2	1157.552647	1157.556432	K	E	140	151
PSM	VFEHSSVELK	2472	sp|Q9R0P3|ESTD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2104.8	23.81863	3	1173.594671	1173.602989	K	C	18	28
PSM	RADLYTVESK	2473	sp|Q9JHW2|NIT2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1968.20	20.07258	2	1180.604647	1180.608802	K	K	265	275
PSM	ITAHLVHELR	2474	sp|Q8BWT1|THIM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2005.11	21.09227	3	1187.670671	1187.677491	R	R	361	371
PSM	YLSEVASGENK	2475	sp|Q9CQV8|1433B_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2029.17	21.76282	2	1195.568247	1195.572082	R	Q	130	141
PSM	ESEAVEWQQK	2476	sp|P26041|MOES_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2155.18	25.25642	2	1232.558247	1232.567331	K	A	439	449
PSM	QAASSLQQASLK	2477	sp|P38647|GRP75_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2066.21	22.78168	2	1230.654247	1230.656815	R	L	635	647
PSM	VIGSGCNLDSAR	2478	sp|P00342|LDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	6-UNIMOD:4	ms_run[1]:scan=1.1.2108.19	23.93785	2	1247.590047	1247.592835	R	F	158	170
PSM	YNDLGEQHFK	2479	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2027.10	21.70118	3	1249.566671	1249.572751	R	G	35	45
PSM	GEGMSQAATICR	2480	sp|P35505|FAAA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	11-UNIMOD:4	ms_run[1]:scan=1.1.2112.21	24.04923	2	1279.563247	1279.564906	K	S	305	317
PSM	EEAVAETDQYR	2481	sp|Q8BMC1|VATG3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2061.20	22.6415	2	1309.578247	1309.578624	K	M	38	49
PSM	NSNPALNDNLEK	2482	sp|Q9Z1Q5|CLIC1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2120.20	24.27368	2	1327.635247	1327.636808	K	G	120	132
PSM	SDGALVDCGTSAQK	2483	sp|Q64105|SPRE_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	8-UNIMOD:4	ms_run[1]:scan=1.1.2015.21	21.38115	2	1407.628247	1407.630008	K	L	228	242
PSM	VCVQTVESGAMTK	2484	sp|P54071|IDHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	2-UNIMOD:4,11-UNIMOD:35	ms_run[1]:scan=1.1.2102.21	23.77392	2	1424.664447	1424.663951	K	D	401	414
PSM	TAELLSHHQVEIK	2485	sp|Q64516|GLPK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2132.5	24.59173	4	1503.797294	1503.804542	K	Q	32	45
PSM	QEYDESGPSIVHR	2486	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2137.17	24.74393	3	1515.691871	1515.695386	K	K	360	373
PSM	VCHAHPTLSEAFR	2487	sp|O08749|DLDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	2-UNIMOD:4	ms_run[1]:scan=1.1.2060.17	22.61123	3	1523.727071	1523.730331	R	E	483	496
PSM	VAQLEAQCQEPCK	2488	sp|Q8VCM7|FIBG_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	8-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.2059.21	22.5869	2	1559.709647	1559.707213	K	D	153	166
PSM	RSSTPGYTATEDTFK	2489	sp|A2ARV4|LRP2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2134.19	24.66007	3	1659.770171	1659.774030	K	D	4634	4649
PSM	FNAHGDANTIVCNTK	2490	sp|P16045|LEG1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	12-UNIMOD:4	ms_run[1]:scan=1.1.2086.17	23.3298	3	1660.761371	1660.762754	R	E	50	65
PSM	QGTFHSQQALEYGTK	2491	sp|Q9WUM5|SUCA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2122.19	24.3297	3	1693.803071	1693.805999	K	L	67	82
PSM	TVAVYSEQDTGQMHR	2492	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2111.15	24.01663	3	1720.784471	1720.783883	R	Q	63	78
PSM	TGVHHYSGNNIELGTACGK	2493	sp|P62889|RL30_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	17-UNIMOD:4	ms_run[1]:scan=1.1.2011.21	21.27133	3	2013.930371	2013.932673	K	Y	69	88
PSM	QREEESQQQAVLAQECR	2494	sp|Q64331|MYO6_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	16-UNIMOD:4	ms_run[1]:scan=1.1.2044.19	22.17778	3	2087.974271	2087.965430	R	D	995	1012
PSM	QTESTSFLEK	2495	sp|Q9QUM9|PSA6_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2207.11	26.71577	2	1168.549647	1168.561183	K	K	172	182
PSM	LTGMAFR	2496	tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2307.4	29.4548	2	794.404647	794.410894	K	V	226	233
PSM	IQALLDK	2497	sp|P24270|CATA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2179.5	25.9256	2	799.473647	799.480354	R	Y	493	500
PSM	VAGILTVK	2498	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2346.5	30.53238	2	799.508847	799.516740	K	G	251	259
PSM	LADLIER	2499	sp|P47738|ALDH2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2358.4	30.85965	2	828.462247	828.470518	R	D	110	117
PSM	GGIMLPEK	2500	sp|Q64433|CH10_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2308.2	29.4803	2	843.446247	843.452425	K	S	29	37
PSM	FINEVVK	2501	sp|Q9JLJ2|AL9A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2223.6	27.14443	2	847.475447	847.480354	K	Q	304	311
PSM	FAEIIEK	2502	sp|Q9CPY7|AMPL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2315.6	29.67478	2	848.459247	848.464370	R	N	215	222
PSM	ISSLPNVK	2503	tr|E9Q6L7|E9Q6L7_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2164.10	25.50347	2	856.496647	856.501818	R	K	188	196
PSM	AIDAALAAR	2504	sp|Q8CHT0|AL4A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2189.8	26.20815	2	870.485647	870.492316	R	K	104	113
PSM	NDIGATVHELSR	2505	sp|P16331|PH4H_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2330.8	30.09672	3	1310.650271	1310.657878	R	D	100	112
PSM	CTLPLTGK	2506	sp|Q9D0K2|SCOT1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:4	ms_run[1]:scan=1.1.2203.8	26.6023	2	888.469247	888.473889	K	Q	456	464
PSM	LHGSGDLEAWEK	2507	sp|Q9CPY7|AMPL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2313.7	29.62048	3	1340.635571	1340.636080	K	G	177	189
PSM	FFVANTAK	2508	sp|Q9Z2I8|SUCB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2177.11	25.875	2	896.470847	896.475603	R	E	60	68
PSM	LITLEQGK	2509	sp|Q9EQ20|MMSA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2207.6	26.70825	2	900.522447	900.528033	R	T	122	130
PSM	TIEEVVGR	2510	sp|P47738|ALDH2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2167.6	25.58518	2	901.481447	901.486896	K	A	431	439
PSM	GVNVSALSR	2511	sp|P50516|VATA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2186.8	26.12257	2	901.491847	901.498130	R	D	121	130
PSM	ALIDQEVK	2512	sp|P97823|LYPA1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2179.10	25.92978	2	914.499047	914.507297	K	N	98	106
PSM	TTLTAAITK	2513	sp|Q8BFR5|EFTU_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2197.9	26.43492	2	918.534847	918.538597	K	I	71	80
PSM	VNLGVGAYR	2514	sp|P05201|AATC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2368.6	31.13048	2	947.514847	947.518865	K	T	34	43
PSM	VEITYTPK	2515	sp|O88844|IDHC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2228.12	27.2872	2	949.508247	949.512048	K	D	152	160
PSM	GLTSVINQK	2516	sp|P16125|LDHB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2225.11	27.2037	2	958.541447	958.544745	R	L	300	309
PSM	VINDFVEK	2517	sp|P07758|A1AT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2269.11	28.40988	2	962.505847	962.507297	K	G	174	182
PSM	QTANVLSGACGLHR	2518	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	10-UNIMOD:4	ms_run[1]:scan=1.1.2244.12	27.72112	3	1482.732971	1482.736145	K	G	92	106
PSM	SCNCLLLK	2519	sp|P17182|ENOA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	2-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=1.1.2301.11	29.29073	2	1006.489847	1006.493973	K	V	336	344
PSM	LVLVGDGGTGK	2520	sp|P62827|RAN_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2309.11	29.51493	2	1014.566647	1014.570960	K	T	13	24
PSM	ICEEAFTR	2521	sp|Q60597|ODO1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	2-UNIMOD:4	ms_run[1]:scan=1.1.2182.13	26.01468	2	1024.459047	1024.464781	K	S	565	573
PSM	ENFSCLTR	2522	sp|P14152|MDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	5-UNIMOD:4	ms_run[1]:scan=1.1.2260.11	28.16137	2	1025.457247	1025.460030	K	L	150	158
PSM	TAVCDIPPR	2523	sp|P68372|TBB4B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	4-UNIMOD:4	ms_run[1]:scan=1.1.2208.7	26.74103	2	1027.507447	1027.512065	K	G	351	360
PSM	CQVLLEAAR	2524	sp|Q9JLJ2|AL9A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:4	ms_run[1]:scan=1.1.2350.13	30.6481	2	1058.549447	1058.554265	R	I	74	83
PSM	TAAYVNAIEK	2525	sp|P26443|DHE3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2221.18	27.09863	2	1078.562647	1078.565875	R	V	536	546
PSM	LRVDPVNFK	2526	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2371.4	31.21108	3	1086.612071	1086.618579	K	L	92	101
PSM	LRVDPVNFK	2527	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2353.2	30.722	3	1086.612071	1086.618579	K	L	92	101
PSM	KPVDQYEDCYLAR	2528	sp|Q921I1|TRFE_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	9-UNIMOD:4	ms_run[1]:scan=1.1.2342.12	30.43057	3	1655.762171	1655.761357	R	I	252	265
PSM	VEDDTLQGLK	2529	sp|P50544|ACADV_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2323.16	29.90695	2	1116.562447	1116.566269	K	E	129	139
PSM	AFAAQEDLEK	2530	sp|P26043|RADI_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2232.15	27.39892	2	1120.540247	1120.540054	K	T	449	459
PSM	LHVDPENFR	2531	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2291.3	29.00737	3	1125.551771	1125.556707	K	L	97	106
PSM	AAGFPTASVCR	2532	sp|Q5U5V2|HYKK_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	10-UNIMOD:4	ms_run[1]:scan=1.1.2322.16	29.87887	2	1135.541647	1135.544428	R	T	93	104
PSM	NNDLVVAVNGK	2533	sp|Q9JIL4|NHRF3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2318.15	29.7656	2	1141.606647	1141.609137	K	S	284	295
PSM	RADFGFTVNK	2534	sp|Q99LB7|SARDH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2296.13	29.15192	2	1153.582847	1153.588007	R	T	855	865
PSM	HYFIEVNSR	2535	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2270.16	28.44158	2	1163.567047	1163.572357	K	L	320	329
PSM	INFDSNSAYR	2536	sp|Q9Z2I9|SUCB1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2344.12	30.48512	2	1185.542047	1185.541451	K	Q	275	285
PSM	GLETTATYDPK	2537	sp|Q9R0H0|ACOX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2188.20	26.18967	2	1194.574647	1194.576833	R	T	149	160
PSM	YGGTFQNVSVK	2538	sp|P17427|AP2A2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2330.17	30.10423	2	1198.593447	1198.598238	R	L	807	818
PSM	AVENSSTAIGIR	2539	sp|O70435|PSA3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2196.20	26.41597	2	1216.638447	1216.641165	K	C	30	42
PSM	LPAKPEVSSDEDVQYR	2540	sp|Q8BMS1|ECHA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2273.20	28.52747	3	1831.895471	1831.895208	R	V	661	677
PSM	NQFTVAQYEK	2541	sp|Q3UZZ6|ST1D1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2354.18	30.76283	2	1226.589047	1226.593152	K	F	266	276
PSM	DQVANSAFVER	2542	sp|P07901|HS90A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2328.18	30.0487	2	1234.590847	1234.594215	K	L	501	512
PSM	EQVANSAFVER	2543	sp|P11499|HS90B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2220.18	27.07072	2	1248.606247	1248.609865	K	V	492	503
PSM	EVNVSPCPTDPCQLHK	2544	sp|Q9Z0J0|NPC2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	7-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.2299.19	29.24068	3	1879.857971	1879.855668	K	G	36	52
PSM	FPGQLNADLRK	2545	sp|A2AQ07|TBB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2325.9	29.95708	3	1257.676871	1257.682970	R	L	242	253
PSM	FPGQLNADLRK	2546	sp|A2AQ07|TBB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2337.3	30.28862	3	1257.676871	1257.682970	R	L	242	253
PSM	IDEPLEGSEDR	2547	sp|P61979|HNRPK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2210.13	26.80153	2	1258.567447	1258.567725	K	I	423	434
PSM	VLEACSIACNK	2548	sp|P50431|GLYC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	5-UNIMOD:4,9-UNIMOD:4	ms_run[1]:scan=1.1.2214.14	26.9092	2	1263.587647	1263.595143	K	N	370	381
PSM	QHATNVGIMFR	2549	sp|P35505|FAAA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2288.18	28.94007	2	1272.632247	1272.639725	R	G	132	143
PSM	GIVEESVTGVHR	2550	sp|Q68FL4|SAHH3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2208.4	26.73602	3	1281.661271	1281.667714	K	L	333	345
PSM	EGASEEEINLSK	2551	sp|Q8VCC2|EST1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2228.19	27.29305	2	1304.605647	1304.609590	K	M	481	493
PSM	YICTTSAIQNR	2552	sp|Q91V92|ACLY_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	3-UNIMOD:4	ms_run[1]:scan=1.1.2169.21	25.6545	2	1325.638247	1325.639785	K	F	18	29
PSM	RFDDAVVQSDMK	2553	sp|P63017|HSP7C_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2277.9	28.62943	3	1409.658371	1409.660914	R	H	77	89
PSM	TCSCLDENYYK	2554	sp|O09173|HGD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	2-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=1.1.2279.20	28.69455	2	1451.570047	1451.569717	K	C	415	426
PSM	LTDIHGNALQYNK	2555	sp|Q9Z0S1|BPNT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2193.14	26.32698	3	1485.756371	1485.757592	K	E	262	275
PSM	IWHHTFYNELR	2556	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2342.8	30.42723	3	1514.740271	1514.741882	K	V	85	96
PSM	HFGYTSYSVSNSVK	2557	sp|P10605|CATB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2322.14	29.8772	3	1574.736371	1574.736522	K	E	224	238
PSM	SDFDPGQDTYQHPPK	2558	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2229.15	27.31742	3	1730.754371	1730.753629	R	D	535	550
PSM	VEKPVVEMDGDEMTR	2559	sp|P54071|IDHP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2365.14	31.05607	3	1733.802371	1733.796422	K	I	46	61
PSM	MEEFKDQLPADECNK	2560	sp|P38647|GRP75_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	13-UNIMOD:4	ms_run[1]:scan=1.1.2352.19	30.70842	3	1852.797971	1852.797150	K	L	596	611
PSM	DPGLDLR	2561	sp|Q91V76|CK054_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2381.5	31.48672	2	784.400847	784.407918	K	L	257	264
PSM	DPGLDLR	2562	sp|Q91V76|CK054_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2374.4	31.29335	2	784.400847	784.407918	K	L	257	264
PSM	AYGLALAK	2563	sp|P40142|TKT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2378.3	31.40192	2	805.462047	805.469790	K	L	320	328
PSM	LEDLIVK	2564	sp|Q8QZT1|THIL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2440.3	33.12077	2	828.491047	828.495670	K	D	172	179
PSM	PSWGNHTPIFR	2565	sp|P05202|AATM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2454.4	33.50358	3	1310.646671	1310.652004	K	D	160	171
PSM	IIAVDINK	2566	sp|P00329|ADH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2384.9	31.57412	2	884.527247	884.533118	R	D	220	228
PSM	MGPLINAPHLER	2567	sp|Q9JLJ2|AL9A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2559.4	36.4027	3	1346.707871	1346.712890	R	V	327	339
PSM	LVIITAGAR	2568	sp|P00342|LDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2449.5	33.3702	2	912.569247	912.575652	K	M	91	100
PSM	LVIITAGAR	2569	sp|P00342|LDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2456.6	33.55892	2	912.569247	912.575652	K	M	91	100
PSM	DGYAQILR	2570	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2571.4	36.7396	2	934.482047	934.487230	R	D	430	438
PSM	VFIEDVSK	2571	sp|P16460|ASSY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2400.7	32.01755	2	935.492047	935.496398	K	E	59	67
PSM	TYIIGELHPDDR	2572	sp|P56395|CYB5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2570.4	36.71147	3	1427.700971	1427.704494	K	S	78	90
PSM	DISLSEYK	2573	sp|P35700|PRDX1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2521.7	35.35558	2	953.466447	953.470577	K	G	28	36
PSM	GYYAVAVVK	2574	sp|Q921I1|TRFE_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2425.9	32.71257	2	968.530247	968.533118	K	A	447	456
PSM	GEVGLLVCK	2575	sp|O35488|S27A2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	8-UNIMOD:4	ms_run[1]:scan=1.1.2456.8	33.56059	2	973.524847	973.526653	K	I	420	429
PSM	TRHNNLDLVIIR	2576	tr|Q91VA7|Q91VA7_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2394.15	31.86013	3	1462.833671	1462.836845	K	E	152	164
PSM	LVVECVMK	2577	sp|P04117|FABP4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	5-UNIMOD:4	ms_run[1]:scan=1.1.2456.9	33.56142	2	976.505647	976.508560	K	G	114	122
PSM	LATLGALEAK	2578	sp|Q9WUZ9|ENTP5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2533.11	35.69613	2	985.578647	985.580797	R	G	251	261
PSM	VLTEIIASR	2579	sp|P48036|ANXA5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2571.6	36.74127	2	1000.586447	1000.591696	K	T	107	116
PSM	ELNQLLGPK	2580	sp|Q91XE4|ACY3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2506.10	34.93279	2	1010.574847	1010.576046	R	G	95	104
PSM	IGGIGTVPVGR	2581	sp|P10126|EF1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2490.9	34.48933	2	1024.598447	1024.602929	K	V	256	267
PSM	IGGIGTVPVGR	2582	sp|P10126|EF1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2477.9	34.12926	2	1024.598447	1024.602929	K	V	256	267
PSM	NLSTFAVDGK	2583	sp|Q9D172|GAL3A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2437.9	33.04239	2	1050.530247	1050.534575	K	D	140	150
PSM	YNDQHIPGSPFTAR	2584	sp|Q8BTM8|FLNA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2442.15	33.18553	3	1601.745371	1601.758654	K	V	1938	1952
PSM	TKPYIQVDIGGGQTK	2585	sp|P20029|BIP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2392.14	31.80233	3	1603.858571	1603.856972	K	T	125	140
PSM	FIGPSPEVVR	2586	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2555.11	36.2983	2	1099.600847	1099.602595	R	K	138	148
PSM	ALLEVVQSGGK	2587	sp|Q9CWH6|PSMA8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2535.12	35.75215	2	1099.620447	1099.623724	K	N	196	207
PSM	ALLEVVQSGGK	2588	sp|Q9CWH6|PSMA8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2541.16	35.92378	2	1099.620447	1099.623724	K	N	196	207
PSM	IIQFNPGPDK	2589	sp|O88958|GNPI1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2457.8	33.5875	2	1127.593247	1127.597509	R	Y	24	34
PSM	IIQFNPGPDK	2590	sp|O88958|GNPI1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2450.8	33.40797	2	1127.593247	1127.597509	R	Y	24	34
PSM	LIIAGTSAYAR	2591	sp|Q9CZN7|GLYM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2520.12	35.33153	2	1134.634047	1134.639708	R	L	220	231
PSM	ASSIVVSGTPIR	2592	sp|P35505|FAAA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2437.16	33.04822	2	1185.668447	1185.671737	R	R	163	175
PSM	RIDQAFALTR	2593	sp|Q9DBE0|CSAD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2416.12	32.46592	2	1189.657247	1189.656755	R	Y	380	390
PSM	AVLYVPGNDEK	2594	sp|Q8R4N0|CLYBL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2423.18	32.66398	2	1203.611847	1203.613553	R	K	45	56
PSM	NAGVEGSLIVEK	2595	sp|P63038|CH60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2423.19	32.66482	2	1214.649247	1214.650667	K	I	482	494
PSM	LFEASVETGDR	2596	sp|Q9CPY7|AMPL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2402.17	32.08092	2	1222.580447	1222.582981	K	V	418	429
PSM	VTGADVPMPYAK	2597	sp|Q9D051|ODPB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2555.16	36.30247	2	1247.619047	1247.622010	R	V	325	337
PSM	VTGADVPMPYAK	2598	sp|Q9D051|ODPB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2548.13	36.1104	2	1247.619047	1247.622010	R	V	325	337
PSM	DYTEMNDLQK	2599	sp|P11352|GPX1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2422.20	32.63762	2	1255.540047	1255.539068	R	R	53	63
PSM	SNDEDSFAFAR	2600	sp|Q91WT9|CBS_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2565.18	36.58228	2	1257.522847	1257.526195	K	M	323	334
PSM	AYDATTHFETTCDDIK	2601	sp|Q61598|GDIB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	12-UNIMOD:4	ms_run[1]:scan=1.1.2397.17	31.94382	3	1886.803271	1886.799259	R	D	403	419
PSM	IEGIQNMPNVR	2602	sp|Q99LB7|SARDH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2572.15	36.77705	2	1269.647047	1269.649956	R	D	302	313
PSM	AQIWDTAGQER	2603	sp|P46638|RB11B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2405.20	32.16678	2	1273.605047	1273.605114	K	Y	62	73
PSM	LVEEAIQCAEK	2604	sp|Q8BH95|ECHM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	8-UNIMOD:4	ms_run[1]:scan=1.1.2399.17	31.99848	2	1288.631447	1288.633303	K	I	218	229
PSM	ELISNASDALEK	2605	sp|Q9CQN1|TRAP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2534.18	35.72953	2	1288.651047	1288.651061	R	L	117	129
PSM	LYEIGAGTSEVR	2606	sp|Q9JHI5|IVD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2486.13	34.37978	2	1293.654447	1293.656481	K	R	400	412
PSM	NSLESYAFNMK	2607	sp|P63017|HSP7C_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	10-UNIMOD:35	ms_run[1]:scan=1.1.2571.14	36.74795	2	1318.585247	1318.586353	K	A	540	551
PSM	GATQQILDEAER	2608	sp|P80314|TCPB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2485.18	34.35608	2	1329.651647	1329.652458	R	S	377	389
PSM	ILYSQCGDVMR	2609	sp|Q60605|MYL6_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	6-UNIMOD:4	ms_run[1]:scan=1.1.2466.8	33.83823	2	1340.627447	1340.621692	K	A	27	38
PSM	TQILAASYELHK	2610	sp|Q62261|SPTB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2433.10	32.93347	3	1372.731371	1372.735065	R	F	1798	1810
PSM	ENPSANYTTMMK	2611	sp|Q3UZZ6|ST1D1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2385.20	31.61142	2	1385.597047	1385.595537	K	E	234	246
PSM	SVEDLPEGVDPSR	2612	sp|Q62468|VILI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2565.20	36.58395	2	1398.663647	1398.662688	K	K	776	789
PSM	EGLELPEDEEEK	2613	sp|P07901|HS90A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2551.13	36.19308	2	1415.631647	1415.630385	K	K	548	560
PSM	EFQCGSGECILR	2614	sp|A2ARV4|LRP2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	4-UNIMOD:4,9-UNIMOD:4	ms_run[1]:scan=1.1.2517.19	35.25172	2	1454.631847	1454.628234	K	A	187	199
PSM	ASAGPQPLLVQSCK	2615	sp|P26039|TLN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	13-UNIMOD:4	ms_run[1]:scan=1.1.2400.19	32.02755	2	1454.754847	1454.755149	K	A	944	958
PSM	EQQIVIQSSGGLSK	2616	sp|P38647|GRP75_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2400.20	32.02839	2	1472.782247	1472.783472	R	D	542	556
PSM	VSPDGEEGYPGELK	2617	sp|Q8K157|GALM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2390.20	31.75083	2	1475.680447	1475.678004	R	V	132	146
PSM	LLCEGLQDPQCR	2618	sp|Q91VI7|RINI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	3-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=1.1.2456.19	33.57143	2	1487.682647	1487.686084	K	L	127	139
PSM	HEDCYILDQGGLK	2619	sp|Q62468|VILI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	4-UNIMOD:4	ms_run[1]:scan=1.1.2510.21	35.05333	2	1546.712247	1546.708593	K	I	282	295
PSM	THINIVVIGHVDSGK	2620	sp|P10126|EF1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2401.21	32.05675	2	1587.876247	1587.873290	K	S	6	21
PSM	TATPQNFSNYESMK	2621	sp|Q3UNX5|ACSM3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2506.19	34.9403	2	1616.720047	1616.714072	R	Q	28	42
PSM	TFTTQETITNAETAK	2622	sp|P06745|G6PI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2421.21	32.61058	2	1654.808247	1654.804996	K	E	212	227
PSM	IRADIVENQVMDTR	2623	sp|P10649|GSTM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2562.11	36.4927	3	1658.840171	1658.841004	R	M	95	109
PSM	INGEWHTIILASDKR	2624	sp|A2BIM8|MUP18_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2549.13	36.13737	3	1751.930471	1751.931868	K	E	34	49
PSM	TCEWIHDSSLSASCK	2625	sp|Q61207|SAP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	2-UNIMOD:4,14-UNIMOD:4	ms_run[1]:scan=1.1.2395.16	31.88827	3	1779.752471	1779.755620	K	E	93	108
PSM	NQQEGVCPEGSIDNSPVK	2626	sp|Q921I1|TRFE_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	7-UNIMOD:4	ms_run[1]:scan=1.1.2378.21	31.41693	2	1956.897047	1956.884720	R	W	344	362
PSM	VAVPSTIHCDHLIEAQVGGEK	2627	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	9-UNIMOD:4	ms_run[1]:scan=1.1.2567.17	36.63757	3	2259.138371	2259.131767	K	D	118	139
PSM	GAIFGGFK	2628	sp|P00329|ADH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2616.3	37.99103	2	795.421447	795.427925	K	S	317	325
PSM	ALNDHHVYLEGTLLK	2629	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2586.3	37.15707	4	1721.915294	1721.910070	K	P	216	231
PSM	EVAGFWVK	2630	sp|Q60648|SAP3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2769.2	42.25307	2	934.485647	934.491253	K	I	89	97
PSM	LYSEFLGK	2631	sp|O35660|GSTM6_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2645.8	38.79768	2	955.498847	955.501484	K	Q	137	145
PSM	IGLFGGAGVGK	2632	sp|P56480|ATPB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2728.2	41.11858	2	974.551047	974.554916	K	T	202	213
PSM	REYYFAITMER	2633	sp|Q9Z2I9|SUCB1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2775.6	42.42465	3	1477.704071	1477.702385	R	S	165	176
PSM	ALASLMTYK	2634	sp|P26443|DHE3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2645.9	38.79852	2	996.528847	996.531404	K	C	163	172
PSM	NFNLPMCK	2635	sp|Q9D0K2|SCOT1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	7-UNIMOD:4	ms_run[1]:scan=1.1.2631.10	38.40553	2	1022.465447	1022.467758	R	A	229	237
PSM	MFASFPTTK	2636	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2627.10	38.29377	2	1028.498047	1028.500103	R	T	33	42
PSM	LPAVVTADLR	2637	sp|Q9DCW4|ETFB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2725.8	41.03907	2	1053.614247	1053.618245	K	L	177	187
PSM	LVLLGESAVGK	2638	sp|P35278|RAB5C_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2741.10	41.48397	2	1084.645047	1084.649211	K	S	24	35
PSM	LLADPTGAFGK	2639	sp|P99029|PRDX5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2733.3	41.25718	2	1088.584847	1088.586610	R	A	145	156
PSM	VSSLPTVYLK	2640	sp|P18242|CATD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2763.10	42.09238	2	1105.635647	1105.638311	K	L	330	340
PSM	LSISGDYNLK	2641	sp|P22599|A1AT2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2610.9	37.83013	2	1108.573647	1108.576440	R	T	309	319
PSM	DLMQTPNFR	2642	sp|P13707|GPDA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2762.13	42.06693	2	1120.534447	1120.533529	K	I	179	188
PSM	AASGSALLWPR	2643	sp|Q9DB29|IAH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2765.10	42.14832	2	1127.607847	1127.608743	R	V	7	18
PSM	FPGQLNADLR	2644	sp|A2AQ07|TBB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2656.12	39.11092	2	1129.581847	1129.588007	R	K	242	252
PSM	IAMQTLDMGR	2645	sp|Q07417|ACADS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2620.8	38.1012	2	1134.551447	1134.552550	K	I	263	273
PSM	IAMQTLDMGR	2646	sp|Q07417|ACADS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2613.12	37.9159	2	1134.551447	1134.552550	K	I	263	273
PSM	HFTEFVPLR	2647	sp|P50516|VATA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2604.15	37.6697	2	1144.602447	1144.602929	K	T	468	477
PSM	KWLPELVDR	2648	sp|Q9EQ20|MMSA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2665.8	39.35287	2	1154.641447	1154.644794	K	A	331	340
PSM	EDKLECSEELGDLVK	2649	sp|Q68FD5|CLH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	6-UNIMOD:4	ms_run[1]:scan=1.1.2749.4	41.70333	3	1762.831571	1762.829496	K	S	454	469
PSM	IDIIPNPQER	2650	sp|P11499|HS90B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2680.12	39.7733	2	1193.638447	1193.640437	K	T	73	83
PSM	TLADAEGDVFR	2651	sp|Q9EQ20|MMSA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2682.14	39.83192	2	1192.573647	1192.572417	K	G	130	141
PSM	WGVISASVDDR	2652	sp|P97494|GSH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2727.11	41.09883	2	1203.590247	1203.588401	R	T	297	308
PSM	QITVNDLPVGR	2653	sp|Q61171|PRDX2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2700.12	40.32525	2	1210.665647	1210.666986	R	S	140	151
PSM	ASSTANLIFEDCRIPK	2654	sp|Q07417|ACADS_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	12-UNIMOD:4	ms_run[1]:scan=1.1.2761.14	42.03963	3	1820.915771	1820.909084	R	E	235	251
PSM	QTLEEHYGDKPVGMGGTFIVQK	2655	sp|Q91V76|CK054_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2647.14	38.8594	4	2433.214094	2433.199846	R	G	190	212
PSM	VYNIEFNPPK	2656	sp|Q9WTP7|KAD3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2755.14	41.87208	2	1219.622447	1219.623724	R	T	137	147
PSM	CAVVDVPFGGAK	2657	sp|P26443|DHE3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:4	ms_run[1]:scan=1.1.2723.11	40.9843	2	1218.606247	1218.606694	K	A	172	184
PSM	HLGLPVFNTVK	2658	sp|Q9WUM5|SUCA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2755.15	41.87292	2	1223.700447	1223.702643	K	E	95	106
PSM	SDDIILSSGYR	2659	sp|Q3UNX5|ACSM3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2644.13	38.77353	2	1224.602247	1224.598632	R	I	471	482
PSM	KLGESCIFAPANVTSEK	2660	sp|O08756|HCD2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	6-UNIMOD:4	ms_run[1]:scan=1.1.2588.17	37.22445	3	1849.927571	1849.924400	K	E	53	70
PSM	RAPFDLFENK	2661	sp|P11499|HS90B_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2779.12	42.54092	2	1235.626847	1235.629872	R	K	338	348
PSM	GVLFYGPPGCGK	2662	sp|Q01853|TERA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	10-UNIMOD:4	ms_run[1]:scan=1.1.2744.13	41.57075	2	1250.613047	1250.611779	K	T	513	525
PSM	MLLADQGQSWK	2663	tr|F6RWR5|F6RWR5_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2658.17	39.17073	2	1275.626847	1275.628158	R	E	20	31
PSM	RPSANCDPYAVTEAIVR	2664	sp|P15105|GLNA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	6-UNIMOD:4	ms_run[1]:scan=1.1.2690.11	40.0479	3	1917.942671	1917.936696	R	T	341	358
PSM	EIGTHKPLPGITVGDIGPK	2665	sp|Q9R0H0|ACOX1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2622.8	38.15759	3	1928.077571	1928.073112	R	F	211	230
PSM	GLCAIAQAESLR	2666	sp|P62908|RS3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	3-UNIMOD:4	ms_run[1]:scan=1.1.2730.16	41.1848	2	1287.659247	1287.660521	R	Y	95	107
PSM	EAICEVALDYK	2667	sp|Q62261|SPTB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	4-UNIMOD:4	ms_run[1]:scan=1.1.2770.16	42.2926	2	1309.629047	1309.622404	K	K	2258	2269
PSM	HTTIFEVLPEK	2668	sp|Q921I1|TRFE_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2677.13	39.68848	2	1312.702247	1312.702703	K	A	226	237
PSM	EHALLAYTLGVK	2669	sp|P10126|EF1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2742.14	41.51552	2	1313.733047	1313.734337	R	Q	135	147
PSM	VLQETILVEER	2670	sp|Q9WV92|E41L3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2721.16	40.93122	2	1327.735047	1327.734731	K	H	690	701
PSM	TSEGSWEPFASGK	2671	sp|P07309|TTHY_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2677.18	39.69267	2	1381.615047	1381.615010	K	T	56	69
PSM	QNLQICVQVASK	2672	sp|Q68FD5|CLH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	6-UNIMOD:4	ms_run[1]:scan=1.1.2582.19	37.06012	2	1386.725247	1386.728935	R	Y	677	689
PSM	CGPGYSTPLEAMK	2673	sp|P17563|SBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:4	ms_run[1]:scan=1.1.2632.18	38.44028	2	1409.633447	1409.631923	K	G	8	21
PSM	EPALNEANLSNLK	2674	sp|P97371|PSME1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2681.15	39.80438	2	1411.726647	1411.730708	K	A	46	59
PSM	TPSCCYLWCGK	2675	sp|Q62468|VILI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	4-UNIMOD:4,5-UNIMOD:4,9-UNIMOD:4	ms_run[1]:scan=1.1.2641.17	38.69203	2	1430.580047	1430.578113	K	G	550	561
PSM	GDVTTQVALQPALK	2676	sp|P09671|SODM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2702.17	40.38673	2	1439.801047	1439.798394	K	F	76	90
PSM	LLGQVSAEDLAAEK	2677	sp|Q9CY64|BIEA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2741.18	41.49065	2	1442.764447	1442.761674	K	K	261	275
PSM	NAQLNIEQDVAPH	2678	sp|Q99KQ4|NAMPT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2653.21	39.03515	2	1447.706247	1447.705556	K	-	479	492
PSM	AQQVSQGLDVLTAK	2679	sp|Q64727|VINC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2674.16	39.60588	2	1456.789247	1456.788558	K	V	353	367
PSM	LREMLNISGPPLK	2680	sp|Q9CPY7|AMPL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2720.3	40.89182	3	1466.823371	1466.827920	K	A	67	80
PSM	ALNDHHVYLEGTLLKPNMVTAGHACTK	2681	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	25-UNIMOD:4	ms_run[1]:scan=1.1.2580.17	37.00337	4	2989.502894	2989.490232	K	K	216	243
PSM	VWCTSLHPELVR	2682	sp|Q91WR5|AK1CL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	3-UNIMOD:4	ms_run[1]:scan=1.1.2664.8	39.3251	3	1495.756271	1495.760569	K	A	85	97
PSM	EVSFQATGDSEWR	2683	sp|O35658|C1QBP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2708.19	40.56063	2	1510.673647	1510.668836	K	D	204	217
PSM	VGTGEPCCDWVGDEGAGHFVK	2684	sp|Q9DCD0|6PGD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	7-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.2727.19	41.1055	3	2275.978871	2275.962653	K	M	164	185
PSM	SGYQQAASEHGLVVIAPDTSPR	2685	sp|Q9R0P3|ESTD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2688.6	39.9974	3	2282.140871	2282.129124	K	G	65	87
PSM	FSASQFWDDCRK	2686	sp|O35488|S27A2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	10-UNIMOD:4	ms_run[1]:scan=1.1.2687.16	39.97208	2	1545.668847	1545.667063	K	Y	292	304
PSM	NCIGQQFAMNEMK	2687	sp|Q64462|CP4B1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	2-UNIMOD:4	ms_run[1]:scan=1.1.2694.20	40.16398	2	1569.676447	1569.673804	R	V	452	465
PSM	IYQIYEGTAQIQR	2688	sp|P45952|ACADM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2704.20	40.44683	2	1581.816447	1581.815107	K	L	396	409
PSM	EQWSNCPTIGQIR	2689	sp|P10605|CATB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	6-UNIMOD:4	ms_run[1]:scan=1.1.2701.20	40.36053	2	1587.747247	1587.746375	R	D	88	101
PSM	SSGEIVYCGQVFEK	2690	sp|P62717|RL18A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	8-UNIMOD:4	ms_run[1]:scan=1.1.2723.19	40.99097	2	1601.751847	1601.739559	K	S	57	71
PSM	LSAEERDQLLPNLR	2691	sp|P61458|PHS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2678.9	39.7137	3	1652.886371	1652.884583	R	A	8	22
PSM	NQVALNPQNTVFDAK	2692	sp|P17879|HS71B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2739.21	41.43657	2	1657.848847	1657.842384	K	R	57	72
PSM	VSHVSTGGGASLELLEGK	2693	sp|P09041|PGK2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2592.14	37.33523	3	1739.906471	1739.905378	K	I	389	407
PSM	EDKLECSEELGDLVK	2694	sp|Q68FD5|CLH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	6-UNIMOD:4	ms_run[1]:scan=1.1.2750.12	41.74212	2	1762.838447	1762.829496	K	S	454	469
PSM	ILDSVGIEADDDRLNK	2695	sp|P99027|RLA2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2622.5	38.15258	3	1771.900271	1771.895208	K	V	26	42
PSM	EAVCIVLSDDTCSDEK	2696	sp|Q01853|TERA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	4-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.2743.20	41.54862	2	1839.795047	1839.786645	R	I	66	82
PSM	GEVITTYCPANNEPIAR	2697	sp|Q9DBF1|AL7A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	8-UNIMOD:4	ms_run[1]:scan=1.1.2654.21	39.063	2	1903.917847	1903.909812	R	V	63	80
PSM	VAPEEHPTLLTEAPLNPK	2698	sp|P62737|ACTA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2694.16	40.16063	3	1955.043671	1955.036393	R	A	98	116
PSM	LSVLLLER	2699	sp|Q8VC30|TKFC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2998.2	48.68082	2	941.585247	941.590967	R	M	435	443
PSM	FIIPQIVK	2700	sp|P16125|LDHB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3101.3	51.56055	2	956.603247	956.605889	K	Y	120	128
PSM	AGIPVFAWK	2701	sp|P50247|SAHH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3153.2	53.0245	2	987.551047	987.554188	K	G	95	104
PSM	ENFIWNLK	2702	sp|Q5U5V2|HYKK_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3089.7	51.22745	2	1062.547047	1062.549831	R	N	175	183
PSM	AVAIDLPGLGR	2703	sp|Q8VCR7|ABHEB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3072.2	50.73874	2	1080.625647	1080.629144	R	S	64	75
PSM	DVAPQAPVHFLVIPR	2704	sp|Q9D0S9|HINT2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3168.4	53.44398	3	1657.934471	1657.930411	R	K	80	95
PSM	SDGIYIINLK	2705	sp|P14206|RSSA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3057.3	50.32025	2	1134.623447	1134.628475	K	R	43	53
PSM	QGEIFLLPAR	2706	sp|Q78JT3|3HAO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3061.6	50.42853	2	1142.642247	1142.644794	R	V	79	89
PSM	SGEYPFPLIK	2707	sp|P45952|ACADM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3083.8	51.05537	2	1149.607447	1149.607011	K	R	70	80
PSM	VEFDTFGELK	2708	sp|P97807|FUMH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3014.4	49.13155	2	1183.574247	1183.576105	R	V	49	59
PSM	VTSLVVDIVPR	2709	sp|Q8R146|APEH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3075.5	50.82623	2	1196.712647	1196.712873	K	Q	340	351
PSM	VMVTNVTSLLK	2710	sp|P26039|TLN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3046.10	50.01652	2	1203.688047	1203.689695	K	T	2120	2131
PSM	IEVIEIMTDR	2711	sp|P49312|ROA1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3110.6	51.81267	2	1217.635647	1217.632574	K	G	131	141
PSM	DFLAGGVAAAISK	2712	sp|P51881|ADT2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3175.8	53.64175	2	1218.662647	1218.660838	K	T	11	24
PSM	VFEFGGPEVLK	2713	sp|P47199|QOR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3079.12	50.94467	2	1220.644247	1220.644125	R	L	13	24
PSM	YLYTLVITDK	2714	sp|Q9JJI8|RL38_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3061.12	50.43355	2	1227.675847	1227.675091	R	E	41	51
PSM	NIPGITLLNVSK	2715	sp|Q9D8E6|RL4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3184.9	53.89442	2	1267.753247	1267.749987	R	L	223	235
PSM	VPTPNVSVVDLTCRLEK	2716	sp|P16858|G3P_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	13-UNIMOD:4	ms_run[1]:scan=1.1.3032.7	49.61687	3	1926.027371	1926.024448	R	P	233	250
PSM	VHLVGIDIFTGK	2717	sp|P63242|IF5A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3086.2	51.13698	3	1297.734371	1297.739423	K	K	56	68
PSM	DVLSVAFSSDNR	2718	sp|P68040|RACK1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3042.9	49.90117	2	1308.631047	1308.630994	K	Q	107	119
PSM	HLLPLVQCPTLIVHGEKDPLVPR	2719	sp|Q8R164|BPHL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	8-UNIMOD:4	ms_run[1]:scan=1.1.3048.14	50.07733	4	2630.487294	2630.473048	R	F	227	250
PSM	HLLPLVQCPTLIVHGEKDPLVPR	2720	sp|Q8R164|BPHL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	8-UNIMOD:4	ms_run[1]:scan=1.1.3038.12	49.78917	4	2630.487294	2630.473048	R	F	227	250
PSM	GPILMELQTYR	2721	sp|P35486|ODPA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3093.12	51.34528	2	1319.691447	1319.690758	K	Y	278	289
PSM	AVEEIWFETAK	2722	sp|Q5U5V2|HYKK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3044.11	49.96012	2	1321.654447	1321.655418	K	S	358	369
PSM	FIEDELQIPVK	2723	sp|P46664|PURA2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3115.13	51.9539	2	1329.720647	1329.718018	R	W	431	442
PSM	GFPTIYFSPANK	2724	sp|P27773|PDIA3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3115.14	51.95473	2	1340.679847	1340.676488	K	K	449	461
PSM	FESTSILQTLSK	2725	sp|Q3UNX5|ACSM3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3055.9	50.26954	2	1352.718247	1352.718747	R	F	300	312
PSM	LEAALADVPELAR	2726	sp|Q9D6Y9|GLGB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3074.9	50.80138	2	1366.742047	1366.745630	R	L	18	31
PSM	CQPPDAVVWPQNVDQVSR	2727	sp|Q7TNG8|LDHD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:4	ms_run[1]:scan=1.1.3011.8	49.0517	3	2094.003671	2093.995273	R	V	63	81
PSM	ELEEIVQPIISK	2728	sp|P20029|BIP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3073.12	50.77559	2	1396.785647	1396.781347	K	L	623	635
PSM	SCWDEPLSIAVR	2729	sp|O55137|ACOT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	2-UNIMOD:4	ms_run[1]:scan=1.1.3158.14	53.17948	2	1431.688047	1431.681650	R	G	13	25
PSM	TFNMDEYVGLPR	2730	sp|O88958|GNPI1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3168.15	53.45317	2	1440.673847	1440.670751	K	D	68	80
PSM	SSFFVNGLTLGGQK	2731	sp|P62962|PROF1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3174.15	53.61948	2	1453.757847	1453.756529	R	C	57	71
PSM	NVGLDIEAEVPAVK	2732	sp|P42932|TCPQ_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3099.13	51.51378	2	1452.781247	1452.782410	K	D	477	491
PSM	LGEYGFQNAILVR	2733	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3174.16	53.62032	2	1478.796247	1478.788164	K	Y	422	435
PSM	EATSVLGEHQALCTITSFPR	2734	sp|P97494|GSH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	13-UNIMOD:4	ms_run[1]:scan=1.1.3062.18	50.46627	3	2216.098271	2216.089567	K	L	130	150
PSM	AQFEGIVTDLIKR	2735	sp|P38647|GRP75_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3124.2	52.19608	3	1488.829571	1488.830029	R	T	349	362
PSM	AQLLQPTLEINPR	2736	sp|Q9CQN1|TRAP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2983.17	48.2868	2	1491.841647	1491.840928	R	H	637	650
PSM	AVLDVAETGTEAAAATGVIGGIRK	2737	sp|P07759|SPA3K_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3154.19	53.06772	3	2269.235471	2269.227775	K	A	361	385
PSM	DILDIVPTEIHQK	2738	sp|Q9QXD6|F16P1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3112.2	51.86341	3	1519.826471	1519.824609	K	A	302	315
PSM	FANILTEACSLQR	2739	sp|Q3UNX5|ACSM3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	9-UNIMOD:4	ms_run[1]:scan=1.1.3094.16	51.37703	2	1521.767647	1521.760963	K	G	101	114
PSM	QCFLYMVCQTAK	2740	sp|Q9DCY0|KEG1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	2-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.3008.18	48.97658	2	1547.697247	1547.693477	K	K	129	141
PSM	YSSPTTIATVMSLSK	2741	sp|Q9DBM2|ECHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3107.15	51.73683	2	1584.812047	1584.806910	R	R	445	460
PSM	AAAAGALAPGPLPDLAAR	2742	sp|Q3TW96|UAP1L_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3060.15	50.4085	2	1601.888847	1601.888940	R	L	53	71
PSM	GQATDIAIQAEEIMK	2743	sp|O88696|CLPP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3180.20	53.79352	2	1616.810647	1616.807973	R	L	182	197
PSM	LTVEDPVTVEYITR	2744	sp|Q9CWH6|PSMA8_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3122.20	52.15447	2	1633.861447	1633.856303	K	F	98	112
PSM	SQEQLAAELAEYTAK	2745	sp|P26040|EZRI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3095.18	51.40707	2	1650.820247	1650.810081	K	I	413	428
PSM	TLVYGGIFLYPANKK	2746	sp|Q9QXD6|F16P1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3033.18	49.65362	2	1682.944847	1682.939579	R	S	256	271
PSM	QVLLSEPQEAAALYR	2747	sp|Q8R146|APEH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3014.10	49.14157	2	1686.895047	1686.894085	R	G	4	19
PSM	QCSSGLQAVANIAGGIR	2748	sp|Q8VCH0|THIKB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	2-UNIMOD:4	ms_run[1]:scan=1.1.3075.20	50.83875	2	1700.867847	1700.862802	R	N	122	139
PSM	SYQDPSNAQFLESIR	2749	sp|Q9CZ44|NSF1C_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3007.20	48.95033	2	1753.835447	1753.827128	R	R	200	215
PSM	NGGLGHMNITLLSDITK	2750	sp|P20108|PRDX3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3168.8	53.44732	3	1782.931871	1782.929819	K	Q	151	168
PSM	QLLQEEVGPVGVETMR	2751	sp|Q7TNG8|LDHD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3011.19	49.06088	2	1783.916447	1783.913835	R	Q	451	467
PSM	MVIWGANAYVTEEDSR	2752	sp|Q8R164|BPHL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3141.18	52.69182	2	1839.857247	1839.846149	K	I	159	175
PSM	TGIGSGLSLSGIVHPELSR	2753	sp|P50544|ACADV_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3123.12	52.17617	3	1879.015571	1879.016326	R	S	514	533
PSM	STCTINYSTSLPLAQGIK	2754	sp|Q9DBF1|AL7A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	3-UNIMOD:4	ms_run[1]:scan=1.1.3081.21	51.00895	2	1952.998847	1952.987728	R	F	520	538
PSM	IFNSGADLSGITEENAPLK	2755	sp|Q00898|A1AT5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3097.21	51.46537	2	1975.001847	1974.989836	R	L	329	348
PSM	VLNNMEIGTSLYDEEGAK	2756	sp|P09411|PGK1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3008.21	48.97908	2	1981.944647	1981.930273	K	I	247	265
PSM	ILATPPQEDAPSVDIANIR	2757	sp|P40142|TKT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3102.12	51.59566	3	2019.070871	2019.063670	K	M	284	303
PSM	RPWLVDYGESGEQVAGFVK	2758	sp|P16675|PPGB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3153.14	53.03452	3	2136.063371	2136.064004	R	E	418	437
PSM	IFSGCNIENACYPLGVCAER	2759	sp|P56389|CDD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	5-UNIMOD:4,11-UNIMOD:4,17-UNIMOD:4	ms_run[1]:scan=1.1.3119.18	52.06828	3	2329.045871	2329.028958	R	T	49	69
PSM	QAPQTVHLPSGETLDVFDAAER	2760	sp|P28271|ACOC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3147.19	52.86503	3	2380.178771	2380.165903	K	Y	737	759
PSM	TITSQWKEEDATLSSPAVVMPTMGR	2761	sp|Q9EQ20|MMSA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3167.21	53.43063	3	2734.352171	2734.330602	K	-	511	536
PSM	LQVEHTVTEEITDVDLVHAQIHVSEGR	2762	sp|Q05920|PYC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3042.7	49.8995	5	3053.560618	3053.541792	R	S	329	356
PSM	TLVYGGIFLYPANK	2763	sp|Q9QXD6|F16P1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3411.12	60.24875	2	1554.843447	1554.844616	R	K	256	270
PSM	ETYLAILMDR	2764	sp|Q9Z2I8|SUCB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3409.5	60.18488	2	1223.624447	1223.622010	R	S	152	162
PSM	AWGLDYLFEK	2765	sp|O55060|TPMT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3599.3	65.51048	2	1240.613047	1240.612825	K	L	224	234
PSM	DLELLIQTATR	2766	sp|Q02819|NUCB1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3500.4	62.72142	2	1271.712847	1271.708516	R	D	152	163
PSM	ILSLLQNLGISK	2767	sp|Q571E4|GALNS_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3487.6	62.34883	2	1297.800047	1297.796937	K	N	266	278
PSM	AFVEFLTDEIK	2768	sp|O35658|C1QBP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3415.7	60.36097	2	1310.681047	1310.675819	K	E	78	89
PSM	ALLAYAFALAGNK	2769	sp|Q61838|PZP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3469.4	61.8427	2	1321.743847	1321.739423	K	A	1160	1173
PSM	CLYSLINEAFR	2770	sp|Q9DBM2|ECHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:4	ms_run[1]:scan=1.1.3433.4	60.86077	2	1384.687447	1384.680922	R	I	618	629
PSM	ILADSINSEVGILCHALQK	2771	sp|P16331|PH4H_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	14-UNIMOD:4	ms_run[1]:scan=1.1.3408.14	60.16343	3	2080.111871	2080.098676	K	I	432	451
PSM	TLNDELEIIEGMK	2772	sp|P63038|CH60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3453.10	61.40695	2	1503.753247	1503.749061	K	F	206	219
PSM	HLYTLDGGDIINALCFSPNR	2773	sp|P68040|RACK1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	15-UNIMOD:4	ms_run[1]:scan=1.1.3530.15	63.57052	3	2275.120871	2275.105552	K	Y	226	246
PSM	DVPLGAPLCIIVEK	2774	sp|Q8BMF4|ODP2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	9-UNIMOD:4	ms_run[1]:scan=1.1.3588.9	65.21048	2	1522.845647	1522.842902	R	Q	282	296
PSM	SGFIEEDELGSILK	2775	sp|P32848|PRVA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3415.14	60.3668	2	1535.781847	1535.771905	K	G	56	70
PSM	GVMLAVDAVIAELKK	2776	sp|P63038|CH60_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3625.2	66.25975	3	1555.902671	1555.900751	R	Q	143	158
PSM	LLGQFTLIGIPPAPR	2777	sp|P38647|GRP75_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3630.12	66.41319	2	1591.952047	1591.944999	K	G	499	514
PSM	QIYPPINVLPSLSR	2778	sp|P62814|VATB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3430.6	60.78717	2	1595.913247	1595.903528	R	L	387	401
PSM	TIFSTLENDPLFAR	2779	sp|Q9EPL9|ACOX3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3585.7	65.13085	2	1622.834847	1622.830422	K	S	50	64
PSM	VEGAFPVTMLPGDGVGPELMHAVK	2780	tr|Q91VA7|Q91VA7_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3508.7	62.95102	3	2450.241671	2450.233789	R	E	44	68
PSM	IFNTNNLWISLGAVK	2781	sp|Q91ZJ5|UGPA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3628.14	66.35706	2	1688.926047	1688.924992	K	R	326	341
PSM	EVEPALELLEPIDQK	2782	sp|P50396|GDIA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3496.19	62.61767	2	1721.913447	1721.908732	K	F	365	380
PSM	LSIWGFFSTGDEHSR	2783	sp|Q91WU0|CES1F_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3470.2	61.86917	3	1737.816671	1737.811084	R	G	172	187
PSM	GLAPVQAYLHIPDIIK	2784	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3465.3	61.73228	3	1747.013171	1747.003242	R	V	89	105
PSM	YCNTWPMAISMLASK	2785	sp|Q64442|DHSO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	2-UNIMOD:4	ms_run[1]:scan=1.1.3556.13	64.31799	2	1771.820247	1771.809569	R	T	300	315
PSM	ALALAQEILPQAPIAVR	2786	sp|Q3TLP5|ECHD2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3511.12	63.02934	2	1773.057247	1773.051255	R	L	228	245
PSM	DAGYEFDICFTSVQK	2787	sp|Q9DBJ1|PGAM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	9-UNIMOD:4	ms_run[1]:scan=1.1.3411.19	60.25458	2	1778.790647	1778.782152	R	R	47	62
PSM	ITGEAFVQFASQELAEK	2788	sp|Q9Z2X1|HNRPF_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3566.20	64.60848	2	1866.952447	1866.936344	K	A	151	168
PSM	FDGGEEVFLSGEFNSLK	2789	sp|Q9CQ62|DECR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3499.20	62.70576	2	1873.886647	1873.873410	R	K	299	316
PSM	QKLPDGSEIPLPPILLGK	2790	sp|Q9D1A2|CNDP2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3511.2	63.021	3	1914.128471	1914.119000	K	L	67	85
PSM	AMTTFLSTLGAQCVIASR	2791	sp|Q9CQ62|DECR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	13-UNIMOD:4	ms_run[1]:scan=1.1.3485.6	62.2925	3	1925.976071	1925.970304	K	N	74	92
PSM	EGDSPQLMAIMNHVLGPR	2792	sp|Q62468|VILI_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3470.3	61.87083	3	1963.967171	1963.960802	K	K	216	234
PSM	IMDWLPQTDLLAHPSIR	2793	sp|Q8JZZ0|UD3A2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3458.6	61.54488	3	2005.050371	2005.045517	K	L	348	365
PSM	DLYANTVLSGGTTMYPGIADR	2794	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3479.10	62.12525	3	2214.079571	2214.062684	K	M	292	313
PSM	ILNKPVPSLPNMDSVFAEAIAK	2795	sp|Q9DBM2|ECHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3479.14	62.12858	3	2353.288571	2353.271554	R	V	196	218
PSM	LVTSPCCIVTSTYGWTANMER	2796	sp|P07901|HS90A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	6-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=1.1.3424.12	60.62138	3	2445.126371	2445.112688	R	I	593	614
PSM	EEFASTCPDDEEIELAYEQVAR	2797	sp|Q9Z1Q5|CLIC1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	7-UNIMOD:4	ms_run[1]:scan=1.1.3480.18	62.16048	3	2600.143571	2600.122443	R	A	217	239
PSM	FIGPSPEVVR	2798	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2548.10	36.1079	2	1099.600847	1099.602595	R	K	138	148
PSM	AYSEALAAFGNGALFVEK	2799	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3556.17	64.32467	2	1857.926647	1856.930865	R	F	220	238
PSM	CCSGSLVER	2800	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:4	ms_run[1]:scan=1.1.2445.11	33.26465	2	1049.4227	1049.4265	K	R	500	509
PSM	QTANVLSGACGLHR	2801	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:28,10-UNIMOD:4	ms_run[1]:scan=1.1.2669.17	39.46812	2	1465.7136	1465.7091	K	G	92	106
PSM	IGPSEVENALMEHPAVSETAVISSPDPSRGEVVK	2802	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3170.21	53.51328	4	3532.792094	3530.756278	R	A	474	508
PSM	EPLGPALAHELR	2803	sp|P17563|SBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2554.3	36.26439	3	1301.704571	1301.709185	K	Y	449	461
PSM	ISSVQSIVPALEIANAHR	2804	sp|P63038|CH60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3111.7	51.84052	3	1905.046271	1904.047960	K	K	251	269
PSM	DRVTDALNATR	2805	sp|P63038|CH60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2301.4	29.28488	3	1230.623771	1230.631663	K	A	419	430
PSM	VNQIGSVTESIQACK	2806	sp|P21550|ENOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	14-UNIMOD:4	ms_run[1]:scan=1.1.2605.19	37.70043	2	1632.819247	1632.814121	K	L	344	359
PSM	VNQIGSVTESIQACK	2807	sp|P21550|ENOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	14-UNIMOD:4	ms_run[1]:scan=1.1.2744.21	41.57743	2	1632.809847	1632.814121	K	L	344	359
PSM	VAEEWAQGTFK	2808	sp|Q91YI0|ARLY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2573.16	36.80587	2	1265.607647	1264.608802	K	L	70	81
PSM	VNADEVGGEALGR	2809	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2388.19	31.69423	2	1286.629447	1285.626243	K	L	19	32
PSM	KVITAFNDGLNHLDSLK	2810	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2721.12	40.92788	3	1885.000571	1884.010512	K	G	67	84
PSM	PMILGYWNVR	2811	sp|P10649|GSTM1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	18	2-UNIMOD:35	ms_run[1]:scan=1.1.3105.9	51.67632	2	1264.6642	1263.6432	M	G	2	12
PSM	GCITIIGGGDTATCCAK	2812	sp|P09411|PGK1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	2-UNIMOD:4,14-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=1.1.2554.14	36.27357	3	1754.778671	1753.779726	R	W	366	383
PSM	VTNGAFTGEISPGMIK	2813	sp|P17751|TPIS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3020.12	49.3009	2	1620.816447	1620.818143	K	D	120	136
PSM	PHPYPALTPEQK	2814	sp|P05064|ALDOA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	18		ms_run[1]:scan=1.1.2118.10	24.2086	3	1376.7007	1376.7083	M	K	2	14
PSM	QVVDSAYEVIK	2815	sp|P06151|LDHA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:28	ms_run[1]:scan=1.1.3182.5	53.8362	2	1232.6275	1232.6283	K	L	233	244
PSM	YGLAATVWSK	2816	sp|Q8BH00|AL8A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2763.9	42.09155	2	1094.574247	1094.576046	R	D	417	427
PSM	LPCIFICENNR	2817	sp|P35486|ODPA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	3-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=1.1.2984.13	48.31075	2	1434.676847	1434.674791	K	Y	216	227
PSM	LLSHCLLVTLASHHPADFTPAVHASLDK	2818	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	5-UNIMOD:4	ms_run[1]:scan=1.1.3039.17	49.82183	4	3052.608494	3049.580761	K	F	101	129
PSM	QITINDLPVGR	2819	sp|P35700|PRDX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:28	ms_run[1]:scan=1.1.3472.7	61.92723	2	1207.6566	1207.6556	R	S	141	152
PSM	AGLGHPSAFGR	2820	sp|Q9CWS0|DDAH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1	ms_run[1]:scan=1.1.2449.16	33.37937	2	1110.5503	1110.5565	M	A	2	13
PSM	QHGDVVSAIK	2821	sp|P70441|NHRF1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:28	ms_run[1]:scan=1.1.2194.14	26.35498	2	1035.5305	1035.5344	K	G	206	216
PSM	ATSASSHLNK	2822	sp|P15105|GLNA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1	ms_run[1]:scan=1.1.1812.18	15.71897	2	1056.5142	1056.5195	M	G	2	12
PSM	KVNLAELFK	2823	sp|P99029|PRDX5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2748.6	41.67527	2	1060.626647	1060.628081	K	G	71	80
PSM	WVQQNIAHFGGNPDR	2824	tr|E9PV38|E9PV38_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2468.7	33.88438	3	1737.831371	1737.833551	R	V	208	223
PSM	KFSGVYLEK	2825	sp|P40936|INMT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2121.16	24.29888	2	1069.575247	1069.580797	K	E	211	220
PSM	IGASTQAAQR	2826	sp|Q8VCT4|CES1D_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1699.19	12.58298	2	1001.525047	1001.525407	K	L	527	537
PSM	HNLCGETEEER	2827	sp|O35660|GSTM6_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	4-UNIMOD:4	ms_run[1]:scan=1.1.1714.12	12.995	2	1373.571047	1372.567742	K	I	84	95
PSM	AFDSGIIPMEFVNK	2828	sp|Q91V92|ACLY_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3460.6	61.60325	2	1568.779647	1566.775216	K	M	939	953
PSM	GTRDDEYDYLFK	2829	sp|P46638|RB11B_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1	ms_run[1]:scan=1.1.3088.18	51.20807	2	1562.6947	1562.6884	M	V	2	14
PSM	ISPQSNVDFDLTLR	2830	sp|Q9DCS2|MTL26_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3108.15	51.76458	2	1602.823047	1603.820586	K	C	148	162
PSM	RESHSILTPLVSLDTPGK	2831	sp|Q9CPV4|GLOD4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2781.15	42.60007	3	1949.058971	1949.058191	K	A	220	238
PSM	LTYTAEVSVPK	2832	sp|P24527|LKHA4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2549.15	36.13905	2	1206.647047	1206.649604	K	E	155	166
PSM	SQAEFDK	2833	sp|P31786|ACBP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1	ms_run[1]:scan=1.1.2145.11	24.96638	2	865.3769	865.3812	M	A	2	9
PSM	SLAGSSGPGASSGPGGDHSELIVR	2834	sp|P57776|EF1D_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2413.21	32.39073	3	2194.063871	2194.061438	K	I	60	84
PSM	VHIEIGPDGR	2835	sp|Q9Z2X1|HNRPF_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	18		ms_run[1]:scan=1.1.2174.7	25.78582	3	1091.5687	1091.5718	R	V	317	327
PSM	DGNGYISAAELR	2836	sp|P0DP26|CALM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2685.15	39.91635	2	1264.606447	1264.604780	K	H	96	108
PSM	GGGHVAQIYAIR	2837	sp|P14131|RS16_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2182.3	26.00633	3	1240.663271	1240.667655	K	Q	74	86
PSM	LVAYTSDQAHSSVER	2838	sp|O88533|DDC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2027.16	21.7062	3	1661.794571	1661.800913	K	A	183	198
PSM	VSHQGYGSTTEFEEPR	2839	sp|P55302|AMRP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2166.21	25.56937	3	1822.819571	1822.812206	K	V	244	260
PSM	VKPFMTGAAEQIK	2840	sp|P63028|TCTP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2314.11	29.65138	3	1418.757971	1418.759172	R	H	111	124
PSM	SHTILLVQPTK	2841	sp|P84089|ERH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1	ms_run[1]:scan=1.1.2697.17	40.24457	2	1277.7339	1277.7338	M	R	2	13
PSM	VVVTMEHSAK	2842	sp|Q9D0K2|SCOT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1799.20	15.35402	2	1098.564447	1099.569580	K	G	437	447
PSM	HSSLAGCQIINYR	2843	sp|Q68FD5|CLH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18	7-UNIMOD:4	ms_run[1]:scan=1.1.2361.13	30.95437	2	1518.733647	1517.740896	R	T	145	158
PSM	PGKESPWGVQK	2844	sp|P70174|HRH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2540.17	35.89657	2	1213.630047	1211.629872	K	R	251	262
PSM	ESVGGDTEAMASALR	2845	sp|Q924M7|MPI_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2705.20	40.47552	2	1494.703247	1492.682772	K	N	181	196
PSM	FLASVSTVLTSK	2846	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.2987.4	48.38655	2	1252.712847	1251.707454	K	Y	129	141
PSM	KFPLDPLITHVLPFEK	2847	sp|P00329|ADH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.3429.2	60.74942	3	1895.070071	1893.076407	K	I	340	356
PSM	VQEAVEENR	2848	sp|Q64516|GLPK_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1731.18	13.45517	2	1072.508847	1072.514902	K	A	164	173
PSM	FKDPNAPK	2849	sp|P63158|HMGB1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1696.3	12.48667	3	915.472571	915.481417	K	R	89	97
PSM	FLHPGSQR	2850	tr|E9Q6L7|E9Q6L7_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1754.2	14.08015	3	940.480571	940.487899	K	K	197	205
PSM	CSYDEHAK	2851	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	1-UNIMOD:4	ms_run[1]:scan=1.1.1578.4	9.21545	3	1008.390671	1008.397095	K	L	58	66
PSM	HHPEDVEPALRK	2852	sp|Q9JII6|AK1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1755.5	14.11075	4	1426.728494	1426.731711	K	T	86	98
PSM	KPPLDAK	2853	tr|E9Q6L7|E9Q6L7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1628.12	10.6124	2	767.448247	767.454139	R	Q	205	212
PSM	THTTVSGVAHR	2854	sp|Q99MN9|PCCB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1620.12	10.38932	3	1164.591671	1164.599969	K	A	251	262
PSM	LDHLAEK	2855	sp|P57780|ACTN4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1677.15	11.9613	2	824.432447	824.439218	R	F	412	419
PSM	SALEAAHK	2856	sp|P28474|ADHX_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1615.10	10.2482	2	825.426647	825.434467	R	G	277	285
PSM	ALKDEEK	2857	tr|D3Z2H9|D3Z2H9_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1572.11	9.053233	2	831.430647	831.433798	R	M	98	105
PSM	MVQEAEK	2858	sp|P63017|HSP7C_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1630.6	10.66513	2	833.388047	833.395304	R	Y	518	525
PSM	ASLAETDK	2859	sp|P50516|VATA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1693.13	12.41018	2	833.407247	833.413063	K	I	499	507
PSM	GAGHMVPTDKPR	2860	sp|P16675|PPGB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1695.8	12.46253	3	1264.631171	1264.634640	K	A	448	460
PSM	TEEIVQK	2861	sp|Q9DC50|OCTC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1745.15	13.84085	2	845.444647	845.449448	K	F	51	58
PSM	IHETNLK	2862	sp|Q99KI0|ACON_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1642.16	10.99417	2	853.457847	853.465767	R	K	694	701
PSM	RFQNVAK	2863	sp|P08113|ENPL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1648.14	11.16007	2	861.474647	861.482086	K	E	587	594
PSM	LQGPQTAR	2864	sp|P13707|GPDA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1733.12	13.50585	2	869.465047	869.471915	K	E	297	305
PSM	LQGPQTAR	2865	sp|P13707|GPDA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1726.16	13.31633	2	869.465047	869.471915	K	E	297	305
PSM	MAHWSNK	2866	sp|P10649|GSTM1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1682.10	12.09755	2	872.390847	872.396307	K	-	212	219
PSM	HHLDGETEEER	2867	sp|P10649|GSTM1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1625.14	10.53068	3	1350.570371	1350.580021	K	I	84	95
PSM	MGDKVEAR	2868	sp|Q05920|PYC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1623.13	10.47385	2	904.435247	904.443651	K	A	149	157
PSM	CDVDIRK	2869	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	1-UNIMOD:4	ms_run[1]:scan=1.1.1727.17	13.34452	2	904.436647	904.443651	K	D	285	292
PSM	CDVDIRK	2870	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	1-UNIMOD:4	ms_run[1]:scan=1.1.1720.17	13.15332	2	904.436647	904.443651	K	D	285	292
PSM	EHAALEPR	2871	sp|Q99KI0|ACON_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1694.17	12.44175	2	921.460647	921.466829	R	H	672	680
PSM	DASHPQFK	2872	sp|P85094|ISC2A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1729.18	13.39997	2	928.435447	928.440280	R	E	171	179
PSM	ASEAHCHYVTVK	2873	sp|Q9R0H0|ACOX1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	6-UNIMOD:4	ms_run[1]:scan=1.1.1702.13	12.66063	3	1400.647271	1400.650684	R	V	526	538
PSM	EIRDQER	2874	sp|Q62468|VILI_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1575.14	9.1387	2	944.467447	944.467558	K	G	196	203
PSM	TATAVAHCK	2875	sp|P14131|RS16_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	8-UNIMOD:4	ms_run[1]:scan=1.1.1575.15	9.139533	2	957.461247	957.470200	K	R	18	27
PSM	KLSSAMSAAK	2876	sp|P14152|MDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1695.15	12.46837	2	992.525847	992.532466	R	A	239	249
PSM	AGVLAGHDNR	2877	sp|P62874|GBB1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1682.17	12.1034	2	1008.503647	1008.510091	R	V	305	315
PSM	YKEETIEK	2878	sp|P61255|RL26_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1701.19	12.63797	2	1038.532847	1038.523341	K	M	135	143
PSM	VLGTAGSEEGK	2879	sp|P47199|QOR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1768.19	14.48762	2	1046.518247	1046.524404	K	K	176	187
PSM	KPFDPENTK	2880	sp|Q00898|A1AT5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1763.17	14.34578	2	1074.528247	1074.534575	K	Q	214	223
PSM	NKEEAAEYAK	2881	sp|P62754|RS6_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1650.20	11.22145	2	1151.537447	1151.545868	K	L	202	212
PSM	HHPEDVEPALRK	2882	sp|Q9JII6|AK1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1757.16	14.17608	3	1426.724471	1426.731711	K	T	86	98
PSM	DALQPGR	2883	sp|P70695|F16P2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1796.10	15.26117	2	755.385447	755.392602	K	N	152	159
PSM	ALEATTEHIR	2884	sp|P26039|TLN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1908.6	18.38892	3	1139.584571	1139.593487	R	Q	2145	2155
PSM	IAHVTLNEEK	2885	sp|P28825|MEP1A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1908.8	18.39058	3	1152.609671	1152.613888	K	K	389	399
PSM	HQGVMVGMGQK	2886	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1877.7	17.53167	3	1170.557771	1170.563783	R	D	40	51
PSM	VQVEYKGETK	2887	sp|P63017|HSP7C_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1780.7	14.81365	3	1179.606071	1179.613553	K	S	103	113
PSM	AIADHIR	2888	sp|P14152|MDHC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1775.9	14.67557	2	794.433847	794.439886	K	D	249	256
PSM	FAQTLEK	2889	sp|P54071|IDHP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1931.11	19.03168	2	835.438047	835.443969	R	V	394	401
PSM	LHISPDR	2890	sp|P34884|MIF_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1799.9	15.34483	2	836.443247	836.450451	R	V	88	95
PSM	ASGTNDKPGGPHYILR	2891	sp|Q8CHT0|AL4A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1955.8	19.69625	4	1681.846894	1681.853618	R	W	524	540
PSM	AFEPATGR	2892	sp|Q9JLJ2|AL9A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1880.9	17.61568	2	847.412847	847.418817	K	V	31	39
PSM	AFEPATGR	2893	sp|Q9JLJ2|AL9A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1887.9	17.80977	2	847.412847	847.418817	K	V	31	39
PSM	NVLAESAR	2894	sp|Q9D172|GAL3A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1871.14	17.3707	2	858.450047	858.455930	R	I	102	110
PSM	HHPEDVEPALR	2895	sp|Q9JII6|AK1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1875.13	17.48158	3	1298.629871	1298.636748	K	K	86	97
PSM	FTGNQIAK	2896	sp|Q3TNA1|XYLB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1835.9	16.35928	2	877.459047	877.465767	R	L	186	194
PSM	EAGVQIAGR	2897	sp|Q922D8|C1TC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1963.10	19.9239	2	899.476247	899.482479	K	H	158	167
PSM	GDTNFYGK	2898	sp|Q9EQ20|MMSA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1950.11	19.55742	2	900.392247	900.397747	R	Q	493	501
PSM	LQDAEIAR	2899	sp|P14069|S10A6_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1949.13	19.53102	2	914.475847	914.482145	K	L	48	56
PSM	DDREAQSICER	2900	sp|O35643|AP1B1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	9-UNIMOD:4	ms_run[1]:scan=1.1.1827.13	16.1382	3	1377.592271	1377.594291	K	V	233	244
PSM	MVAAVACAK	2901	sp|Q3ULD5|MCCB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	7-UNIMOD:4	ms_run[1]:scan=1.1.1930.13	19.00528	2	919.457247	919.461944	K	V	425	434
PSM	THSASFFK	2902	sp|O35215|DOPD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1869.16	17.31628	2	923.445847	923.450117	R	F	76	84
PSM	IIAPPERK	2903	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1787.3	15.00715	3	922.552271	922.560002	K	Y	329	337
PSM	NSRPEANEALER	2904	sp|Q9QYB1|CLIC4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1797.14	15.2926	3	1384.661471	1384.669505	K	G	131	143
PSM	IIAPPERK	2905	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1784.14	14.93155	2	922.554447	922.560002	K	Y	329	337
PSM	LPECEAVCGKPK	2906	sp|Q61646|HPT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	4-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.1926.14	18.89295	3	1386.654371	1386.663557	K	H	83	95
PSM	LIAEGTAPR	2907	sp|Q8R0Y6|AL1L1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1956.13	19.72883	2	926.512447	926.518531	R	R	182	191
PSM	QVAQNLDR	2908	sp|Q8CHT0|AL4A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1776.13	14.7067	2	942.481447	942.488293	R	F	296	304
PSM	VNVVEQEK	2909	sp|P17182|ENOA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1797.16	15.29428	2	943.491047	943.497461	K	I	82	90
PSM	ELAQQIQK	2910	sp|P10630|IF4A2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1893.13	17.98063	2	956.525247	956.529095	R	V	112	120
PSM	QNPGMPCR	2911	sp|Q91XE4|ACY3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	7-UNIMOD:4	ms_run[1]:scan=1.1.1825.19	16.0867	2	958.404247	958.411305	R	L	145	153
PSM	LPEGTTPEK	2912	sp|Q921I1|TRFE_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1834.16	16.33705	2	970.491847	970.497127	K	Y	659	668
PSM	AMEAVAAQGK	2913	sp|O70250|PGAM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1820.12	15.9392	2	974.478247	974.485516	K	A	242	252
PSM	HQPTAIIAK	2914	sp|P40142|TKT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1785.15	14.96063	2	977.561047	977.565815	K	T	233	242
PSM	QDQVCIAR	2915	sp|Q149F3|ERF3B_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	5-UNIMOD:4	ms_run[1]:scan=1.1.1949.16	19.53352	2	988.473247	988.476014	K	L	582	590
PSM	HIDCAQVYQNEK	2916	sp|P45376|ALDR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	4-UNIMOD:4	ms_run[1]:scan=1.1.1933.16	19.0917	3	1503.677771	1503.677627	R	E	42	54
PSM	SGINCPIQK	2917	sp|Q9Z0J0|NPC2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	5-UNIMOD:4	ms_run[1]:scan=1.1.1948.15	19.50463	2	1015.507047	1015.512065	K	D	95	104
PSM	MDASASAASVR	2918	sp|Q8CG76|ARK72_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1948.19	19.50797	2	1064.488047	1064.492058	R	A	59	70
PSM	IREEYPDR	2919	sp|A2AQ07|TBB1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1777.6	14.72872	3	1076.520971	1076.525073	K	I	155	163
PSM	VVVTMEHSAK	2920	sp|Q9D0K2|SCOT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1798.7	15.31493	3	1099.560371	1099.569580	K	G	437	447
PSM	VEPVDASGTEK	2921	sp|Q9JLJ2|AL9A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1831.20	16.25643	2	1130.539647	1130.545533	R	A	20	31
PSM	ADGSTQVIDTK	2922	sp|O08749|DLDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1912.19	18.50922	2	1133.552647	1133.556432	K	N	167	178
PSM	NHGVVMPDANK	2923	sp|Q9EQ20|MMSA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1829.20	16.20047	2	1180.560847	1180.565892	K	E	288	299
PSM	TASSVLLHTGQK	2924	sp|Q9JII6|AK1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	17		ms_run[1]:scan=1.1.1947.12	19.47423	3	1240.6708	1240.6770	M	M	2	14
PSM	HVEPGNAAIQEK	2925	sp|Q99KB8|GLO2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1795.21	15.24237	2	1291.648647	1291.652064	R	L	234	246
PSM	VAEDDEDDDVDTK	2926	sp|P26350|PTMA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1859.21	17.03815	2	1464.577247	1464.573993	R	K	91	104
PSM	QEPERNECFLQHK	2927	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	8-UNIMOD:4	ms_run[1]:scan=1.1.1897.14	18.09468	4	1713.785694	1713.789303	K	D	118	131
PSM	RPQPEEGATYEGIQKK	2928	sp|Q8R0Y6|AL1L1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	17		ms_run[1]:scan=1.1.1872.20	17.40387	3	1829.9264	1829.9267	R	E	191	207
PSM	SEQAEPPAAADTHEAGDQNEAEK	2929	sp|P70441|NHRF1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1937.21	19.2085	3	2394.033671	2394.020755	K	S	117	140
PSM	DPELGVK	2930	sp|Q8BFR5|EFTU_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2028.4	21.72398	2	756.394247	756.401770	R	S	228	235
PSM	AGNVIFR	2931	sp|Q9D0K2|SCOT1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2158.5	25.33045	2	775.428447	775.434073	R	K	218	225
PSM	AFEVTAR	2932	sp|Q62468|VILI_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2050.2	22.33017	2	792.405647	792.413003	K	A	530	537
PSM	RGILTLK	2933	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2051.5	22.35702	2	799.522047	799.527973	K	Y	62	69
PSM	AAYNLVR	2934	sp|Q9CQI6|COTL1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2122.7	24.31968	2	805.437247	805.444637	R	D	12	19
PSM	CFGGLQK	2935	sp|Q9R0P3|ESTD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	1-UNIMOD:4	ms_run[1]:scan=1.1.1994.13	20.78277	2	808.384047	808.390159	R	V	11	18
PSM	SPDTFVR	2936	sp|Q99LC5|ETFA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2006.10	21.11983	2	820.402047	820.407918	K	T	140	147
PSM	AVSYLGPK	2937	sp|O08997|ATOX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2103.7	23.79005	2	833.456847	833.464704	K	-	61	69
PSM	SSDILYR	2938	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2120.7	24.26283	2	852.428047	852.434132	R	L	142	149
PSM	IDIVENR	2939	sp|P16460|ASSY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2118.6	24.20527	2	857.454247	857.460681	R	F	266	273
PSM	FVMEQGR	2940	sp|Q9QXD6|F16P1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2017.10	21.42648	2	865.405647	865.411623	R	K	17	24
PSM	SAITPGGLR	2941	sp|Q9CZN7|GLYM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2116.12	24.15355	2	870.486647	870.492316	R	L	417	426
PSM	ACLYAGVK	2942	sp|P15105|GLNA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	2-UNIMOD:4	ms_run[1]:scan=1.1.2109.12	23.95923	2	880.440447	880.447674	R	I	182	190
PSM	DNMFSGSK	2943	sp|P06745|G6PI_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2007.11	21.14912	2	884.363447	884.369817	R	I	82	90
PSM	KLEEEGEQFVK	2944	sp|P32020|NLTP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1000663, ProteinPilot, ]	17		ms_run[1]:scan=1.1.2155.8	25.24808	3	1334.66767064349	1334.67179609254	K	K	443	454
PSM	EAILAIHK	2945	sp|P57780|ACTN4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2085.12	23.29753	2	893.527247	893.533452	R	E	586	594
PSM	QRQEELCLER	2946	sp|Q00724|RET4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	7-UNIMOD:4	ms_run[1]:scan=1.1.2009.9	21.20445	3	1359.651071	1359.656498	R	Q	172	182
PSM	AALCTELK	2947	sp|Q3UNZ8|QORL2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	4-UNIMOD:4	ms_run[1]:scan=1.1.2114.12	24.09737	2	904.463247	904.468804	R	Q	29	37
PSM	TGGVLYADK	2948	sp|Q9D826|SOX_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2005.14	21.09477	2	922.470847	922.475997	K	A	145	154
PSM	ATQEAFMK	2949	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1976.8	20.28332	2	924.431847	924.437503	K	R	323	331
PSM	VIEPGCVR	2950	sp|Q9QYJ0|DNJA2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	6-UNIMOD:4	ms_run[1]:scan=1.1.2011.15	21.26632	2	928.473647	928.480037	K	V	303	311
PSM	FLQPGSQR	2951	sp|P13745|GSTA1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1972.14	20.1793	2	931.481447	931.487565	K	K	197	205
PSM	LYSESLAR	2952	sp|P50396|GDIA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2123.16	24.35443	2	937.480447	937.486896	K	Y	211	219
PSM	AVVGVVAGGGR	2953	sp|P62918|RL8_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2070.12	22.88483	2	940.539847	940.545414	R	I	164	175
PSM	GGPLSDSYR	2954	sp|P00920|CAH2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2073.11	22.96627	2	950.439247	950.445760	K	L	81	90
PSM	AVVGSPHVSTASAVR	2955	sp|Q7TNG8|LDHD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2029.9	21.75613	3	1436.769971	1436.773576	K	E	37	52
PSM	YLTNAYSR	2956	sp|Q9QYB1|CLIC4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2061.12	22.63482	2	986.484047	986.482145	R	D	220	228
PSM	GSGTAEVELK	2957	sp|P52480|KPYM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1967.16	20.04087	2	989.498647	989.502940	K	K	126	136
PSM	MQHNLEQQIQAR	2958	sp|P16546|SPTN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2061.13	22.63565	3	1494.732971	1494.736145	R	N	2304	2316
PSM	SAAEVIAQAR	2959	sp|O08553|DPYL2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2126.15	24.43528	2	1014.539247	1014.545808	K	K	259	269
PSM	FAELQSPNK	2960	sp|Q9D1A2|CNDP2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2125.10	24.4039	2	1032.518447	1032.524010	K	F	365	374
PSM	AVLAESYER	2961	sp|P28271|ACOC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2154.19	25.22877	2	1036.514647	1036.518925	K	I	794	803
PSM	VCALMSCAK	2962	sp|P45376|ALDR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	2-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=1.1.2114.16	24.10072	2	1038.459847	1038.466043	R	H	298	307
PSM	YESLTDPSK	2963	sp|P07901|HS90A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2051.13	22.36703	2	1038.479447	1038.486956	R	L	61	70
PSM	DHENIIIAK	2964	sp|P09103|PDIA1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2060.19	22.6129	2	1051.561447	1051.566209	K	M	418	427
PSM	NTIVTSYNR	2965	sp|Q99KI0|ACON_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2045.18	22.2047	2	1066.537447	1066.540723	K	N	466	475
PSM	KFYEQFSK	2966	sp|P07901|HS90A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2071.19	22.91803	2	1075.532247	1075.533846	K	N	437	445
PSM	KLAPSLMDAK	2967	sp|Q9DCY0|KEG1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2117.14	24.18348	2	1072.589047	1072.595066	K	N	141	151
PSM	SVEAAAELSAK	2968	sp|Q9D0J8|PTMS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2129.14	24.51615	2	1074.551247	1074.555704	K	D	5	16
PSM	EGWVEQDPK	2969	sp|Q64516|GLPK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2147.16	25.02695	2	1086.494047	1086.498189	R	E	50	59
PSM	NQAPPGLYTK	2970	sp|P16460|ASSY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2103.13	23.79507	2	1087.562247	1087.566209	K	T	200	210
PSM	KVINDFVEK	2971	sp|P07758|A1AT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2064.20	22.72475	2	1090.597847	1090.602260	K	G	173	182
PSM	SSPYPTDVAR	2972	tr|E9Q7L0|E9Q7L0_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2130.18	24.54702	2	1091.521447	1091.524738	R	V	463	473
PSM	DAMQYASESK	2973	sp|Q68FD5|CLH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2056.20	22.50418	2	1128.474247	1128.475739	K	D	1536	1546
PSM	RPQPEEGATYEGIQK	2974	sp|Q8R0Y6|AL1L1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2025.19	21.65303	3	1701.831671	1701.832213	R	K	191	206
PSM	CYEMASHLR	2975	sp|P62962|PROF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	1-UNIMOD:4	ms_run[1]:scan=1.1.2015.18	21.37863	2	1165.504047	1165.500849	K	R	128	137
PSM	ITAHLVHELR	2976	sp|Q8BWT1|THIM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2004.9	21.0622	3	1187.670671	1187.677491	R	R	361	371
PSM	EWRPQDAEPCAHPNSR	2977	sp|Q9Z2V4|PCKGC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	10-UNIMOD:4	ms_run[1]:scan=1.1.2078.21	23.11295	3	1948.864571	1948.859842	K	F	390	406
PSM	FCANTCVDCR	2978	sp|P97447|FHL1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	2-UNIMOD:4,6-UNIMOD:4,9-UNIMOD:4	ms_run[1]:scan=1.1.2079.21	23.14025	2	1301.491247	1301.495112	K	K	35	45
PSM	GAVHQLCQSLAGK	2979	sp|Q8BVI4|DHPR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	7-UNIMOD:4	ms_run[1]:scan=1.1.2113.21	24.07698	2	1367.693247	1367.697969	K	N	152	165
PSM	FNQCGTCTEFK	2980	sp|Q9WUU7|CATZ_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	4-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=1.1.2157.20	25.31493	2	1390.563247	1390.564572	K	E	169	180
PSM	SCPTVQHVLVAHR	2981	sp|Q99NB1|ACS2L_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	2-UNIMOD:4	ms_run[1]:scan=1.1.2000.17	20.9555	3	1502.773271	1502.777616	K	T	234	247
PSM	EQTEGEYSSLEHESAK	2982	tr|Q91VA7|Q91VA7_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2077.21	23.08548	3	1822.787471	1822.785717	R	G	164	180
PSM	LEAEAVPEVSEK	2983	sp|Q9CQM9|GLRX3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2364.17	31.03492	2	1299.643847	1299.655812	K	Y	70	82
PSM	LFAEGDTPVPHAR	2984	sp|Q91X91|NADC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2339.8	30.35745	2	1408.720447	1408.709913	K	R	285	298
PSM	TLAGDVHIVR	2985	sp|Q9QZ88|VPS29_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2221.4	27.08695	3	1079.598071	1079.608743	K	G	51	61
PSM	APLVLKD	2986	sp|Q99LX0|PARK7_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2174.8	25.78665	2	754.452047	754.458890	K	-	183	190
PSM	DLAACIK	2987	sp|O88844|IDHC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	5-UNIMOD:4	ms_run[1]:scan=1.1.2238.4	27.55205	2	789.400447	789.405475	K	G	375	382
PSM	VAGILTVK	2988	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2339.3	30.34493	2	799.508847	799.516740	K	G	251	259
PSM	SVDEIIR	2989	sp|P35700|PRDX1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2221.9	27.09113	2	830.443647	830.449782	R	L	152	159
PSM	TEWLDGK	2990	sp|P17742|PPIA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2254.4	27.9924	2	847.405047	847.407583	K	H	119	126
PSM	DSDFLEK	2991	sp|P11930|NUD19_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2240.8	27.60872	2	852.383247	852.386513	K	N	294	301
PSM	SNTHEFVNLVK	2992	sp|P40336|VP26A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2295.6	29.11857	3	1286.660471	1286.661900	K	E	83	94
PSM	VIPELNGK	2993	tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2205.5	26.65368	2	868.496047	868.501818	K	L	218	226
PSM	IRYESLTDPSK	2994	sp|P07901|HS90A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2171.11	25.70323	3	1307.667371	1307.672131	K	L	59	70
PSM	HLDTFLK	2995	sp|O55060|TPMT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2165.7	25.52933	2	872.470247	872.475603	K	G	47	54
PSM	TIAPALVSK	2996	sp|P17182|ENOA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2267.9	28.35282	2	898.543447	898.548768	K	K	72	81
PSM	IIFEDDR	2997	sp|P70349|HINT1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2365.7	31.05023	2	906.441047	906.444697	K	C	31	38
PSM	KFPPDGSAPYGAR	2998	sp|Q9QXD6|F16P1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2196.8	26.40595	3	1361.671571	1361.672800	K	Y	232	245
PSM	ENLQAVLK	2999	tr|E9PV38|E9PV38_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2357.5	30.83693	2	913.515447	913.523282	R	D	367	375
PSM	NLEAIVQK	3000	sp|P06801|MAOX_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2271.6	28.46067	2	913.517047	913.523282	K	I	363	371
PSM	FEEDYVK	3001	sp|Q3UZZ6|ST1D1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2192.14	26.2988	2	928.411847	928.417814	K	K	276	283
PSM	DSQGNLFR	3002	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2240.9	27.60955	2	935.441847	935.446094	K	N	88	96
PSM	RIFSSEHDIFR	3003	sp|P51174|ACADL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2322.7	29.87135	3	1405.703171	1405.710248	R	E	51	62
PSM	LAPSLMDAK	3004	sp|Q9DCY0|KEG1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2333.11	30.18415	2	944.494847	944.500103	K	N	142	151
PSM	IIALDGDTK	3005	sp|P40142|TKT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2275.12	28.5762	2	944.513247	944.517862	R	N	335	344
PSM	ANIIYPGHGPVIHNAEAK	3006	sp|Q99KR3|LACB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2221.16	27.09697	4	1899.990094	1899.995531	K	I	192	210
PSM	EELFVTSK	3007	sp|Q9JII6|AK1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2339.5	30.34995	2	951.486447	951.491313	R	L	73	81
PSM	LSQVAPVLK	3008	sp|Q9DBE0|CSAD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2323.10	29.90195	2	953.585247	953.590967	R	E	434	443
PSM	MPEFYNR	3009	sp|P16460|ASSY_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2365.8	31.05107	2	955.418647	955.422187	R	F	147	154
PSM	ALAVSDLNR	3010	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2280.9	28.71332	2	957.519847	957.524344	K	A	1062	1071
PSM	VINDFVEK	3011	sp|P07758|A1AT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2276.7	28.5998	2	962.505847	962.507297	K	G	174	182
PSM	EPDLSSDIK	3012	sp|A2BIM8|MUP18_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2258.14	28.10955	2	1002.486047	1002.486956	R	E	142	151
PSM	VWNLANCK	3013	sp|P68040|RACK1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	7-UNIMOD:4	ms_run[1]:scan=1.1.2348.14	30.594	2	1003.488647	1003.490936	K	L	176	184
PSM	SCNCLLLK	3014	sp|P17182|ENOA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	2-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=1.1.2288.12	28.93423	2	1006.489847	1006.493973	K	V	336	344
PSM	IVFSPEEAK	3015	sp|Q9Z2I9|SUCB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2359.6	30.8931	2	1018.528447	1018.533512	K	A	121	130
PSM	NCDEFLVK	3016	sp|P28271|ACOC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	2-UNIMOD:4	ms_run[1]:scan=1.1.2371.13	31.2186	2	1023.466847	1023.469532	R	K	49	57
PSM	GVYSTQVGFAGGHTR	3017	sp|Q9D6Y7|MSRA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2200.14	26.52368	3	1535.748671	1535.748090	K	N	85	100
PSM	ENFSCLTR	3018	sp|P14152|MDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	5-UNIMOD:4	ms_run[1]:scan=1.1.2253.13	27.97232	2	1025.457247	1025.460030	K	L	150	158
PSM	GELLEAIKR	3019	sp|P09671|SODM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2287.9	28.90477	2	1027.599047	1027.602595	K	D	115	124
PSM	LEQVLSSMK	3020	tr|Q91VA7|Q91VA7_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2352.13	30.70342	2	1033.543247	1033.547782	K	E	96	105
PSM	RIILLAEGR	3021	sp|P50247|SAHH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2304.12	29.37677	2	1039.646047	1039.650214	R	L	335	344
PSM	LDGNQDLIR	3022	sp|P54071|IDHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2256.12	28.05362	2	1042.537647	1042.540723	K	F	385	394
PSM	KLDPGSEETQTLVR	3023	sp|Q9D8N0|EF1G_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2247.14	27.8056	3	1571.811671	1571.815501	R	E	401	415
PSM	SGKYDLDFK	3024	sp|P17182|ENOA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2231.2	27.36112	3	1071.516371	1071.523676	R	S	254	263
PSM	SLQQLAEER	3025	sp|P16546|SPTN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2295.15	29.12608	2	1072.547247	1072.551287	R	S	1217	1226
PSM	LTEEITYGR	3026	sp|Q8JZZ0|UD3A2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2294.19	29.10202	2	1080.541047	1080.545139	R	S	95	104
PSM	EVNLAVENAK	3027	sp|Q9JLJ2|AL9A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2175.20	25.82527	2	1085.566647	1085.571688	K	A	50	60
PSM	LHIVQVVCK	3028	sp|Q9Z1Q5|CLIC1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	8-UNIMOD:4	ms_run[1]:scan=1.1.2197.17	26.4416	2	1094.624047	1094.627036	K	K	184	193
PSM	WLNENAVEK	3029	sp|P50247|SAHH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2280.15	28.71832	2	1101.541647	1101.545474	K	V	310	319
PSM	RQDLFIVSK	3030	sp|P45376|ALDR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2332.16	30.15993	2	1104.625647	1104.629144	K	L	70	79
PSM	LWCTFHDK	3031	sp|P45376|ALDR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	3-UNIMOD:4	ms_run[1]:scan=1.1.2203.18	26.61065	2	1105.502447	1105.501501	K	S	79	87
PSM	LHVDPENFR	3032	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2298.4	29.2	3	1125.551771	1125.556707	K	L	97	106
PSM	GYSFTTTAER	3033	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2266.19	28.33327	2	1131.517647	1131.519653	R	E	197	207
PSM	RFEEEGNPYYSSAR	3034	sp|Q3ULD5|MCCB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2178.20	25.91087	3	1703.760071	1703.753963	K	L	512	526
PSM	VNVPGSQAQLK	3035	sp|Q02819|NUCB1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2169.19	25.65283	2	1139.625847	1139.629872	K	E	218	229
PSM	VLTVINQTQK	3036	sp|Q6ZWV7|RL35_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2199.20	26.50042	2	1142.661447	1142.665923	R	E	57	67
PSM	LVASAYSIAQK	3037	sp|Q9Z0S1|BPNT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2363.13	31.00135	2	1149.634047	1149.639374	R	A	11	22
PSM	PFFHSLCDK	3038	sp|P10639|THIO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	7-UNIMOD:4	ms_run[1]:scan=1.1.2297.4	29.17208	3	1149.521171	1149.527715	K	Y	40	49
PSM	ATAVMPDGQFK	3039	sp|P35700|PRDX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2366.16	31.08465	2	1163.562047	1163.564495	K	D	17	28
PSM	SIEEAAASCIK	3040	sp|Q9DBK0|ACO12_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	9-UNIMOD:4	ms_run[1]:scan=1.1.2330.16	30.1034	2	1177.566647	1177.564889	K	F	532	543
PSM	VIATFACSGEK	3041	sp|Q9JLJ2|AL9A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	7-UNIMOD:4	ms_run[1]:scan=1.1.2244.17	27.7253	2	1181.574847	1181.575060	R	E	39	50
PSM	DMYVNTIGHR	3042	sp|P42125|ECI1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2225.18	27.20955	2	1204.568247	1204.565892	K	E	178	188
PSM	EQNSPIYISR	3043	sp|O88951|LIN7B_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2318.18	29.7681	2	1205.603647	1205.604051	K	V	112	122
PSM	VLEDNSVPQVK	3044	sp|Q9D051|ODPB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2282.17	28.7759	2	1226.645447	1226.650667	K	D	337	348
PSM	YQAVTATLEEK	3045	sp|P19253|RL13A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2332.20	30.16328	2	1251.626647	1251.634683	K	R	149	160
PSM	ASQRPDVLTTGGGNPIGDK	3046	sp|P24270|CATA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2307.18	29.46648	3	1881.956771	1881.954454	R	L	20	39
PSM	IDEPLEGSEDR	3047	sp|P61979|HNRPK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2203.19	26.61148	2	1258.567447	1258.567725	K	I	423	434
PSM	SKFDNLYGCR	3048	sp|P50247|SAHH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	9-UNIMOD:4	ms_run[1]:scan=1.1.2167.20	25.59687	2	1258.574247	1258.576457	K	E	187	197
PSM	NDDVINSSSYR	3049	sp|Q8BGA8|ACSM5_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2171.21	25.71158	2	1268.561247	1268.563309	R	I	470	481
PSM	MATVYPEPQNK	3050	sp|P06801|MAOX_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2185.20	26.1042	2	1276.609847	1276.612173	K	E	526	537
PSM	ATAGAYIASQTVK	3051	sp|O55234|PSB5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2252.19	27.94963	2	1279.678247	1279.677216	R	K	79	92
PSM	YHSLAPMYYR	3052	sp|P35278|RAB5C_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2354.5	30.75198	3	1299.598871	1299.607028	R	G	83	93
PSM	EQAEAEVASLNR	3053	tr|D3Z6I8|D3Z6I8_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2264.19	28.27783	2	1315.633447	1315.636808	R	R	43	55
PSM	LGTVADCGVPEAR	3054	sp|Q8BWF0|SSDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	7-UNIMOD:4	ms_run[1]:scan=1.1.2331.21	30.13582	2	1343.649847	1343.650350	K	A	75	88
PSM	ASFSQGPINSANR	3055	sp|P97823|LYPA1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2162.20	25.455	2	1347.652447	1347.653127	R	D	150	163
PSM	SVQTTLQTDEVK	3056	sp|Q8BFZ9|ERLN2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2229.20	27.32158	2	1347.675647	1347.688175	K	N	61	73
PSM	EEAQAEIEQYR	3057	sp|Q9CR51|VATG1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2317.19	29.74098	2	1364.620647	1364.620824	K	L	38	49
PSM	AVPREELFVTSK	3058	sp|Q9JII6|AK1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2361.4	30.94018	3	1374.746171	1374.750716	K	L	69	81
PSM	AVDPDSPAEASGLR	3059	sp|P70441|NHRF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2309.18	29.52077	2	1383.666447	1383.663023	R	A	176	190
PSM	STGSVVGQQPFGGAR	3060	sp|Q8CHT0|AL4A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2358.15	30.87217	2	1446.719847	1446.721541	K	A	509	524
PSM	GVAINMVTEEDKR	3061	sp|P60843|IF4A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2304.10	29.3751	3	1460.726171	1460.729328	K	T	370	383
PSM	FSTVTGESGSADTVR	3062	sp|P24270|CATA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2202.21	26.58602	2	1512.712847	1512.705616	R	D	113	128
PSM	ESNTELAEDCEIK	3063	sp|O08677|KNG1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	10-UNIMOD:4	ms_run[1]:scan=1.1.2261.21	28.197	2	1536.657047	1536.661368	K	H	330	343
PSM	KIENCNYAVELGK	3064	sp|Q3V0K9|PLSI_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	5-UNIMOD:4	ms_run[1]:scan=1.1.2290.12	28.9938	2	1536.751447	1536.760629	K	N	458	471
PSM	GQHMSEQFSQVNCLNK	3065	sp|Q61133|GSTT2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	13-UNIMOD:4	ms_run[1]:scan=1.1.2302.16	29.32323	3	1905.848771	1905.846166	K	V	38	54
PSM	EQAGGDATENFEDVGHSTDAR	3066	sp|P56395|CYB5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2318.21	29.7706	3	2204.920871	2204.920647	R	E	53	74
PSM	YTDQSGEEEEDYESEEQLQHR	3067	sp|Q8K1Z0|COQ9_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2317.21	29.74265	3	2600.054171	2600.042279	R	I	77	98
PSM	VAVADYVEPSPR	3068	sp|Q9JLT4|TRXR2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2538.14	35.83768	2	1301.666647	1301.661566	K	G	65	77
PSM	AFAQAQSHIFIEK	3069	sp|Q61838|PZP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2430.12	32.8582	2	1488.781447	1488.772514	K	T	1061	1074
PSM	HGSIIYHPSLLPR	3070	sp|Q8K009|AL1L2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2405.21	32.16762	2	1488.823247	1488.820132	K	H	122	135
PSM	VIDFAVK	3071	sp|Q9DCW4|ETFB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2483.3	34.28808	2	790.454047	790.458890	R	I	13	20
PSM	EALELLK	3072	sp|P17182|ENOA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2575.3	36.85158	2	814.473847	814.480020	K	T	222	229
PSM	SDLLMPR	3073	sp|P00329|ADH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2404.5	32.1264	2	830.425847	830.432024	R	G	115	122
PSM	STRFEEFLQR	3074	sp|Q60597|ODO1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2563.4	36.51482	3	1311.650771	1311.657149	R	K	261	271
PSM	DGLILTSR	3075	sp|Q99LX0|PARK7_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2516.3	35.20982	2	873.485847	873.491982	K	G	149	157
PSM	LAAAFAVSR	3076	sp|Q99JY0|ECHB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2388.7	31.68422	2	904.505647	904.513051	R	M	231	240
PSM	GQVYILGR	3077	sp|P16460|ASSY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2441.6	33.1507	2	904.508647	904.513051	K	E	356	364
PSM	GIAFEDVR	3078	sp|P45952|ACADM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2476.7	34.09997	2	905.455647	905.460681	R	V	249	257
PSM	LVIITAGAR	3079	sp|P00342|LDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2442.5	33.17719	2	912.569247	912.575652	K	M	91	100
PSM	IALLEEAR	3080	sp|P26040|EZRI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2523.9	35.41335	2	913.517647	913.523282	K	R	428	436
PSM	AAAVPVEFK	3081	tr|Q91VA7|Q91VA7_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2415.5	32.43285	2	930.512247	930.517468	K	E	72	81
PSM	DGYAQILR	3082	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2565.8	36.57393	2	934.482047	934.487230	R	D	430	438
PSM	DAQLFIQK	3083	sp|P24270|CATA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2519.7	35.29888	2	961.517447	961.523282	K	K	469	477
PSM	DAQLFIQK	3084	sp|P24270|CATA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2525.11	35.4711	2	961.517447	961.523282	K	K	469	477
PSM	AVLLGPPGAGK	3085	sp|Q9WTP6|KAD2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2391.14	31.77395	2	978.581047	978.586216	R	G	18	29
PSM	NDLMEYAK	3086	sp|P16460|ASSY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2380.13	31.4656	2	982.436847	982.442982	R	Q	158	166
PSM	VVGNPFDSR	3087	sp|P47738|ALDH2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2396.9	31.90982	2	989.488647	989.493044	R	T	349	358
PSM	DSNNLCLHFNPR	3088	sp|P16045|LEG1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	6-UNIMOD:4	ms_run[1]:scan=1.1.2542.7	35.94343	3	1485.674471	1485.678296	K	F	38	50
PSM	NDLAVVDVR	3089	sp|P09405|NUCL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2491.7	34.51563	2	999.539847	999.534909	K	T	336	345
PSM	EDIFYTSK	3090	sp|P70694|DHB5_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2393.8	31.82595	2	1001.469047	1001.470577	R	V	77	85
PSM	DFASCHLAQAPNHVVVSR	3091	sp|Q921I1|TRFE_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	5-UNIMOD:4	ms_run[1]:scan=1.1.2436.11	33.01628	4	2006.972894	2006.974478	K	K	593	611
PSM	DTPGFIVNR	3092	sp|Q61425|HCDH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2565.11	36.57645	2	1017.519847	1017.524344	K	L	213	222
PSM	YNALLAVQK	3093	sp|Q8BVE3|VATH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2450.5	33.40045	2	1018.574447	1018.581131	R	L	450	459
PSM	ELLTTMGDR	3094	sp|Q3THE2|ML12B_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2399.13	31.99513	2	1034.510847	1034.506645	R	F	125	134
PSM	FPQASASDVVVVHGR	3095	sp|Q921H8|THIKA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2446.13	33.29395	3	1567.812071	1567.810690	R	R	30	45
PSM	IFYTTTPVK	3096	sp|Q99KR3|LACB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2417.11	32.49227	2	1068.582647	1068.585548	K	K	274	283
PSM	LPSDVVTSVR	3097	sp|P29758|OAT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2433.12	32.93515	2	1071.589047	1071.592424	K	G	363	373
PSM	ATDFVVPGPGK	3098	sp|O88844|IDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2492.14	34.54937	2	1086.569047	1086.570960	R	V	141	152
PSM	TPVSEDMLGR	3099	sp|P62814|VATB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2384.16	31.57995	2	1103.526647	1103.528109	R	V	121	131
PSM	WSTPSGASWK	3100	sp|Q9DBM2|ECHP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2516.11	35.2165	2	1105.515047	1105.519259	K	T	279	289
PSM	NYEYYASHVPESVK	3101	sp|Q9Z0S1|BPNT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2436.14	33.01878	3	1684.771271	1684.773302	R	N	290	304
PSM	ALHIPESLPR	3102	sp|P16675|PPGB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2506.2	34.92612	3	1131.634571	1131.640043	K	W	343	353
PSM	DAGMQLQGYR	3103	sp|P05202|AATM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2413.13	32.38407	2	1137.521847	1137.523692	R	Y	171	181
PSM	SSEEIESAFR	3104	sp|P16546|SPTN1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2421.18	32.60807	2	1153.521047	1153.525132	K	A	2405	2415
PSM	VVLVTGAGGGLGR	3105	sp|P51660|DHB4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2541.17	35.92462	2	1154.671847	1154.677157	R	A	11	24
PSM	LEQEGLEALR	3106	sp|Q8VCA8|SCRN2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2521.13	35.36058	2	1156.606847	1156.608802	R	G	386	396
PSM	EITALAPSTMK	3107	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2505.17	34.91082	2	1160.607847	1160.611110	K	I	316	327
PSM	LSASEALGSAALPSHSSAISQHSK	3108	sp|Q9CQX8|RT36_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2458.8	33.61855	4	2335.188094	2335.176802	K	G	33	57
PSM	VAQLCDFNPK	3109	sp|Q6IRU5|CLCB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	5-UNIMOD:4	ms_run[1]:scan=1.1.2467.14	33.86173	2	1190.570447	1190.575394	K	S	195	205
PSM	VNTEPLPAIEK	3110	sp|Q9CXN7|PBLD2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2480.13	34.21465	2	1209.656647	1209.660504	K	T	179	190
PSM	GVKPITLELGGK	3111	sp|Q9JLJ2|AL9A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2436.5	33.01126	3	1210.722371	1210.728524	K	S	247	259
PSM	GNYLVDVDGNR	3112	sp|P61922|GABT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2503.12	34.85062	2	1220.579847	1220.578565	R	M	82	93
PSM	AAPGGASPTIFSR	3113	sp|Q9D0S9|HINT2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2463.13	33.75347	2	1230.634647	1230.635686	K	I	46	59
PSM	MVNHFIAEFK	3114	sp|P63017|HSP7C_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2547.2	36.07428	3	1234.611371	1234.616865	R	R	237	247
PSM	ASVGFGGSCFQK	3115	sp|O70475|UGDH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	9-UNIMOD:4	ms_run[1]:scan=1.1.2409.17	32.27515	2	1243.567847	1243.565558	K	D	268	280
PSM	TDYMVGSYGPR	3116	sp|Q99PT1|GDIR1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2523.17	35.42003	2	1244.545647	1244.549573	K	A	142	153
PSM	AVIFCLSADKK	3117	sp|Q9R0P5|DEST_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	5-UNIMOD:4	ms_run[1]:scan=1.1.2458.10	33.62188	2	1250.661847	1250.669294	K	C	35	46
PSM	WGSQAFCNMR	3118	sp|P28271|ACOC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	7-UNIMOD:4	ms_run[1]:scan=1.1.2549.18	36.14155	2	1255.522047	1255.522647	K	I	159	169
PSM	EPLGPALAHELR	3119	sp|P17563|SBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2564.3	36.54192	3	1301.704571	1301.709185	K	Y	449	461
PSM	DTANLVKEDSDV	3120	sp|A2ARV4|LRP2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2435.18	32.99468	2	1304.614247	1304.609590	K	-	4649	4661
PSM	ILYHSSFSVMK	3121	sp|Q3UZZ6|ST1D1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2468.2	33.87853	3	1310.665871	1310.669294	K	E	223	234
PSM	TFIAIKPDGVQR	3122	sp|P15532|NDKA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2434.4	32.95567	3	1343.753171	1343.756135	R	G	7	19
PSM	MGPLINAPHLER	3123	sp|Q9JLJ2|AL9A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2562.15	36.49605	2	1346.713247	1346.712890	R	V	327	339
PSM	VQISPDSGGLPER	3124	sp|Q3U0V1|FUBP2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2435.20	32.99635	2	1353.685647	1353.688844	K	S	179	192
PSM	GISQEQMQEFR	3125	sp|P57780|ACTN4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2434.17	32.96652	2	1351.620647	1351.619049	K	A	762	773
PSM	LQLTDEQLQNR	3126	sp|Q8CC88|VWA8_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2447.17	33.32487	2	1356.700447	1356.699743	K	S	556	567
PSM	AVEAGLSVKPYIK	3127	sp|P28271|ACOC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2466.3	33.82738	3	1373.788571	1373.791852	K	T	456	469
PSM	NPDSQYGELIEK	3128	sp|Q9DBP5|KCY_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2506.18	34.93947	2	1391.655047	1391.656875	K	Y	44	56
PSM	ELAEDGYSGVEVR	3129	sp|P62908|RS3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2508.20	34.99678	2	1422.664647	1422.662688	R	V	28	41
PSM	IEDVTPIPSDSTR	3130	sp|P62264|RS14_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2514.20	35.1667	2	1428.707847	1428.709639	R	R	129	142
PSM	ASSTCQLTFENVK	3131	sp|Q9DBL1|ACDSB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	5-UNIMOD:4	ms_run[1]:scan=1.1.2483.20	34.30227	2	1483.702047	1483.697694	R	V	257	270
PSM	EPITVSSEQMSHFR	3132	sp|P00920|CAH2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2491.11	34.51897	3	1646.772671	1646.772256	R	T	213	227
PSM	AGSDGESIGNCPFSQR	3133	sp|Q9QYB1|CLIC4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	11-UNIMOD:4	ms_run[1]:scan=1.1.2396.21	31.91983	2	1680.718447	1680.716198	K	L	25	41
PSM	YTVQDESHSEWVSCVR	3134	sp|P68040|RACK1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	14-UNIMOD:4	ms_run[1]:scan=1.1.2535.17	35.75632	3	1980.867371	1980.863590	K	F	140	156
PSM	AADKDTCFSTEGPNLVTR	3135	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	7-UNIMOD:4	ms_run[1]:scan=1.1.2477.21	34.13928	2	1980.931047	1980.921105	K	C	585	603
PSM	KYEDICPSTHNMDVPNIK	3136	sp|P63242|IF5A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	6-UNIMOD:4	ms_run[1]:scan=1.1.2484.21	34.33082	3	2160.000671	2159.997975	K	R	68	86
PSM	KVNLAELFK	3137	sp|P99029|PRDX5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2740.2	41.44902	3	1060.622771	1060.628081	K	G	71	80
PSM	AFGFMTR	3138	sp|P61458|PHS_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2618.2	38.04237	2	828.392247	828.395244	R	V	46	53
PSM	VTVPALLR	3139	sp|Q91XE4|ACY3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2761.2	42.02962	2	867.550647	867.554188	R	L	302	310
PSM	VTVPALLR	3140	sp|Q91XE4|ACY3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2755.2	41.86207	2	867.550647	867.554188	R	L	302	310
PSM	VTVPALLR	3141	sp|Q91XE4|ACY3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2767.2	42.19747	2	867.550647	867.554188	R	L	302	310
PSM	DLAGSIIGK	3142	sp|P61979|HNRPK_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2703.2	40.40302	2	872.492247	872.496733	K	G	397	406
PSM	GAVEIIFK	3143	sp|Q99MN9|PCCB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2755.3	41.8629	2	875.507047	875.511654	K	G	469	477
PSM	VLLSALDR	3144	sp|Q922D8|C1TC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2597.4	37.4684	2	885.523047	885.528367	K	L	355	363
PSM	NLLSVAYK	3145	sp|O70456|1433S_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2581.5	37.0209	2	906.511847	906.517468	R	N	42	50
PSM	ARVDEYLAWQHTGLR	3146	sp|Q64471|GSTT1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2676.6	39.65405	4	1813.926494	1813.922366	R	R	93	108
PSM	VDFNVPMK	3147	sp|P09041|PGK2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2647.4	38.85105	2	948.469647	948.473889	R	N	23	31
PSM	APGFAQMLK	3148	sp|P42932|TCPQ_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2667.4	39.40518	2	961.504447	961.505523	K	D	8	17
PSM	FAFDYATK	3149	tr|Q91VA7|Q91VA7_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2642.3	38.70872	2	961.455247	961.454533	K	K	199	207
PSM	AFALDVINSAHER	3150	sp|Q91VM9|IPYR2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2717.4	40.80622	3	1441.728971	1441.731377	K	W	257	270
PSM	AHTMTDDVTFWK	3151	sp|Q68FD5|CLH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2712.3	40.66128	3	1450.651871	1450.655101	K	W	101	113
PSM	AALQELLSK	3152	sp|P62852|RS25_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2717.6	40.80788	2	971.561047	971.565147	R	G	86	95
PSM	AILNYIASK	3153	sp|P30115|GSTA3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2618.3	38.0432	2	991.566047	991.570232	K	Y	70	79
PSM	VPGATMLLAK	3154	sp|Q9EQ20|MMSA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2639.6	38.62585	2	999.576847	999.578688	R	L	214	224
PSM	NLGSVDFPR	3155	sp|Q91XE4|ACY3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2611.10	37.85912	2	1003.505447	1003.508694	R	T	224	233
PSM	AILNYIATK	3156	tr|E9Q6L7|E9Q6L7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2643.13	38.74537	2	1005.582647	1005.585882	R	Y	70	79
PSM	HEMLPANLIQAQR	3157	sp|Q9DCD0|6PGD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2608.13	37.77785	3	1519.793171	1519.792931	R	D	435	448
PSM	DISTLEPLK	3158	sp|Q9EST5|AN32B_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2772.6	42.3403	2	1014.557847	1014.559727	K	R	102	111
PSM	EATWVVDVK	3159	sp|P32020|NLTP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2683.10	39.85688	2	1045.541647	1045.544411	K	N	471	480
PSM	VYDLNEIAK	3160	sp|Q91V76|CK054_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2581.9	37.02425	2	1063.549847	1063.554976	K	V	77	86
PSM	GAEILADTFK	3161	sp|Q9CWS0|DDAH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2752.7	41.78452	2	1063.554047	1063.554976	R	D	150	160
PSM	HDVVFLITK	3162	sp|Q68FD5|CLH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2604.11	37.66637	2	1070.605847	1070.612431	K	Y	270	279
PSM	LGVEFDEITADDRK	3163	sp|P04117|FABP4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2735.8	41.31423	3	1606.783871	1606.783866	K	V	67	81
PSM	DETEFYLGK	3164	sp|O55142|RL35A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2740.15	41.45987	2	1100.502847	1100.502606	R	R	37	46
PSM	LAELEAALQR	3165	sp|P11679|K2C8_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2688.2	39.98738	2	1112.620647	1112.618973	K	A	359	369
PSM	WQNNLLPSR	3166	sp|P62245|RS15A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2616.5	37.99437	2	1126.588847	1126.588342	K	Q	89	98
PSM	NDIAWNFEK	3167	sp|P11352|GPX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2780.12	42.56907	2	1135.528047	1135.529824	R	F	156	165
PSM	NDIAWNFEK	3168	sp|P11352|GPX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2777.15	42.48767	2	1135.528047	1135.529824	R	F	156	165
PSM	TVVTEAGNLLK	3169	sp|Q61207|SAP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2707.11	40.52535	2	1143.650647	1143.649939	K	D	68	79
PSM	YPVNSVNILK	3170	sp|P11983|TCPA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2668.13	39.43742	2	1145.640647	1145.644459	R	A	190	200
PSM	NHYQAEVFSVNFAESEEAKK	3171	sp|P07758|A1AT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2637.15	38.57701	4	2326.093694	2326.086590	K	V	154	174
PSM	HLEINPDHSIIETLR	3172	sp|P07901|HS90A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2734.11	41.2894	3	1785.942671	1785.937347	K	Q	634	649
PSM	GNPAAVCLLER	3173	sp|Q9CXN7|PBLD2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	7-UNIMOD:4	ms_run[1]:scan=1.1.2624.13	38.21353	2	1198.613047	1198.612842	R	T	18	29
PSM	KTQEQLASEMAELTAR	3174	sp|P26041|MOES_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2759.12	41.98172	3	1804.902971	1804.898913	K	I	412	428
PSM	QITVNDLPVGR	3175	sp|Q61171|PRDX2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2706.12	40.49748	2	1210.665647	1210.666986	R	S	140	151
PSM	CAVVDVPFGGAK	3176	sp|P26443|DHE3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	1-UNIMOD:4	ms_run[1]:scan=1.1.2729.10	41.15255	2	1218.606247	1218.606694	K	A	172	184
PSM	VYNIEFNPPK	3177	sp|Q9WTP7|KAD3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2761.15	42.04047	2	1219.622447	1219.623724	R	T	137	147
PSM	VYNIEFNPPK	3178	sp|Q9WTP7|KAD3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2767.15	42.20832	2	1219.622447	1219.623724	R	T	137	147
PSM	LQESLMSVAPR	3179	sp|P61922|GABT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2638.12	38.60258	2	1229.644047	1229.643808	K	G	143	154
PSM	GVLFYGPPGCGK	3180	sp|Q01853|TERA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	10-UNIMOD:4	ms_run[1]:scan=1.1.2738.15	41.40328	2	1250.613047	1250.611779	K	T	513	525
PSM	EGTLPAALVQPR	3181	sp|Q9CQ60|6PGL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2722.17	40.96072	2	1250.696647	1250.698286	K	T	220	232
PSM	QVVDSAYEVIK	3182	sp|P06151|LDHA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2611.17	37.86495	2	1249.651647	1249.655418	K	L	233	244
PSM	WLHGLESQIQSDDYGK	3183	sp|Q62261|SPTB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2714.15	40.72878	3	1874.880971	1874.879892	K	D	1395	1411
PSM	YLAAAFPSACGK	3184	sp|Q9Z2V4|PCKGC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	10-UNIMOD:4	ms_run[1]:scan=1.1.2591.17	37.30915	2	1254.599447	1254.606694	K	T	279	291
PSM	ENIIDLSNANR	3185	sp|A2BIM8|MUP18_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2623.10	38.18383	2	1257.631647	1257.631329	R	C	165	176
PSM	TVLVSEGIVTPR	3186	sp|A2ARV4|LRP2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2719.12	40.87055	2	1269.727247	1269.729252	R	G	2227	2239
PSM	GLCAIAQAESLR	3187	sp|P62908|RS3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	3-UNIMOD:4	ms_run[1]:scan=1.1.2724.13	41.01457	2	1287.659247	1287.660521	R	Y	95	107
PSM	DILVTSEDGITK	3188	sp|Q78JN3|ECI3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2723.14	40.9868	2	1289.669047	1289.671462	K	I	63	75
PSM	MTGLVDEAIDTK	3189	sp|Q64727|VINC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2685.16	39.91718	2	1291.629047	1291.632968	K	S	709	721
PSM	EHALLAYTLGVK	3190	sp|P10126|EF1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2751.9	41.76582	2	1313.733047	1313.734337	R	Q	135	147
PSM	IHVSDQELQSANASVDDSRLEELK	3191	sp|Q02053|UBA1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2723.16	40.98847	4	2682.323694	2682.309667	K	A	807	831
PSM	INDAFLHVMQR	3192	sp|Q3UNZ8|QORL2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2716.5	40.77808	3	1342.677971	1342.681590	K	K	329	340
PSM	AGVNTVTTLVENK	3193	sp|P12970|RL7A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2593.14	37.36386	2	1344.722847	1344.724895	R	K	138	151
PSM	LAGCTVFITGASR	3194	sp|Q2TPA8|HSDL2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	4-UNIMOD:4	ms_run[1]:scan=1.1.2680.17	39.77747	2	1351.696247	1351.691821	K	G	8	21
PSM	AALEALGSCLNNK	3195	sp|Q9CZN7|GLYM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	9-UNIMOD:4	ms_run[1]:scan=1.1.2629.17	38.35534	2	1359.681447	1359.681650	R	Y	83	96
PSM	NALVSHLDGTTPVCEDIGR	3196	sp|Q9CZ13|QCR1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	14-UNIMOD:4	ms_run[1]:scan=1.1.2716.19	40.78977	3	2053.002371	2052.989853	R	S	397	416
PSM	GVEVTVGHEQEEGGKWPYAGTAEAIK	3197	sp|Q9D172|GAL3A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2657.19	39.1446	4	2741.338094	2741.329674	K	A	187	213
PSM	VVDLMAYMASKE	3198	tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	8-UNIMOD:35	ms_run[1]:scan=1.1.2739.17	41.43324	2	1371.647447	1371.641425	R	-	322	334
PSM	VLAVNQENEHLMEDYER	3199	sp|P57780|ACTN4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2649.17	38.91882	3	2087.963771	2087.958219	K	L	285	302
PSM	EGRPSGEAFVELESEDEVK	3200	sp|O35737|HNRH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2717.19	40.81873	3	2105.986871	2105.975309	R	L	50	69
PSM	LYLGHNYVTAIR	3201	sp|Q921I1|TRFE_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2581.7	37.02257	3	1418.761271	1418.767034	R	N	332	344
PSM	RHPDYSVSLLLR	3202	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2595.6	37.41415	3	1454.797271	1454.799397	R	L	361	373
PSM	QFVTPADVVSGNPK	3203	sp|Q3V0K9|PLSI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2726.17	41.07538	2	1457.749647	1457.751444	R	L	350	364
PSM	SQFTITPGSEQIR	3204	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2624.19	38.21855	2	1462.745847	1462.741607	K	A	412	425
PSM	MVDDGSGEVQVWR	3205	sp|Q62468|VILI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2711.19	40.64622	2	1476.668847	1476.666728	K	I	392	405
PSM	FKLEAPDADELPR	3206	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2771.5	42.31128	3	1499.759771	1499.762009	K	S	522	535
PSM	GHQAALGLMEDEQEQAQQLR	3207	sp|Q8VCA8|SCRN2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2710.17	40.61597	3	2251.078571	2251.065143	R	K	361	381
PSM	RNVLAGEVEMSWK	3208	sp|Q62468|VILI_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2711.9	40.63787	3	1517.762771	1517.766048	K	S	146	159
PSM	SGYQQAASEHGLVVIAPDTSPR	3209	sp|Q9R0P3|ESTD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2675.18	39.63568	3	2282.140871	2282.129124	K	G	65	87
PSM	HVTIVVGTSGDTGSAAIESVQGSK	3210	sp|Q80W22|THNS2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2638.18	38.6076	3	2299.176071	2299.165569	K	N	134	158
PSM	HVTIVVGTSGDTGSAAIESVQGSK	3211	sp|Q80W22|THNS2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2636.20	38.55332	3	2299.176071	2299.165569	K	N	134	158
PSM	SLTNDWEEHLAVK	3212	sp|P07901|HS90A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2753.6	41.81083	3	1540.752671	1540.752172	K	H	316	329
PSM	IVLTNPVCTEVGEK	3213	sp|Q9Z0N1|IF2G_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	8-UNIMOD:4	ms_run[1]:scan=1.1.2747.21	41.66053	2	1557.809447	1557.807244	K	I	427	441
PSM	RVIISAPSADAPMFVMGVNHEK	3214	tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	13-UNIMOD:35	ms_run[1]:scan=1.1.2759.19	41.98757	3	2384.214371	2384.198072	K	Y	116	138
PSM	IIEEAPAPGINPEVR	3215	sp|Q99MR8|MCCA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2692.17	40.1104	2	1603.851247	1603.856972	K	R	281	296
PSM	HWPFMVVNDAGRPK	3216	sp|P63017|HSP7C_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2633.12	38.46315	3	1652.822471	1652.824566	K	V	89	103
PSM	LIGPNCPGVINPGECK	3217	sp|Q9WUM5|SUCA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	6-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=1.1.2649.21	38.92216	2	1723.845047	1723.838562	R	I	167	183
PSM	ILDSVGIEADDDRLNK	3218	sp|P99027|RLA2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2629.10	38.3495	3	1771.900271	1771.895208	K	V	26	42
PSM	FAREEIIPVAPEYDK	3219	sp|P45952|ACADM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2746.15	41.62812	3	1775.910371	1775.909401	K	S	55	70
PSM	KVITAFNDGLNHLDSLK	3220	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2763.17	42.09822	3	1884.021671	1884.010512	K	G	67	84
PSM	ILVTLLHTLER	3221	tr|Q80X81|Q80X81_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3027.5	49.48262	2	1306.792247	1306.797272	R	V	362	373
PSM	VNLAELFK	3222	sp|P99029|PRDX5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3187.2	53.9714	2	932.531847	932.533118	K	G	72	80
PSM	FLIDGFPR	3223	sp|Q9DBP5|KCY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3149.4	52.91022	2	963.513447	963.517802	K	N	89	97
PSM	EGWPLDIR	3224	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3027.2	49.47762	2	984.498647	984.502881	K	V	371	379
PSM	EGWPLDIR	3225	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3034.4	49.66977	2	984.498647	984.502881	K	V	371	379
PSM	DVTLGSVLGR	3226	sp|Q9R0H0|ACOX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2996.4	48.62722	2	1015.560447	1015.566209	K	Y	614	624
PSM	VVTALCLLR	3227	sp|Q64462|CP4B1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	6-UNIMOD:4	ms_run[1]:scan=1.1.2982.4	48.24767	2	1043.612447	1043.616136	K	F	465	474
PSM	RAFPAWADTSILSR	3228	sp|Q9EQ20|MMSA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3004.4	48.85287	3	1589.829971	1589.831425	K	Q	88	102
PSM	GWPLYLSTK	3229	sp|O88844|IDHC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3007.4	48.93699	2	1063.569247	1063.570232	K	N	204	213
PSM	LLQDFFNGK	3230	sp|P17156|HSP72_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3000.4	48.73897	2	1080.558047	1080.560395	K	E	352	361
PSM	LLQDFFNGK	3231	sp|P17156|HSP72_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2992.3	48.51788	2	1080.558047	1080.560395	K	E	352	361
PSM	FPLFTAVYK	3232	sp|P13707|GPDA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3182.3	53.83453	2	1084.595247	1084.595718	K	V	319	328
PSM	FVNLFPEVK	3233	sp|P17427|AP2A2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3152.3	52.99627	2	1091.598847	1091.601532	K	A	547	556
PSM	DLAFTLEER	3234	sp|P06801|MAOX_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2992.4	48.51955	2	1092.546447	1092.545139	K	Q	27	36
PSM	YFDLGLPNR	3235	sp|P54071|IDHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3000.5	48.7398	2	1093.551047	1093.555644	K	D	81	90
PSM	TIFAYFSGSK	3236	sp|Q9CQM5|TXD17_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3022.3	49.34462	2	1119.555647	1119.560061	K	D	26	36
PSM	LGDDIDLIVR	3237	sp|O70194|EIF3D_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3048.7	50.0715	2	1127.615247	1127.618639	K	C	365	375
PSM	LAVNMVPFPR	3238	sp|A2AQ07|TBB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3079.8	50.94132	2	1142.625647	1142.627035	K	L	253	263
PSM	TMEEILEGLK	3239	sp|P07759|SPA3K_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3186.3	53.94463	2	1161.596647	1161.595126	K	F	94	104
PSM	DLELLASGVDR	3240	sp|P01027|CO3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3067.6	50.59832	2	1186.617647	1186.619367	K	Y	1417	1428
PSM	AGLILFGNDDR	3241	sp|Q8R0Y6|AL1L1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3039.7	49.8135	2	1189.610847	1189.609137	K	M	275	286
PSM	LSTIALALGVER	3242	sp|Q76MZ3|2AAA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3150.7	52.9417	2	1241.737447	1241.734337	K	T	35	47
PSM	FLASVSTVLTSK	3243	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3005.7	48.88363	2	1251.707847	1251.707454	K	Y	129	141
PSM	IHLFDIDVPGK	3244	sp|Q9JHW2|NIT2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3077.2	50.87993	3	1252.674671	1252.681573	K	I	113	124
PSM	PLPGITVGDIGPK	3245	sp|Q9R0H0|ACOX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3006.9	48.9133	2	1262.721647	1262.723438	K	F	217	230
PSM	GVVFSVTTVDLK	3246	sp|Q9QYB1|CLIC4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3105.9	51.67632	2	1263.707647	1263.707454	K	R	49	61
PSM	ELLLQPVTISR	3247	sp|P59999|ARPC4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3059.11	50.37785	2	1267.745647	1267.749987	K	N	45	56
PSM	GEMMDLQHGSLFLQTPK	3248	sp|P16125|LDHB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3083.13	51.05955	3	1930.935071	1930.928104	K	I	61	78
PSM	TLAMDTILANAR	3249	sp|O88958|GNPI1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3052.14	50.19048	2	1288.670847	1288.680921	K	F	161	173
PSM	AHDGGIYAISWSPDSTHLLSASGDK	3250	sp|O88342|WDR1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3068.14	50.63372	4	2584.236094	2584.219395	K	T	232	257
PSM	MVLVLQQLEDK	3251	sp|Q61133|GSTT2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3156.11	53.11908	2	1314.725247	1314.721724	R	F	139	150
PSM	LCNPPVNAISPTVITEVR	3252	sp|Q9DBM2|ECHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	2-UNIMOD:4	ms_run[1]:scan=1.1.3161.6	53.25471	3	1979.060171	1979.050997	R	N	16	34
PSM	KNDIENILNWNVMQHK	3253	sp|P28271|ACOC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3076.8	50.85683	3	1995.008471	1994.999630	K	N	57	73
PSM	DPEGYFHFIGR	3254	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3001.3	48.76662	3	1336.617071	1336.620036	K	S	452	463
PSM	GAAGALMVYDITR	3255	sp|Q91V41|RAB14_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3027.6	49.48428	2	1336.684447	1336.680921	R	R	83	96
PSM	LIIWDSYTTNK	3256	sp|P29387|GBB4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3009.13	49.0003	2	1352.693047	1352.697617	K	M	79	90
PSM	AEMQQILQGLDK	3257	sp|Q91YI0|ARLY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3062.17	50.46544	2	1372.703447	1372.702051	K	V	58	70
PSM	CQPPDAVVWPQNVDQVSR	3258	sp|Q7TNG8|LDHD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	1-UNIMOD:4	ms_run[1]:scan=1.1.3005.12	48.8878	3	2094.003671	2093.995273	R	V	63	81
PSM	ATSLNSNDVFILK	3259	sp|Q62468|VILI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2995.15	48.60909	2	1420.757647	1420.756195	R	T	537	550
PSM	TGLVFMPGTIQMR	3260	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	6-UNIMOD:35	ms_run[1]:scan=1.1.3078.15	50.91895	2	1465.743647	1465.742142	R	S	129	142
PSM	VLGPLIGVQVPQEK	3261	sp|Q61133|GSTT2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3099.14	51.51462	2	1475.874447	1475.871165	K	V	118	132
PSM	LVAYYTLIGASGQR	3262	sp|P01027|CO3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3071.17	50.72252	2	1510.808647	1510.814378	R	E	531	545
PSM	PSTFAYPAPLEVPK	3263	sp|Q3TXS7|PSMD1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3069.20	50.66765	2	1515.805847	1515.797331	K	E	808	822
PSM	NSTLTFVTMSGELK	3264	sp|Q9DCG6|PBLD1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3116.14	51.98205	2	1526.767847	1526.765045	R	A	98	112
PSM	GCALQCAILSPAFK	3265	sp|P48722|HS74L_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	2-UNIMOD:4,6-UNIMOD:4	ms_run[1]:scan=1.1.3098.14	51.48705	2	1534.771047	1534.763606	R	V	375	389
PSM	VFQPMFNHSIFTSAVSPAAER	3266	tr|D3Z7G8|D3Z7G8_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3185.16	53.92795	3	2335.143671	2335.141937	R	I	27	48
PSM	SHSNQLVTDCISAMNPDTVLR	3267	sp|Q9Z0S1|BPNT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	10-UNIMOD:4	ms_run[1]:scan=1.1.3039.19	49.82352	3	2357.121671	2357.110379	R	V	197	218
PSM	SHSNQLVTDCISAMNPDTVLR	3268	sp|Q9Z0S1|BPNT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	10-UNIMOD:4	ms_run[1]:scan=1.1.3041.20	49.88165	3	2357.121671	2357.110379	R	V	197	218
PSM	SFNRGDVFLLDLGK	3269	sp|Q62468|VILI_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3167.3	53.41562	3	1579.838471	1579.835842	K	L	159	173
PSM	TIQNLASIQSFQIK	3270	sp|Q91XE0|GLYAT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3155.16	53.09433	2	1589.884447	1589.877707	K	H	114	128
PSM	TSSGLELQVVTSVPGR	3271	sp|P47791|GSHR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2988.10	48.42188	2	1628.872047	1628.873350	K	K	279	295
PSM	TSSGLELQVVTSVPGR	3272	sp|P47791|GSHR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2981.20	48.23281	2	1628.872047	1628.873350	K	K	279	295
PSM	SQQEGGILPLLDSPAK	3273	sp|Q6ZQM8|UD17C_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3170.17	53.50995	2	1651.886047	1651.878101	K	G	100	116
PSM	TPDFESTGLYSAMPR	3274	sp|Q9D964|GATM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3087.19	51.18018	2	1670.769447	1670.761022	K	D	155	170
PSM	FATASADGQIFIYDGK	3275	sp|O88342|WDR1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3048.21	50.08317	2	1702.821247	1702.820252	R	T	204	220
PSM	GLVYETSVLDPDEGIR	3276	tr|Q80X68|Q80X68_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3158.20	53.18448	2	1761.891047	1761.878495	K	F	77	93
PSM	QVGYENAGTVEFLVDK	3277	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3091.20	51.29505	2	1767.875847	1767.867930	K	H	301	317
PSM	QNPDIPQLEPSDYLR	3278	sp|Q9DBM2|ECHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3176.20	53.68012	2	1783.880647	1783.874078	R	R	680	695
PSM	TITLEVEPSDTIENVK	3279	tr|A0A0A6YW67|A0A0A6YW67_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2999.21	48.72483	2	1786.927647	1786.920025	K	A	12	28
PSM	GRELPTAFDYVEFTR	3280	sp|P16546|SPTN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3115.9	51.95057	3	1799.887271	1799.884249	K	S	2453	2468
PSM	QFASQANMVGPWIQTK	3281	sp|P57780|ACTN4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3092.21	51.3243	2	1804.898447	1804.893040	R	M	654	670
PSM	VGINYQPPTVVPGGDLAK	3282	sp|P05213|TBA1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3050.21	50.14055	2	1823.989247	1823.978149	K	V	353	371
PSM	SIYGEKFEDENFILK	3283	sp|P17742|PPIA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2997.21	48.66883	2	1830.912247	1830.903981	R	H	77	92
PSM	SLPAGSLISLHIYALHR	3284	sp|Q64462|CP4B1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3062.3	50.45375	4	1847.040094	1847.041753	R	N	398	415
PSM	YVRPGGGFEPNFTLFEK	3285	sp|P11352|GPX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3140.11	52.6572	3	1956.984971	1956.973398	K	C	96	113
PSM	AGVHTFLGIPFAKPPVGPLR	3286	tr|E9PV38|E9PV38_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3181.3	53.80702	4	2073.197294	2073.188751	K	F	55	75
PSM	AVATLQGEGLSVTGIVCHVGK	3287	sp|Q99LB2|DHRS4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	17-UNIMOD:4	ms_run[1]:scan=1.1.3031.14	49.59535	3	2095.115771	2095.109575	R	A	73	94
PSM	VLTPTQVMNRPSSISWDGLDPGK	3288	sp|P70296|PEBP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3189.16	54.03798	3	2497.285571	2497.263509	K	L	40	63
PSM	FAVELEGEQPISVPPSTNHTVYR	3289	sp|Q8CHT0|AL4A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2990.20	48.47895	3	2569.299071	2569.281267	K	G	175	198
PSM	TFVSITPAEVGVLVGK	3290	sp|P62962|PROF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3517.4	63.1878	3	1615.921271	1615.918509	K	D	39	55
PSM	EANNFLWPFK	3291	sp|P14148|RL7_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3496.5	62.60598	2	1264.626647	1264.624058	K	L	225	235
PSM	LLVPYLIEAVR	3292	sp|Q61425|HCDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3574.6	64.82207	2	1284.783847	1284.780559	R	L	222	233
PSM	FFPLEAWQIGK	3293	sp|O35215|DOPD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3552.4	64.19537	2	1334.706447	1334.702309	R	K	100	111
PSM	DMAGLLKPAACTMLVSSLR	3294	sp|Q05920|PYC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	11-UNIMOD:4	ms_run[1]:scan=1.1.3483.6	62.23597	3	2033.056571	2033.047174	K	D	742	761
PSM	EHGGSIVNIIVLLNNGFPTAAHTGAAR	3295	sp|Q99MZ7|PECR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3557.7	64.34192	4	2728.456494	2728.440896	R	E	149	176
PSM	SLYALVQQFATK	3296	sp|P70158|ASM3A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3502.9	62.78257	2	1367.746847	1367.744902	K	D	384	396
PSM	AWNIWADIPAPK	3297	sp|Q9DBF1|AL7A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3518.11	63.22197	2	1380.721847	1380.719021	K	R	98	110
PSM	CLYSLINEAFR	3298	sp|Q9DBM2|ECHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	1-UNIMOD:4	ms_run[1]:scan=1.1.3440.6	61.04725	2	1384.687447	1384.680922	R	I	618	629
PSM	TGEAIVDAALSALR	3299	sp|Q922R8|PDIA6_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3603.7	65.62885	2	1385.751247	1385.751444	R	Q	119	133
PSM	LEGLTDEINFLR	3300	sp|P11679|K2C8_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3425.10	60.64742	2	1418.734647	1418.740545	R	Q	220	232
PSM	LFQVEYAIEAIK	3301	sp|Q9Z2U1|PSA5_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3421.9	60.53512	2	1422.777447	1422.775868	R	L	21	33
PSM	TVCVEMGDVESAF	3302	sp|Q9JLJ2|AL9A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	3-UNIMOD:4	ms_run[1]:scan=1.1.3443.5	61.13017	2	1442.607247	1442.605767	K	-	482	495
PSM	LTAGNALAFLGLER	3303	sp|Q8R519|ACMSD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3601.7	65.57124	2	1444.806847	1444.803814	K	K	319	333
PSM	DVEDEILWVGER	3304	sp|Q62261|SPTB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3479.9	62.1244	2	1458.707047	1458.699074	R	M	1493	1505
PSM	GNLEVLLFTIQSK	3305	sp|Q62261|SPTB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3631.8	66.44155	2	1460.830247	1460.823881	K	M	360	373
PSM	DGETFQLMGLYGR	3306	sp|A2BIM8|MUP18_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3425.11	60.64825	2	1485.692247	1485.692214	K	E	129	142
PSM	VVGVPVALDLITSGR	3307	sp|Q9DBM2|ECHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3571.12	64.74239	2	1494.885447	1494.876979	R	H	140	155
PSM	DIVLVAYGVLGTQR	3308	sp|Q91WR5|AK1CL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3610.8	65.83076	2	1502.853047	1502.845679	K	Y	210	224
PSM	DESSDNFGSFFLR	3309	sp|Q6PB66|LPPRC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3557.16	64.34943	2	1519.661047	1519.657937	K	H	365	378
PSM	LAGFLDLTEQEFR	3310	sp|Q8QZY1|EIF3L_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3542.12	63.91338	2	1537.790047	1537.777659	K	I	475	488
PSM	ALQLGTLFSPAEALK	3311	sp|P42125|ECI1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3544.11	63.97077	2	1557.884447	1557.876644	R	V	192	207
PSM	VINVNLIGTFNVIR	3312	sp|O08756|HCD2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3584.5	65.09877	2	1570.925247	1570.919512	R	L	117	131
PSM	LLGQFTLIGIPPAPR	3313	sp|P38647|GRP75_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3624.12	66.23922	2	1591.952047	1591.944999	K	G	499	514
PSM	VSALDLAVLDQVEAR	3314	sp|Q99KJ8|DCTN2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3481.16	62.18753	2	1597.878447	1597.867536	K	L	269	284
PSM	VVLAYEPVWAIGTGK	3315	sp|P17751|TPIS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3416.15	60.39668	2	1601.891047	1601.881730	K	T	211	226
PSM	LAALADQWQFLVQK	3316	sp|P16546|SPTN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3522.11	63.33685	2	1629.898447	1629.887878	R	S	1633	1647
PSM	EIVLADVIDNDSWR	3317	sp|Q9DCL9|PUR6_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3552.9	64.19953	2	1643.823247	1643.815501	K	L	202	216
PSM	PWEPTFLSMDVDGR	3318	sp|Q9WVM8|AADAT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3506.8	62.89712	2	1648.761047	1648.755543	K	V	241	255
PSM	DFTATFGPLDSLNTR	3319	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3534.16	63.68648	2	1653.812447	1653.799851	K	L	1022	1037
PSM	DIPSDAFTGLDPLGDK	3320	sp|P98078|DAB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3536.17	63.7446	2	1659.808447	1659.799182	K	E	629	645
PSM	LTFFNSTLNTSGLVAQGEALPIPGAHRPGLVTK	3321	sp|Q8R0Y6|AL1L1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3446.12	61.21445	4	3405.869694	3405.840875	K	A	242	275
PSM	AIWNVINWENVTER	3322	sp|P09671|SODM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3599.18	65.523	2	1742.886847	1742.874019	K	Y	203	217
PSM	EYGGLDVLVNNAGIAFK	3323	sp|P48758|CBR1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3632.13	66.47743	2	1778.932847	1778.920300	K	V	80	97
PSM	SLRPGVAIADFVIFPPR	3324	sp|O09173|HGD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3490.5	62.43308	3	1854.056471	1854.051589	K	W	305	322
PSM	SLRPGVAIADFVIFPPR	3325	sp|O09173|HGD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3523.6	63.36147	3	1854.058871	1854.051589	K	W	305	322
PSM	SVSAFAPICNPVLCSWGK	3326	sp|Q9R0P3|ESTD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	9-UNIMOD:4,14-UNIMOD:4	ms_run[1]:scan=1.1.3515.21	63.14598	2	1991.978447	1991.959739	R	K	168	186
PSM	LLAEAVDLCDTWEAMEK	3327	tr|Q91WT7|Q91WT7_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	9-UNIMOD:4	ms_run[1]:scan=1.1.3629.20	66.39173	2	1992.933647	1992.917265	K	C	137	154
PSM	ASAFALQEQPVVNAVIDDATK	3328	sp|Q9D2G2|ODO2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3534.11	63.6823	3	2186.136971	2186.121913	K	E	288	309
PSM	GGCEAIVDTGTSLLVGPVEEVK	3329	sp|P18242|CATD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	3-UNIMOD:4	ms_run[1]:scan=1.1.3468.10	61.82028	3	2229.132671	2229.119865	K	E	286	308
PSM	FLPGAHVFPGGVLDAADSSPDWVR	3330	sp|P11930|NUD19_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3473.15	61.96145	3	2509.257971	2509.239009	R	L	40	64
PSM	FLPGAHVFPGGVLDAADSSPDWVR	3331	sp|P11930|NUD19_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3474.17	61.99065	3	2509.257971	2509.239009	R	L	40	64
PSM	HGLEVIYMIEPIDEYCVQQLK	3332	sp|P07901|HS90A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	16-UNIMOD:4	ms_run[1]:scan=1.1.3599.17	65.52216	3	2576.286071	2576.265483	K	E	515	536
PSM	NFPSSCVLGPEGTPASWTLMDQTGEMR	3333	sp|Q91XE0|GLYAT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	6-UNIMOD:4	ms_run[1]:scan=1.1.3627.14	66.334	3	2967.344471	2967.320114	K	M	203	230
PSM	QEPERNECFLQHK	3334	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:28,8-UNIMOD:4	ms_run[1]:scan=1.1.2200.19	26.52785	3	1697.7662	1696.7622	K	D	118	131
PSM	CCTLPEDQR	3335	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:4	ms_run[1]:scan=1.1.2447.14	33.32236	2	1160.4553	1160.4585	K	L	461	470
PSM	CTTDHISAAGPWLK	3336	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.3013.8	49.1113	2	1538.7247	1538.7182	K	F	592	606
PSM	HQAFEAELHANADR	3337	sp|P16546|SPTN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2046.16	22.23058	3	1607.742671	1607.744067	K	I	1592	1606
PSM	AELFTQSCADLDK	3338	sp|Q62261|SPTB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	8-UNIMOD:4	ms_run[1]:scan=1.1.2646.20	38.8361	2	1497.681447	1496.681710	K	W	1382	1395
PSM	TLADAEGDVFR	3339	sp|Q9EQ20|MMSA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2697.12	40.2404	2	1192.573647	1192.572417	K	G	130	141
PSM	RLYATTSLYSAWDK	3340	sp|P17563|SBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2768.13	42.23448	3	1675.854371	1673.841322	K	Q	398	412
PSM	PVTTPEEIAQVATISANGDK	3341	sp|P63038|CH60_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3137.12	52.5721	3	2040.045971	2040.037515	K	D	161	181
PSM	GDVAFVK	3342	sp|Q921I1|TRFE_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2089.4	23.40377	2	734.389047	734.396290	K	H	219	226
PSM	SDSRDPASDQMK	3343	sp|P24270|CATA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1	ms_run[1]:scan=1.1.1893.21	17.98732	2	1377.5821	1377.5825	M	Q	2	14
PSM	RLCENIAGHLK	3344	sp|P24270|CATA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	3-UNIMOD:4	ms_run[1]:scan=1.1.1973.10	20.20343	3	1309.687571	1309.692489	K	D	458	469
PSM	FPGQLNADLR	3345	sp|A2AQ07|TBB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2642.9	38.71372	2	1129.585847	1129.588007	R	K	242	252
PSM	FPGQLNADLR	3346	sp|A2AQ07|TBB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2640.11	38.65855	2	1129.585847	1129.588007	R	K	242	252
PSM	QLDALNK	3347	sp|Q9JII6|AK1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:28	ms_run[1]:scan=1.1.2651.2	38.96317	2	783.4065	783.4121	K	N	288	295
PSM	KIPIVSSMAEPLVAGPDEK	3348	sp|Q9JIL4|NHRF3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3012.6	49.08445	3	1980.061871	1980.060165	K	G	467	486
PSM	MEGYHKPDQQK	3349	sp|P40142|TKT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1	ms_run[1]:scan=1.1.1858.21	17.01047	2	1401.6279	1401.6342	-	L	1	12
PSM	QASEGPLK	3350	sp|P16858|G3P_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:28	ms_run[1]:scan=1.1.2144.8	24.93558	2	811.4004	811.4071	K	G	262	270
PSM	SDKLPYK	3351	sp|P50247|SAHH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1	ms_run[1]:scan=1.1.2143.13	24.91148	2	891.4630	891.4697	M	V	2	9
PSM	KYEMFAQTLQQSR	3352	sp|Q01853|TERA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2506.13	34.9353	3	1628.802671	1628.798076	R	G	754	767
PSM	YPIEHGIITNWDDMEK	3353	sp|P62737|ACTA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	14-UNIMOD:35	ms_run[1]:scan=1.1.2730.18	41.18648	3	1975.902971	1975.898579	K	I	71	87
PSM	SEVTFTTPAVYIYTSGTTGLPK	3354	sp|O35488|S27A2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3523.13	63.3673	3	2332.203071	2332.183845	R	A	212	234
PSM	EEFQQFAGLLQAGIEK	3355	sp|P47199|QOR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3608.14	65.77825	2	1806.927447	1806.915215	K	G	279	295
PSM	VAPAPAGVFTDIPISNIR	3356	sp|Q8BMF4|ODP2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3410.4	60.213	3	1837.012571	1837.009784	R	R	407	425
PSM	ILEEHSR	3357	sp|A2AUU0-5|METL8-5_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1664.17	11.60548	2	882.450247	882.455930	R	I	190	197
PSM	GPILMELQTYR	3358	sp|P35486|ODPA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3091.9	51.28588	2	1320.686647	1319.690758	K	Y	278	289
PSM	VALVYGQMNEPPGAR	3359	sp|P56480|ATPB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2702.21	40.39007	2	1601.808647	1600.803162	K	A	265	280
PSM	VIVVGNPANTNCLTASK	3360	sp|P14152|MDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	12-UNIMOD:4	ms_run[1]:scan=1.1.2688.8	40.0024	2	1757.907247	1756.914169	K	S	126	143
PSM	KLSSAMSAAK	3361	sp|P14152|MDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1696.5	12.48833	3	992.523371	992.532466	R	A	239	249
PSM	FYAYNPLAGGLLTGK	3362	sp|Q8CG76|ARK72_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3441.5	61.07902	2	1583.839647	1583.834780	R	Y	230	245
PSM	REDLLNNVAR	3363	sp|P61922|GABT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2167.4	25.58352	3	1198.641971	1198.641834	K	V	401	411
PSM	AGKPVLHYFNAR	3364	sp|P10648|GSTA2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1	ms_run[1]:scan=1.1.2508.6	34.9851	3	1413.7496	1413.7512	M	G	2	14
PSM	SQEQLAAELAEYTAK	3365	sp|P26040|EZRI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	17		ms_run[1]:scan=1.1.3096.7	51.42591	3	1650.8202	1650.8092	K	I	413	428
PSM	IALLEEAR	3366	sp|P26040|EZRI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2517.3	35.23837	2	913.517647	913.523282	K	R	428	436
PSM	VISSIEQK	3367	sp|P61982|1433G_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1885.11	17.7557	2	902.501647	902.507297	R	T	62	70
PSM	GGIMLPEK	3368	sp|Q64433|CH10_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2302.4	29.31322	2	843.446247	843.452425	K	S	29	37
PSM	LIINSLYK	3369	sp|P08113|ENPL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2731.2	41.20037	2	962.574447	962.580068	K	N	88	96
PSM	VISLSGEHSIIGR	3370	sp|P08228|SODC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2538.3	35.82852	3	1366.752671	1366.756864	R	T	104	117
PSM	EGSSIGAIDSR	3371	sp|Q9CZU6|CISY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2090.18	23.4435	2	1090.521447	1090.525467	R	L	223	234
PSM	QKPITPETAEK	3372	sp|P60766|CDC42_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:28	ms_run[1]:scan=1.1.2024.19	21.62537	2	1223.6323	1223.6392	K	L	134	145
PSM	CSGIASAAATAVEVAR	3373	sp|Q91X91|NADC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.3465.12	61.73978	2	1515.7443	1515.7346	R	S	111	127
PSM	SGSLEEVPNVGVNK	3374	sp|Q9CY64|BIEA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2520.19	35.33737	2	1427.724647	1427.725623	K	N	234	248
PSM	ASEEAFVK	3375	sp|Q6IRU5-2|CLCB-2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1956.11	19.72717	2	879.427247	879.433798	R	E	156	164
PSM	FASCFYGPFR	3376	sp|P10518|HEM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	4-UNIMOD:4	ms_run[1]:scan=1.1.2999.6	48.71232	2	1250.549647	1250.554265	K	D	200	210
PSM	TKPADMVIEAYGHGQR	3377	sp|Q9Z2Y8|PLPHP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2377.12	31.38202	3	1771.873871	1771.867553	K	T	48	64
PSM	SSMTFLTR	3378	sp|Q99LF4|RTCB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2487.4	34.40032	2	941.461247	941.464052	R	Q	322	330
PSM	AAVPSAVHLPR	3379	sp|Q3UFF7|LYPL1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1	ms_run[1]:scan=1.1.2751.5	41.75913	2	1158.6473	1158.6504	M	C	2	13
PSM	GFGHIGIAVPDVYSACK	3380	sp|Q9CPU0|LGUL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	16-UNIMOD:4	ms_run[1]:scan=1.1.3000.7	48.74147	3	1789.882871	1789.882141	R	R	124	141
PSM	IGPFEVESALIEHPAVVESAVVSSPDPIRGEVVK	3381	sp|Q80W40|ACSM4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3492.19	62.50198	4	3557.901294	3555.882465	R	A	482	516
PSM	VLEDSDLK	3382	sp|P20029|BIP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2043.11	22.14325	2	918.472647	917.470577	K	K	346	354
PSM	EALLQASR	3383	sp|P26041|MOES_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2051.8	22.35952	2	886.479647	886.487230	K	D	401	409
PSM	TASGSSVTSLEGTR	3384	sp|Q62433|NDRG1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.2125.19	24.41142	2	1352.650447	1351.657937	R	S	328	342
PSM	QVVVCGYGEVGK	3385	sp|Q68FL4|SAHH3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17	5-UNIMOD:4	ms_run[1]:scan=1.1.2394.21	31.86515	2	1294.632247	1293.638722	K	G	396	408
PSM	NFLASQVPFPSR	3386	sp|O08756|HCD2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.3058.4	50.3457	2	1363.705447	1361.709185	R	L	215	227
PSM	HITDEADR	3387	sp|Q6IRU2|TPM4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1631.10	10.69687	2	955.439447	955.435923	K	K	117	125
PSM	HVVFGK	3388	sp|P17742|PPIA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1729.8	13.39163	2	685.384847	685.391145	K	V	126	132
PSM	AGSALNR	3389	sp|Q99KI0|ACON_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1620.6	10.38432	2	687.360647	687.366387	R	M	768	775
PSM	VLSGEDK	3390	tr|Q91VB8|Q91VB8_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	16		ms_run[1]:scan=1.1.1633.8	10.74283	2	746.3733	746.3805	M	S	2	9
PSM	HNLLASK	3391	sp|Q62261|SPTB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1699.14	12.57882	2	781.437447	781.444637	K	E	1479	1486
PSM	TSYAQHQQVR	3392	sp|P97351|RS3A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1651.11	11.2419	3	1216.585571	1216.594884	K	Q	153	163
PSM	SPEDLEK	3393	sp|P06745|G6PI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1768.12	14.48177	2	816.378447	816.386513	K	L	455	462
PSM	TIAPCQK	3394	sp|P38647|GRP75_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	5-UNIMOD:4	ms_run[1]:scan=1.1.1688.7	12.26392	2	816.409447	816.416374	R	A	362	369
PSM	QASEGPLK	3395	tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1723.13	13.23178	2	828.426647	828.434132	K	G	262	270
PSM	QASEGPLK	3396	tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1716.7	13.04023	2	828.426647	828.434132	K	G	262	270
PSM	LVGGTTPGK	3397	sp|Q9WUM5|SUCA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1749.12	13.94815	2	828.463247	828.470518	K	G	82	91
PSM	EHGHLEK	3398	sp|Q9D2R0|AACS_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1562.10	8.778033	2	848.414047	848.414066	K	L	216	223
PSM	VLQEHVK	3399	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1661.16	11.52103	2	851.478847	851.486502	K	S	527	534
PSM	VLQEHVK	3400	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1654.12	11.3257	2	851.478847	851.486502	K	S	527	534
PSM	YIQAACK	3401	sp|Q68FD5|CLH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	6-UNIMOD:4	ms_run[1]:scan=1.1.1718.12	13.09738	2	852.411447	852.416374	K	T	731	738
PSM	LHDALSAK	3402	sp|P97807|FUMH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1705.14	12.74508	2	853.459647	853.465767	K	S	211	219
PSM	RVESQLK	3403	sp|P05202|AATM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	16		ms_run[1]:scan=1.1.1617.11	10.30492	2	858.4835	858.4918	K	I	303	310
PSM	EFVTHTK	3404	sp|Q9CPY7|AMPL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1665.15	11.63168	2	860.433047	860.439218	R	W	470	477
PSM	VTTHPLAK	3405	sp|Q99LX0|PARK7_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1656.9	11.37777	2	865.495047	865.502152	K	D	123	131
PSM	TGHAEVVR	3406	sp|Q9D6Y7|MSRA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1607.12	10.03353	2	867.448247	867.456265	K	V	111	119
PSM	HLNLSGNK	3407	sp|O35381|AN32A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1688.12	12.26808	2	881.465247	881.471915	K	I	92	100
PSM	VLNEEER	3408	sp|P24270|CATA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1726.17	13.31717	2	887.427247	887.434861	K	K	450	457
PSM	AGGLATTGDK	3409	sp|Q9QXD6|F16P1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1687.18	12.24505	2	889.445647	889.450511	K	D	292	302
PSM	HHVLHDQNVDK	3410	sp|Q60597|ODO1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1600.10	9.833283	3	1340.649671	1340.658546	R	R	687	698
PSM	ADAEVLRK	3411	sp|P48036|ANXA5_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1705.15	12.74592	2	900.495047	900.502881	R	A	17	25
PSM	KCDVLNR	3412	sp|Q9DB29|IAH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	2-UNIMOD:4	ms_run[1]:scan=1.1.1691.14	12.35453	2	903.451647	903.459636	R	G	46	53
PSM	MKGDYHR	3413	sp|P62259|1433E_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1571.15	9.029217	2	905.412647	905.417771	K	Y	124	131
PSM	VHLTDAEK	3414	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	16		ms_run[1]:scan=1.1.1736.16	13.59335	2	911.4649	911.4707	M	A	2	10
PSM	YDSTHYK	3415	sp|Q9JII6|AK1A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1638.11	10.88712	2	912.389847	912.397747	R	E	135	142
PSM	MAEHSHCSLGIK	3416	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	7-UNIMOD:4	ms_run[1]:scan=1.1.1767.16	14.45712	3	1368.620471	1368.627840	K	A	230	242
PSM	LQTCCDK	3417	sp|P07724|ALBU_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	4-UNIMOD:4,5-UNIMOD:4	ms_run[1]:scan=1.1.1617.13	10.30658	2	923.377247	923.384088	K	P	299	306
PSM	ATAEEISSK	3418	sp|Q9CQ62|DECR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1709.16	12.85623	2	934.453847	934.460741	K	T	98	107
PSM	YAEEDRR	3419	sp|P38647|GRP75_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1577.15	9.196417	2	937.419847	937.425359	K	K	568	575
PSM	EDAANNYAR	3420	sp|P05213|TBA1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1731.17	13.45433	2	1022.436847	1022.441737	K	G	97	106
PSM	EVQQGGPADK	3421	sp|Q9JIL4|NHRF3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1596.20	9.7278	2	1027.485847	1027.493438	K	A	405	415
PSM	LITEEASKR	3422	sp|Q9D6R2|IDH3A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1747.18	13.89808	2	1045.570247	1045.576774	K	I	170	179
PSM	SGQASAKPNLR	3423	sp|Q9DBM2|ECHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1659.20	11.46918	2	1127.597447	1127.604720	K	F	349	360
PSM	TGSQGQCTQVR	3424	sp|P62858|RS28_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	7-UNIMOD:4	ms_run[1]:scan=1.1.1635.21	10.80747	2	1220.547047	1220.556784	R	V	21	32
PSM	EANQQQQFNR	3425	sp|P16546|SPTN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1749.21	13.95565	2	1261.579247	1261.579962	R	N	676	686
PSM	VDCTANTNTCNK	3426	sp|P27773|PDIA3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	3-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.1644.20	11.05293	2	1396.561447	1396.571113	K	Y	83	95
PSM	TPVLLHDHNER	3427	sp|Q99JW2|ACY1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1800.6	15.3706	4	1329.671294	1329.678948	R	L	368	379
PSM	LIEYCHSK	3428	sp|P45376|ALDR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	5-UNIMOD:4	ms_run[1]:scan=1.1.1784.6	14.92488	3	1048.493171	1048.501166	K	G	196	204
PSM	HVAFLK	3429	sp|Q91XE4|ACY3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1914.6	18.55307	2	713.416247	713.422445	K	S	291	297
PSM	SVTAPYK	3430	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1827.6	16.13237	2	764.401047	764.406855	K	Y	534	541
PSM	NSPLVSR	3431	sp|P08249|MDHM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1806.12	15.54463	2	771.417447	771.423902	K	L	46	53
PSM	TVHTEWTQR	3432	sp|Q8R146|APEH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1851.9	16.80653	3	1156.556171	1156.562521	R	D	45	54
PSM	RIHAEGLGYR	3433	sp|Q3TNA1|XYLB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1832.7	16.27352	3	1170.615671	1170.625790	K	V	435	445
PSM	VVVVGCR	3434	sp|P47199|QOR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	6-UNIMOD:4	ms_run[1]:scan=1.1.1896.9	18.06228	2	787.432047	787.437444	R	G	245	252
PSM	VHSEVSSLDSR	3435	sp|Q9R0X4|ACOT9_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1820.5	15.93335	3	1214.582471	1214.589129	R	E	373	384
PSM	HLPESLK	3436	sp|Q9DCY0|KEG1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1822.10	15.9943	2	822.463047	822.459953	K	V	20	27
PSM	IAQAQGLK	3437	sp|Q9D0S9|HINT2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1781.12	14.84583	2	827.479047	827.486502	K	D	121	129
PSM	SVEETLR	3438	sp|P20108|PRDX3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1900.12	18.17617	2	832.424247	832.429047	R	L	209	216
PSM	ANFTVQR	3439	sp|Q9DCY0|KEG1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1944.10	19.38967	2	834.429247	834.434801	K	M	267	274
PSM	QVEIAQR	3440	sp|P16460|ASSY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1810.10	15.65622	2	842.454047	842.461016	R	E	102	109
PSM	QVEIAQR	3441	sp|P16460|ASSY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1816.11	15.82502	2	842.454047	842.461016	R	E	102	109
PSM	ELNMGQR	3442	sp|P45952|ACADM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1857.12	16.97508	2	846.395447	846.401786	K	C	237	244
PSM	DGSVAIASK	3443	sp|Q9D0K2|SCOT1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1845.16	16.64525	2	846.436647	846.444697	K	P	177	186
PSM	VISELNGK	3444	tr|A0A5F8MPY2|A0A5F8MPY2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1923.10	18.80565	2	858.474247	858.481083	K	N	42	50
PSM	HHPEDVEPALR	3445	sp|Q9JII6|AK1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1882.9	17.671	3	1298.629871	1298.636748	K	K	86	97
PSM	HTNYTMEHIR	3446	sp|P57780|ACTN4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1809.13	15.63045	3	1300.590371	1300.598254	K	V	725	735
PSM	NYLSQPR	3447	sp|P62814|VATB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1952.13	19.61535	2	876.438047	876.445366	R	L	38	45
PSM	SNPTLNEYHTR	3448	sp|Q00623|APOA1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1900.17	18.18033	3	1330.621871	1330.626578	K	A	206	217
PSM	AIVQEATR	3449	sp|Q8CHT0|AL4A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1828.15	16.1681	2	886.479847	886.487230	K	M	487	495
PSM	TINELGEK	3450	sp|Q9D2G2|ODO2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1912.14	18.50505	2	902.464447	902.470912	R	A	347	355
PSM	TIEAEAAHGTVTR	3451	sp|P54071|IDHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1913.10	18.52902	3	1354.680071	1354.684093	K	H	341	354
PSM	FLEQQNK	3452	tr|E9Q0F0|E9Q0F0_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1805.12	15.51645	2	905.454047	905.460681	R	V	125	132
PSM	VGFGQCAGK	3453	sp|P35505|FAAA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	6-UNIMOD:4	ms_run[1]:scan=1.1.1897.15	18.09552	2	922.427247	922.433087	R	V	403	412
PSM	KFDDFQK	3454	sp|P16546|SPTN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1890.15	17.89845	2	926.445447	926.449782	K	D	1132	1139
PSM	ELSDIAHR	3455	tr|A6ZI46|A6ZI46_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1899.15	18.15153	2	939.472647	939.477394	K	I	70	78
PSM	LSEELSGGR	3456	sp|Q99JY9|ARP3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1952.16	19.61785	2	946.467247	946.471974	K	L	349	358
PSM	SLEQSGSLK	3457	sp|Q99KP3|CRYL1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1851.15	16.81153	2	947.494247	947.492375	K	G	55	64
PSM	FTTGDAMSK	3458	sp|Q9CQI6|COTL1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1957.19	19.76242	2	956.425447	956.427332	R	R	64	73
PSM	EQAVTLAQK	3459	sp|Q9Z2I9|SUCB1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1923.18	18.81232	2	986.533647	986.539660	K	M	217	226
PSM	DSETGENIR	3460	sp|P38647|GRP75_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1774.19	14.6562	2	1019.446847	1019.451967	K	Q	626	635
PSM	EGVHGGLINK	3461	sp|P62962|PROF1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1813.16	15.74515	2	1022.541447	1022.550893	K	K	117	127
PSM	CATITPDEK	3462	sp|O88844|IDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:4	ms_run[1]:scan=1.1.1835.18	16.3668	2	1033.468847	1033.475011	K	R	73	82
PSM	IYDQVQSGK	3463	sp|Q9R0H0|ACOX1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1850.16	16.78463	2	1036.511647	1036.518925	K	L	438	447
PSM	NVTAIQGPGGK	3464	sp|Q9D6R2|IDH3A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1959.20	19.81998	2	1040.558047	1040.561458	R	W	67	78
PSM	VLGTAGSEEGK	3465	sp|P47199|QOR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1774.20	14.65703	2	1046.518247	1046.524404	K	K	176	187
PSM	DYCVTANSK	3466	sp|P06151|LDHA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	3-UNIMOD:4	ms_run[1]:scan=1.1.1925.18	18.86813	2	1056.450447	1056.454610	K	L	82	91
PSM	VIEEGSPAEK	3467	sp|Q9JIL4|NHRF3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1789.21	15.07683	2	1057.523247	1057.529155	R	A	37	47
PSM	YLDRDLNR	3468	sp|Q91XE4|ACY3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1915.18	18.59045	2	1063.537647	1063.541057	R	S	64	72
PSM	INGCAIQCR	3469	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	4-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.1906.16	18.34263	2	1090.500047	1090.501183	R	V	369	378
PSM	HNYYTSISK	3470	sp|O70250|PGAM2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1873.19	17.43102	2	1111.526647	1111.529824	K	D	130	139
PSM	ISNAQNAELR	3471	sp|Q8VCT3|AMPB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1860.20	17.06505	2	1114.564647	1114.573085	K	L	563	573
PSM	AIDVEQGQTR	3472	sp|P35505|FAAA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1918.17	18.6721	2	1115.555247	1115.557101	K	T	372	382
PSM	STTTGHLIYK	3473	sp|P10126|EF1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1873.6	17.42017	3	1119.585071	1119.592424	K	C	21	31
PSM	MEGANIQPNR	3474	sp|Q6PB66|LPPRC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1963.20	19.93223	2	1128.533847	1128.534591	K	V	187	197
PSM	SSSAPVASPNVR	3475	sp|Q05920|PYC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1954.20	19.67782	2	1170.595447	1170.599300	R	R	19	31
PSM	RFPGYDSESK	3476	sp|P47962|RL5_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1933.21	19.09588	2	1184.540447	1184.546202	K	E	179	189
PSM	HLIPAANTGESK	3477	sp|P62259|1433E_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1870.21	17.34853	2	1236.644047	1236.646250	K	V	107	119
PSM	VQEVQQVSTNK	3478	sp|P19096|FAS_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1829.21	16.2013	2	1258.645447	1258.651730	R	R	479	490
PSM	HEQNIDCGGGYVK	3479	sp|P14211|CALR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	7-UNIMOD:4	ms_run[1]:scan=1.1.1907.21	18.37417	2	1475.645647	1475.646327	K	L	99	112
PSM	NIIHGSDSVESAEK	3480	sp|Q01768|NDKB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1955.21	19.7071	2	1484.710247	1484.710701	R	E	115	129
PSM	KPMVLGHEAAGTVTK	3481	sp|Q64442|DHSO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1903.16	18.2617	3	1537.827671	1537.828648	K	V	64	79
PSM	EASTIHQCVETESR	3482	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	8-UNIMOD:4	ms_run[1]:scan=1.1.1845.21	16.64942	3	1645.734071	1645.736599	K	E	200	214
PSM	QEPERNECFLQHK	3483	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	8-UNIMOD:4	ms_run[1]:scan=1.1.1899.20	18.1557	3	1713.788471	1713.789303	K	D	118	131
PSM	VGNIGQTNYASSK	3484	sp|P50171|DHB8_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2016.21	21.40847	2	1337.663647	1337.657543	K	A	159	172
PSM	SLVSVTK	3485	sp|P11499|HS90B_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1972.4	20.17095	2	732.431447	732.438155	K	E	532	539
PSM	SAQLGFK	3486	sp|O08749|DLDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2027.6	21.69785	2	749.399847	749.407189	K	T	60	67
PSM	VLAAVYK	3487	tr|A6ZI46|A6ZI46_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2098.4	23.64955	2	762.457447	762.463976	K	A	264	271
PSM	EGDIAIR	3488	sp|Q8K0L3|ACSM2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1989.11	20.64248	2	772.401647	772.407918	K	V	408	415
PSM	VLDGLNR	3489	sp|Q91WR5|AK1CL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2101.5	23.73285	2	785.434047	785.439552	K	N	295	302
PSM	LSDADLR	3490	sp|Q64462|CP4B1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1988.8	20.6123	2	788.398647	788.402832	K	A	300	307
PSM	SISKEEILER	3491	sp|Q9DBM2|ECHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2102.7	23.76223	3	1202.642771	1202.650667	R	C	608	618
PSM	AGLLDGDR	3492	sp|Q9JIL4|NHRF3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2123.6	24.3461	2	815.407647	815.413731	K	V	47	55
PSM	DGLEMEK	3493	sp|P63028|TCTP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2019.11	21.48173	2	820.360047	820.363669	K	C	165	172
PSM	EEFRPSAPYR	3494	sp|P61922|GABT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2123.8	24.34777	3	1250.609471	1250.604386	K	I	368	378
PSM	KEEELQAALAR	3495	sp|O08638|MYH11_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2156.6	25.27492	3	1256.669471	1256.672465	K	L	1088	1099
PSM	VGEVIVTK	3496	sp|P63038|CH60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2040.9	22.05863	2	843.499247	843.506569	K	D	345	353
PSM	ATADNLIK	3497	sp|P42125|ECI1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2005.12	21.0931	2	844.459847	844.465432	K	Q	248	256
PSM	SIEQLEK	3498	sp|P13707|GPDA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1970.9	20.1196	2	845.444447	845.449448	K	E	283	290
PSM	TTADILSK	3499	sp|Q9WVM8|AADAT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2055.9	22.468	2	847.459447	847.465098	R	A	21	29
PSM	SSDILYR	3500	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2133.13	24.62665	2	852.428047	852.434132	R	L	142	149
PSM	ELNITAAK	3501	sp|P62082|RS7_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2094.8	23.54445	2	858.472647	858.481083	R	E	42	50
PSM	GTLDPVEK	3502	sp|P63017|HSP7C_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1989.12	20.64332	2	857.444047	857.449448	R	A	312	320
PSM	EGPEGFAR	3503	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1996.13	20.8391	2	861.392647	861.398081	R	A	548	556
PSM	AVLHVALR	3504	sp|P06745|G6PI_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2151.11	25.13643	2	877.544247	877.549771	R	N	97	105
PSM	SQLLGSAHEVQR	3505	sp|P16546|SPTN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1971.13	20.15077	3	1323.688571	1323.689512	R	F	1226	1238
PSM	FAQLCEK	3506	tr|A9R9W0|A9R9W0_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	5-UNIMOD:4	ms_run[1]:scan=1.1.2000.15	20.95383	2	894.420447	894.426939	R	H	152	159
PSM	ADIDVSGPK	3507	tr|E9Q616|E9Q616_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2052.11	22.38888	2	900.459847	900.455262	K	V	1404	1413
PSM	EDMAALEK	3508	sp|P05213|TBA1B_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2084.16	23.27292	2	905.410447	905.416433	R	D	423	431
PSM	SQWLNEK	3509	sp|P10649|GSTM1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2077.14	23.07965	2	903.440247	903.445031	R	F	44	51
PSM	SQLETSLK	3510	sp|Q8CG76|ARK72_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1984.11	20.50327	2	904.480847	904.486562	R	R	129	137
PSM	LLVSENSR	3511	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1979.13	20.36765	2	916.492247	916.497795	K	E	181	189
PSM	ATQEAFMK	3512	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1986.14	20.56152	2	924.431847	924.437503	K	R	323	331
PSM	SCEEFMK	3513	sp|P12658|CALB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	2-UNIMOD:4	ms_run[1]:scan=1.1.2003.11	21.03557	2	929.356647	929.362290	K	T	99	106
PSM	YLAEVACGDDRK	3514	sp|P68254|1433T_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	7-UNIMOD:4	ms_run[1]:scan=1.1.2004.15	21.0672	3	1395.642071	1395.645264	R	Q	128	140
PSM	FSELTSEK	3515	sp|P80316|TCPE_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1989.17	20.6475	2	939.451647	939.454927	R	L	345	353
PSM	EVGVALQEK	3516	sp|P45376|ALDR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2102.15	23.76892	2	971.521847	971.528761	K	L	54	63
PSM	EVGVALQEK	3517	sp|P45376|ALDR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2109.16	23.96257	2	971.521847	971.528761	K	L	54	63
PSM	AGFAGDDAPR	3518	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1983.17	20.48055	2	975.437647	975.441009	K	A	19	29
PSM	QYVYNVAK	3519	sp|Q9JHI5|IVD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2110.10	23.98495	2	983.502647	983.507632	R	A	339	347
PSM	YGMGTSVER	3520	sp|P35486|ODPA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2021.15	21.53942	2	998.448447	998.449130	R	A	227	236
PSM	LITEDVQGK	3521	sp|P97351|RS3A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2076.17	23.05438	2	1001.534047	1001.539326	K	N	86	95
PSM	GNSMQEALR	3522	sp|P97328|KHK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2001.17	20.98385	2	1004.465247	1004.470929	K	F	271	280
PSM	GNSMQEALR	3523	sp|P97328|KHK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1995.14	20.81168	2	1004.465247	1004.470929	K	F	271	280
PSM	VGDYGSLSGR	3524	sp|Q9WUU7|CATZ_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2118.16	24.2136	2	1009.485247	1009.482873	R	E	192	202
PSM	SAAEVIAQAR	3525	sp|O08553|DPYL2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2133.17	24.62998	2	1014.539247	1014.545808	K	K	259	269
PSM	ITQSNAILR	3526	sp|P10649|GSTM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2112.15	24.04423	2	1014.576447	1014.582194	K	Y	70	79
PSM	TAVCDIPPR	3527	sp|P68372|TBB4B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	4-UNIMOD:4	ms_run[1]:scan=1.1.2104.13	23.8228	2	1027.508447	1027.512065	K	G	351	360
PSM	TAVCDIPPR	3528	sp|P68372|TBB4B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	4-UNIMOD:4	ms_run[1]:scan=1.1.2117.13	24.18265	2	1027.508447	1027.512065	K	G	351	360
PSM	EPLGVNAQGR	3529	sp|P28271|ACOC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2001.18	20.98468	2	1039.534847	1039.541057	K	Q	573	583
PSM	TSVPLTAPQK	3530	sp|Q60648|SAP3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2135.17	24.6868	2	1040.579647	1040.586610	K	V	72	82
PSM	ISFTGSTATGK	3531	sp|Q8BWF0|SSDH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2147.14	25.02528	2	1068.542847	1068.545139	K	I	268	279
PSM	ITIGQSPTEK	3532	sp|Q922D8|C1TC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2069.18	22.86238	2	1072.570647	1072.576440	K	G	544	554
PSM	SVEAAAELSAK	3533	sp|Q9D0J8|PTMS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2141.13	24.85475	2	1074.551247	1074.555704	K	D	5	16
PSM	VIEASEIQAK	3534	sp|P17563|SBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2122.18	24.32887	2	1086.587247	1086.592090	K	C	121	131
PSM	VIATDINESK	3535	sp|Q8JZV9|BDH2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2030.20	21.79333	2	1088.565247	1088.571354	K	L	33	43
PSM	RLIPDGCGVK	3536	sp|P86048|RL10L_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	7-UNIMOD:4	ms_run[1]:scan=1.1.2039.17	22.0379	2	1113.594647	1113.596464	K	Y	189	199
PSM	AAWEVDSGRR	3537	sp|P45952|ACADM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1977.4	20.30613	3	1145.553371	1145.557770	R	N	340	350
PSM	RQAVTNPNNTFYATK	3538	sp|P38647|GRP75_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2080.17	23.16418	3	1723.866671	1723.864182	K	R	107	122
PSM	DAGMQLQGYR	3539	sp|P05202|AATM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	4-UNIMOD:35	ms_run[1]:scan=1.1.2146.18	25.00047	2	1153.517247	1153.518607	R	Y	171	181
PSM	REDIFYTSK	3540	sp|P70694|DHB5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2096.18	23.60695	2	1157.569047	1157.571688	K	V	76	85
PSM	VVPGYGHAVLR	3541	tr|Q80X68|Q80X68_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2157.15	25.31077	2	1166.651047	1166.656027	R	K	341	352
PSM	LECVEPNCR	3542	tr|A0A2I3BPG9|A0A2I3BPG9_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	3-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.1975.17	20.26472	2	1175.496847	1175.506328	R	S	70	79
PSM	VEIIANDQGNR	3543	sp|P16627|HS71L_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2107.20	23.91128	2	1227.615647	1227.620764	K	T	28	39
PSM	EIGQSVDEVEK	3544	sp|Q62261|SPTB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2143.21	24.91815	2	1231.592047	1231.593212	R	L	2044	2055
PSM	SCEAGYSPSYK	3545	sp|P10605|CATB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	2-UNIMOD:4	ms_run[1]:scan=1.1.2000.21	20.95885	2	1247.510247	1247.512853	K	E	210	221
PSM	ISSDLDGHPVPK	3546	sp|P40142|TKT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2058.9	22.54938	3	1263.639371	1263.645916	K	Q	103	115
PSM	TLNVKPLVTHR	3547	sp|Q64442|DHSO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2014.12	21.34622	3	1276.756871	1276.761555	K	F	315	326
PSM	TLNVKPLVTHR	3548	sp|Q64442|DHSO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2018.8	21.45203	3	1276.756871	1276.761555	K	F	315	326
PSM	ALQTTYGTNAPR	3549	sp|Q8CG76|ARK72_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2091.20	23.47312	2	1291.648247	1291.652064	K	M	287	299
PSM	QTYSTEPNNLK	3550	sp|P41105|RL28_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1990.21	20.67842	2	1293.620247	1293.620095	K	A	23	34
PSM	HRPELIEYDK	3551	sp|P57780|ACTN4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1972.10	20.17597	3	1298.658071	1298.661900	R	L	206	216
PSM	DEFTNTCPSDK	3552	sp|Q9QYB1|CLIC4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	7-UNIMOD:4	ms_run[1]:scan=1.1.2061.21	22.64233	2	1312.523047	1312.524146	R	E	228	239
PSM	DEFTNTCPSDK	3553	sp|Q9QYB1|CLIC4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	7-UNIMOD:4	ms_run[1]:scan=1.1.2067.20	22.80875	2	1312.523047	1312.524146	R	E	228	239
PSM	RDPHLACVAYER	3554	sp|Q68FD5|CLH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	7-UNIMOD:4	ms_run[1]:scan=1.1.2019.15	21.48508	3	1485.711071	1485.714681	K	G	912	924
PSM	RPQPEEGATYEGIQK	3555	sp|Q8R0Y6|AL1L1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2018.18	21.46288	2	1701.833647	1701.832213	R	K	191	206
PSM	EHHLSEVQNMASEEK	3556	tr|Q91VA7|Q91VA7_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2074.18	22.99968	3	1766.791571	1766.789362	K	L	81	96
PSM	AGGFLMK	3557	sp|P09411|PGK1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2222.2	27.11325	2	722.372447	722.378532	K	K	185	192
PSM	LGISTIK	3558	sp|Q9D964|GATM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2225.4	27.19787	2	730.452047	730.458890	K	V	386	393
PSM	LHVDPENFR	3559	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2310.3	29.53538	3	1125.551771	1125.556707	K	L	97	106
PSM	GLGVEIAK	3560	sp|Q02053|UBA1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2268.4	28.3764	2	785.459847	785.464704	R	N	82	90
PSM	KNPDSLELIR	3561	sp|Q91YI0|ARLY_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2302.3	29.31238	3	1183.648871	1183.656087	K	S	288	298
PSM	LTGMAFR	3562	tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2314.5	29.64638	2	794.404647	794.410894	K	V	226	233
PSM	FYALSAK	3563	sp|P14211|CALR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2268.5	28.37723	2	798.421447	798.427590	R	F	74	81
PSM	VQVSVFK	3564	sp|P16460|ASSY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2305.4	29.39845	2	805.464847	805.469790	K	G	349	356
PSM	VQVSVFK	3565	sp|P16460|ASSY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2312.5	29.59148	2	805.464847	805.469790	K	G	349	356
PSM	IHDPQLLTER	3566	sp|Q922B2|SYDC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2182.2	26.0055	3	1220.641871	1220.651336	R	A	432	442
PSM	VTVAGLAGK	3567	sp|Q99LX0|PARK7_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2163.11	25.47587	2	814.486247	814.491253	K	D	33	42
PSM	VDPVNFK	3568	sp|P01942|HBA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2214.3	26.89418	2	817.427447	817.433404	R	L	94	101
PSM	EFAQVIK	3569	sp|P97807|FUMH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2258.4	28.10122	2	833.460047	833.464704	K	I	221	228
PSM	LVAQLYK	3570	sp|Q9CZU6|CISY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2251.7	27.91183	2	833.496447	833.501090	K	I	376	383
PSM	AFNADFR	3571	sp|Q9JHI5|IVD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2290.2	28.97962	2	839.386647	839.392602	R	-	418	425
PSM	AFNADFR	3572	sp|Q9JHI5|IVD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2283.7	28.79528	2	839.386647	839.392602	R	-	418	425
PSM	IFAQLDR	3573	sp|Q99KP3|CRYL1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2359.2	30.8856	2	861.464647	861.470852	K	I	105	112
PSM	TDACFIR	3574	sp|P46471|PRS7_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	4-UNIMOD:4	ms_run[1]:scan=1.1.2173.7	25.75722	2	881.403247	881.406538	R	V	233	240
PSM	LGAPALTSR	3575	sp|Q9CZN7|GLYM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2194.7	26.34915	2	884.503647	884.507966	R	Q	426	435
PSM	FYEAFSK	3576	sp|P11499|HS90B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2349.6	30.61472	2	890.410047	890.417420	K	N	429	436
PSM	LQNIQFK	3577	sp|Q07417|ACADS_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2260.8	28.15885	2	889.495447	889.502152	K	L	307	314
PSM	FYEAFSK	3578	sp|P11499|HS90B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2342.5	30.42472	2	890.410047	890.417420	K	N	429	436
PSM	GPIEINPR	3579	sp|P47199|QOR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2200.7	26.51785	2	894.486647	894.492316	R	D	252	260
PSM	GPIEINPR	3580	sp|P47199|QOR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2194.8	26.34998	2	894.486647	894.492316	R	D	252	260
PSM	TIAPALVSK	3581	sp|P17182|ENOA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2260.10	28.16052	2	898.543447	898.548768	K	K	72	81
PSM	TIEEVVGR	3582	sp|P47738|ALDH2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2173.8	25.75805	2	901.481447	901.486896	K	A	431	439
PSM	DSILAAADK	3583	sp|Q9WVM8|AADAT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2307.7	29.45732	2	902.467447	902.470912	R	W	331	340
PSM	IVVVTAGVR	3584	sp|P16125|LDHB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2317.8	29.7318	2	912.571247	912.575652	K	Q	92	101
PSM	ENLQAVLK	3585	tr|E9PV38|E9PV38_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2364.8	31.02407	2	913.515447	913.523282	R	D	367	375
PSM	EGVYNLTK	3586	sp|Q99MZ7|PECR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2169.14	25.64867	2	922.469647	922.475997	R	S	176	184
PSM	FDSQTVLK	3587	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2262.11	28.2161	2	936.487847	936.491647	K	V	292	300
PSM	HELIEFR	3588	sp|Q68FD5|CLH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2312.10	29.59565	2	942.487647	942.492316	K	R	1502	1509
PSM	RVIDFAVK	3589	sp|Q9DCW4|ETFB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2244.9	27.71862	2	946.555047	946.560002	K	I	12	20
PSM	FYEQFSK	3590	sp|P07901|HS90A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2258.10	28.10622	2	947.434247	947.438883	K	N	438	445
PSM	HLIVLINK	3591	sp|Q8R050|ERF3A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2326.9	29.98503	2	948.606247	948.612037	K	M	351	359
PSM	EELFVTSK	3592	sp|Q9JII6|AK1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2346.7	30.53405	2	951.486447	951.491313	R	L	73	81
PSM	LSQVAPVLK	3593	sp|Q9DBE0|CSAD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2329.15	30.07435	2	953.585247	953.590967	R	E	434	443
PSM	LNIMTAGSR	3594	sp|P24270|CATA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2287.8	28.90393	2	961.496247	961.501500	K	G	39	48
PSM	VAVVNQIAR	3595	sp|Q62261|SPTB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2187.12	26.15445	2	968.571247	968.576714	R	Q	905	914
PSM	VPETNILGK	3596	sp|Q9DBL1|ACDSB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2309.10	29.5141	2	969.540847	969.549496	K	I	270	279
PSM	IQASSMAFK	3597	sp|Q9WVA4|TAGL2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2241.10	27.63753	2	981.490447	981.495352	K	Q	80	89
PSM	LTAAVDELR	3598	sp|Q99MZ7|PECR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2363.8	30.99718	2	986.533247	986.539660	R	A	55	64
PSM	IQSILSSGGK	3599	sp|Q60648|SAP3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2179.14	25.93312	2	988.551047	988.555310	R	R	170	180
PSM	IQSILSSGGK	3600	sp|Q60648|SAP3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2186.11	26.12507	2	988.551047	988.555310	R	R	170	180
PSM	AGFAGDQIPK	3601	sp|P61164|ACTZ_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2282.11	28.77088	2	1002.504447	1002.513445	K	Y	23	33
PSM	FLLSESGSGK	3602	sp|P17710|HXK1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2329.21	30.07937	2	1023.518247	1023.523676	R	G	498	508
PSM	GTGIVSAPVPK	3603	sp|P25444|RS2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2283.12	28.79945	2	1024.586447	1024.591696	R	K	201	212
PSM	ILEYISHR	3604	sp|Q99KR3|LACB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2231.11	27.36862	2	1029.553847	1029.560730	K	N	210	218
PSM	MREIVHIQAGQCGNQIGAK	3605	sp|P99024|TBB5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	12-UNIMOD:4	ms_run[1]:scan=1.1.2244.15	27.72363	4	2109.068094	2109.057162	-	F	1	20
PSM	HFVGMLPEK	3606	sp|Q9R0P5|DEST_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2262.15	28.21943	2	1056.538247	1056.542637	K	D	70	79
PSM	HVLNQDLTFQHIK	3607	sp|Q3UFF7|LYPL1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2348.17	30.5965	3	1591.839371	1591.847076	K	I	44	57
PSM	GYVSDIDCR	3608	sp|P97494|GSH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	8-UNIMOD:4	ms_run[1]:scan=1.1.2197.16	26.44075	2	1083.461647	1083.465509	R	W	288	297
PSM	LVIVGDGACGK	3609	sp|Q62159|RHOC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	9-UNIMOD:4	ms_run[1]:scan=1.1.2295.16	29.12692	2	1087.563247	1087.569580	K	T	8	19
PSM	VHIEIGPDGR	3610	sp|O35737|HNRH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2180.18	25.96387	2	1091.562447	1091.572357	R	V	317	327
PSM	VEFMDDTSR	3611	sp|P62858|RS28_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2333.17	30.18915	2	1098.462647	1098.465174	R	S	32	41
PSM	IFRDGEEAGAYDGPR	3612	sp|P27773|PDIA3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2231.13	27.37028	3	1651.757471	1651.759048	K	T	105	120
PSM	YDDMAACMK	3613	sp|P63101|1433Z_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	7-UNIMOD:4	ms_run[1]:scan=1.1.2180.19	25.96472	2	1103.407047	1103.408588	R	S	19	28
PSM	RQDLFIVSK	3614	sp|P45376|ALDR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2326.14	29.9892	2	1104.625647	1104.629144	K	L	70	79
PSM	ILSTAQRPLE	3615	sp|Q3TNA1|XYLB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2256.17	28.05778	2	1126.629247	1126.634623	R	-	542	552
PSM	VPLVAMHHAYVVTER	3616	sp|Q99LB7|SARDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2369.17	31.16693	3	1720.908971	1720.908296	K	I	287	302
PSM	VYIGGEDYEK	3617	sp|P40936|INMT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2307.15	29.46398	2	1171.539447	1171.539720	K	E	5	15
PSM	LAAIQESGVER	3618	sp|Q60692|PSB6_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2196.17	26.41345	2	1171.617047	1171.619701	R	Q	209	220
PSM	AQSYEYVYR	3619	sp|Q9D2R0|AACS_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2302.15	29.3224	2	1177.536847	1177.540388	K	C	416	425
PSM	AAGCDFNNVVK	3620	sp|P52760|RIDA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	4-UNIMOD:4	ms_run[1]:scan=1.1.2251.20	27.92268	2	1193.548047	1193.549907	K	T	68	79
PSM	VTQSNFAVGYK	3621	sp|Q60932|VDAC1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2313.18	29.62967	2	1212.610847	1212.613888	R	T	177	188
PSM	KFDQLLAEEK	3622	sp|O08638|MYH11_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2311.9	29.57257	2	1219.642447	1219.644853	K	N	1452	1462
PSM	YLECSALTQR	3623	sp|P60764|RAC3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	4-UNIMOD:4	ms_run[1]:scan=1.1.2356.16	30.81588	2	1239.586847	1239.591772	K	G	154	164
PSM	TPVEPEVAIHR	3624	sp|P60867|RS20_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2186.7	26.12173	3	1246.661771	1246.666986	K	I	9	20
PSM	TCAELVQEAAR	3625	sp|Q8VDK1|NIT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	2-UNIMOD:4	ms_run[1]:scan=1.1.2232.17	27.40058	2	1246.598047	1246.597586	K	L	62	73
PSM	YLIANATNPESK	3626	sp|P68254|1433T_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2324.19	29.9375	2	1319.671447	1319.672131	K	V	104	116
PSM	GEGGILINSQGER	3627	sp|Q8K2B3|SDHA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2303.18	29.35333	2	1328.667847	1328.668442	R	F	313	326
PSM	AATMSAVEAATCR	3628	sp|Q9DCC4|P5CR3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	12-UNIMOD:4	ms_run[1]:scan=1.1.2316.19	29.7133	2	1337.609647	1337.606770	R	A	255	268
PSM	ALGQNPTNAEVLK	3629	sp|Q60605|MYL6_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2334.20	30.2202	2	1353.726847	1353.725229	R	V	38	51
PSM	INEVQTDVSVDTK	3630	sp|Q91YR1|TWF1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2306.19	29.43923	2	1446.719047	1446.720203	K	H	159	172
PSM	DINAYNGETPTEK	3631	sp|O08709|PRDX6_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2232.20	27.40308	2	1450.657647	1450.657603	K	L	85	98
PSM	SLLHCFQCCGAK	3632	sp|O35488|S27A2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	5-UNIMOD:4,8-UNIMOD:4,9-UNIMOD:4	ms_run[1]:scan=1.1.2295.12	29.12357	3	1479.633971	1479.642111	K	V	142	154
PSM	IWHHTFYNELR	3633	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2335.14	30.24367	3	1514.740271	1514.741882	K	V	85	96
PSM	IWHHTFYNELR	3634	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2317.20	29.74182	2	1514.741847	1514.741882	K	V	85	96
PSM	AAVLWELHK	3635	sp|P00329|ADH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2539.2	35.85603	3	1065.588371	1065.597115	K	P	12	21
PSM	IGDFVVK	3636	sp|Q64442|DHSO_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2385.2	31.5964	2	776.437847	776.443240	R	K	57	64
PSM	NKEPILSVLR	3637	sp|Q9DCS2|MTL26_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2501.2	34.78682	3	1167.689771	1167.697558	R	Q	10	20
PSM	NLVVIPK	3638	sp|P45376|ALDR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2413.4	32.37655	2	781.500647	781.506175	R	S	257	264
PSM	EAVTFLR	3639	sp|Q9D2G2|ODO2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2456.5	33.55808	2	834.452047	834.459953	R	K	432	439
PSM	IVVLLQR	3640	sp|P97371|PSME1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2566.3	36.59782	2	839.551047	839.559273	K	L	110	117
PSM	GELLEAIK	3641	sp|P09671|SODM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2539.4	35.8577	2	871.495647	871.501484	K	R	115	123
PSM	SPAQILIR	3642	sp|Q9DCT1|AKCL2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2486.5	34.3731	2	896.539647	896.544351	K	F	229	237
PSM	MAEHNLLLHLR	3643	sp|Q99KR3|LACB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2375.6	31.32227	3	1345.722671	1345.728875	K	K	256	267
PSM	GQVYILGR	3644	sp|P16460|ASSY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2448.5	33.3425	2	904.508647	904.513051	K	E	356	364
PSM	VVVPPLPGK	3645	sp|O70492|SNX3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2552.3	36.21172	2	904.567247	904.574589	K	A	87	96
PSM	LLVVTDPR	3646	sp|P14206|RSSA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2433.9	32.93263	2	911.538247	911.544017	R	A	121	129
PSM	EAIDSYIK	3647	sp|Q68FD5|CLH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2403.6	32.09941	2	937.475047	937.475663	K	A	1123	1131
PSM	QAVSMFVR	3648	sp|Q9DBF1|AL7A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2434.7	32.95818	2	936.478847	936.485122	K	A	376	384
PSM	QMALVLDR	3649	sp|Q8VC30|TKFC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2560.4	36.43072	2	944.506247	944.511337	K	I	373	381
PSM	VNLAMDVGK	3650	sp|P52480|KPYM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2398.8	31.96358	2	945.492047	945.495352	R	A	490	499
PSM	TVFDEAIR	3651	sp|P60764|RAC3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2544.6	35.99665	2	949.482647	949.486896	K	A	167	175
PSM	TYIIGELHPDDR	3652	sp|P56395|CYB5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2564.4	36.54275	3	1427.700971	1427.704494	K	S	78	90
PSM	GQPIYIQFSNHK	3653	sp|P17225|PTBP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2459.5	33.63875	3	1430.728571	1430.730649	R	E	122	134
PSM	NFAAELAPK	3654	sp|Q99LB2|DHRS4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2453.7	33.47927	2	959.503047	959.507632	K	N	196	205
PSM	ENGMDVFR	3655	sp|Q05920|PYC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2458.6	33.6152	2	966.415647	966.422916	K	V	668	676
PSM	FEEFLQR	3656	sp|Q60597|ODO1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2564.6	36.54442	2	967.480447	967.476331	R	K	264	271
PSM	FGLGPEPPR	3657	sp|P11930|NUD19_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2463.7	33.74847	2	968.503647	968.507966	R	Q	74	83
PSM	AIDSLSIEK	3658	sp|Q99LB7|SARDH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2391.13	31.77312	2	974.521247	974.528427	R	G	768	777
PSM	FLTATSLAR	3659	sp|Q9WVM8|AADAT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2521.8	35.35641	2	978.545047	978.549831	R	K	6	15
PSM	SEEALALPR	3660	sp|P34914|HYES_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2429.10	32.82537	2	984.522447	984.524010	R	D	26	35
PSM	SQIHDIVLVGGSTR	3661	sp|P63017|HSP7C_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2448.8	33.345	3	1480.797071	1480.799791	K	I	329	343
PSM	SGYLLPDTK	3662	sp|P08113|ENPL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2430.7	32.84986	2	992.513847	992.517862	R	A	725	734
PSM	EFSVYMTK	3663	sp|P05202|AATM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2546.4	36.04982	2	1003.465047	1003.468469	K	D	397	405
PSM	SSVEWQIR	3664	sp|Q91YI0|ARLY_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2472.9	33.99213	2	1003.501247	1003.508694	K	Q	446	454
PSM	IGYPAPNFK	3665	sp|P35700|PRDX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2519.10	35.30138	2	1005.523047	1005.528367	K	A	8	17
PSM	LISEVIGER	3666	sp|P13707|GPDA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2499.10	34.73852	2	1014.566047	1014.570960	K	L	131	140
PSM	GDYPLEAVR	3667	sp|P52480|KPYM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2464.4	33.77535	2	1018.502647	1018.508360	K	M	368	377
PSM	QHVPLDEYSANLR	3668	sp|Q9DB29|IAH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2456.10	33.56227	3	1540.758671	1540.763406	K	D	100	113
PSM	PMQFLGDEETVRK	3669	sp|Q9DBJ1|PGAM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2428.7	32.7952	3	1548.761171	1548.760628	K	A	229	242
PSM	FQIATVTEK	3670	sp|P99026|PSB4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2439.10	33.099	2	1035.553647	1035.560061	R	G	232	241
PSM	GVFCAGADLK	3671	sp|Q3TLP5|ECHD2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	4-UNIMOD:4	ms_run[1]:scan=1.1.2425.11	32.71423	2	1036.497847	1036.501166	K	E	92	102
PSM	MFASFPTTK	3672	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:35	ms_run[1]:scan=1.1.2482.14	34.26987	2	1044.489647	1044.495018	R	T	33	42
PSM	GDFCIQVGR	3673	sp|P15532|NDKA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	4-UNIMOD:4	ms_run[1]:scan=1.1.2566.7	36.60115	2	1050.487847	1050.491664	R	N	106	115
PSM	FEFSPDPSK	3674	sp|Q64462|CP4B1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2551.6	36.18557	2	1052.480047	1052.481476	R	I	474	483
PSM	THINIVVIGHVDSGK	3675	sp|P10126|EF1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2415.11	32.43787	3	1587.876971	1587.873290	K	S	6	21
PSM	THINIVVIGHVDSGK	3676	sp|P10126|EF1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2422.11	32.63012	3	1587.876971	1587.873290	K	S	6	21
PSM	FLQENLAPK	3677	sp|Q9JHI5|IVD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2409.10	32.2693	2	1058.570847	1058.576046	K	A	57	66
PSM	AGLELSPEMK	3678	sp|P12658|CALB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2568.9	36.6592	2	1073.538647	1073.542697	K	S	50	60
PSM	LITPAVVSER	3679	sp|P62852|RS25_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2507.10	34.96068	2	1083.626647	1083.628809	K	L	67	77
PSM	ATDFVVPGPGK	3680	sp|O88844|IDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2506.14	34.93613	2	1086.569047	1086.570960	R	V	141	152
PSM	SYGADLPLEK	3681	sp|Q9EPL9|ACOX3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2540.14	35.89407	2	1091.546647	1091.549890	R	L	64	74
PSM	MAYSYFQAK	3682	sp|Q9JIL4|NHRF3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2515.12	35.18867	2	1107.508447	1107.505917	K	K	458	467
PSM	HDLNDLIDR	3683	sp|Q80W22|THNS2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2463.10	33.75097	2	1109.544447	1109.546536	R	A	71	80
PSM	HDLNDLIDR	3684	sp|Q80W22|THNS2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2456.15	33.56643	2	1109.544447	1109.546536	R	A	71	80
PSM	VDDFLANEAK	3685	sp|Q9DCD0|6PGD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2474.13	34.04984	2	1120.537047	1120.540054	K	G	39	49
PSM	DLLFRDDTK	3686	sp|Q921I1|TRFE_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2432.10	32.90728	2	1121.568647	1121.571688	K	C	646	655
PSM	VNLQGDIVDR	3687	sp|Q9QYC0|ADDA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2445.13	33.26632	2	1127.591047	1127.593487	K	G	200	210
PSM	KLEVEANNAFDQYR	3688	sp|P47757|CAPZB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2520.11	35.3307	3	1695.817571	1695.821649	R	D	95	109
PSM	KWPLYLSTK	3689	sp|P54071|IDHP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2571.11	36.74543	2	1134.640047	1134.643731	K	N	243	252
PSM	TDGFGIDTCR	3690	sp|O88456|CPNS1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	9-UNIMOD:4	ms_run[1]:scan=1.1.2400.13	32.02255	2	1140.484047	1140.486973	K	S	137	147
PSM	VISAEEALPGR	3691	sp|Q9D6Y7|MSRA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2421.17	32.60723	2	1140.611247	1140.613888	K	T	28	39
PSM	SVSLYYTGEK	3692	sp|P09405|NUCL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2394.17	31.86182	2	1145.559847	1145.560455	R	G	460	470
PSM	DVDGLTSVSAGK	3693	sp|Q922D8|C1TC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2389.19	31.72203	2	1147.569847	1147.572082	K	L	123	135
PSM	TPVPSDIAISR	3694	sp|Q922D8|C1TC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2516.15	35.21983	2	1154.623847	1154.629538	K	S	314	325
PSM	VVDSLQLTGTK	3695	sp|O08709|PRDX6_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2422.16	32.63428	2	1159.638247	1159.644853	R	P	163	174
PSM	EITALAPSTMK	3696	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2491.15	34.5223	2	1160.607847	1160.611110	K	I	316	327
PSM	FGEVVDCTIK	3697	sp|Q99020|ROAA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	7-UNIMOD:4	ms_run[1]:scan=1.1.2528.14	35.55905	2	1166.557647	1166.564161	K	M	98	108
PSM	NIEVPFKPAR	3698	sp|P28271|ACOC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2400.3	32.0142	3	1169.651771	1169.655693	K	V	73	83
PSM	EVCFACVDGK	3699	sp|Q68FD5|CLH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	3-UNIMOD:4,6-UNIMOD:4	ms_run[1]:scan=1.1.2420.19	32.58125	2	1183.498847	1183.500180	K	E	1255	1265
PSM	SVIVEPEGIEK	3700	sp|Q61838|PZP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2478.15	34.16175	2	1198.641047	1198.644519	K	E	914	925
PSM	VNTEPLPAIEK	3701	sp|Q9CXN7|PBLD2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2487.16	34.41032	2	1209.656647	1209.660504	K	T	179	190
PSM	NAGVEGSLIVEK	3702	sp|P63038|CH60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2436.16	33.02045	2	1214.649247	1214.650667	K	I	482	494
PSM	LFEASVETGDR	3703	sp|Q9CPY7|AMPL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2415.18	32.4437	2	1222.580447	1222.582981	K	V	418	429
PSM	QLICDPSYVK	3704	sp|Q61598|GDIB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	4-UNIMOD:4	ms_run[1]:scan=1.1.2479.11	34.18575	2	1221.607047	1221.606360	K	D	279	289
PSM	TEAITQDNGGSHFSWAK	3705	sp|Q7TNG8|LDHD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2444.16	33.24118	3	1847.845871	1847.843841	R	E	319	336
PSM	HMNSAGVLAALR	3706	sp|Q9Z0S1|BPNT1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2476.18	34.10915	2	1238.646847	1238.655375	K	N	278	290
PSM	VNADEVGGEALGR	3707	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2382.19	31.52625	2	1285.624647	1285.626243	K	L	19	32
PSM	EEAESTLQSFR	3708	sp|P20152|VIME_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2445.18	33.27048	2	1295.600647	1295.599360	R	Q	197	208
PSM	ESGICMDSGGFR	3709	sp|Q8VCA8|SCRN2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	5-UNIMOD:4	ms_run[1]:scan=1.1.2508.17	34.99428	2	1314.529247	1314.533271	K	T	273	285
PSM	MLVQNDMSSYK	3710	sp|Q3UNX5|ACSM3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2417.19	32.49893	2	1314.594047	1314.594809	R	F	326	337
PSM	HGCAFLVDEVQTGGGCTGK	3711	sp|P61922|GABT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	3-UNIMOD:4,16-UNIMOD:4	ms_run[1]:scan=1.1.2534.19	35.73037	3	1991.884871	1991.882946	K	F	319	338
PSM	INQFYGAPTAVR	3712	sp|Q99NB1|ACS2L_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2556.16	36.32973	2	1335.692847	1335.693535	K	L	374	386
PSM	SGSGTMNLGGSLTR	3713	sp|P47757|CAPZB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2408.18	32.24854	2	1336.638647	1336.640513	K	Q	182	196
PSM	VADWTGATYQDK	3714	sp|O70194|EIF3D_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2396.18	31.91733	2	1353.632447	1353.620095	K	R	42	54
PSM	NVTLNPDPNEIK	3715	sp|P58044|IDI1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2508.18	34.99512	2	1352.687047	1352.693595	K	S	158	170
PSM	VLVHPPQDGEDEPELVQK	3716	sp|O88696|CLPP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2521.19	35.3656	3	2028.014771	2028.016385	K	E	240	258
PSM	SFDTPPPPMDEK	3717	sp|O70250|PGAM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2485.19	34.35692	2	1359.599047	1359.601668	R	H	118	130
PSM	YQHQDFAVFSK	3718	sp|Q3UNZ8|QORL2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2392.8	31.79733	3	1368.643571	1368.646250	R	S	292	303
PSM	GVLETFSGTETNK	3719	sp|Q9WTP7|KAD3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2574.15	36.83317	2	1381.671847	1381.672525	K	I	191	204
PSM	YYASEVAGLTTSK	3720	sp|Q9DBL1|ACDSB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2560.18	36.4424	2	1388.684247	1388.682361	K	C	372	385
PSM	FFQEENTENLK	3721	sp|Q9D8W5|PSD12_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2399.18	31.99932	2	1397.642447	1397.646310	K	L	213	224
PSM	SVEDLPEGVDPSR	3722	sp|Q62468|VILI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2571.17	36.75045	2	1398.663647	1398.662688	K	K	776	789
PSM	ELAEDGYSGVEVR	3723	sp|P62908|RS3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2514.19	35.16587	2	1422.664647	1422.662688	R	V	28	41
PSM	VTCIDPNPNFEK	3724	tr|G3X9G9|G3X9G9_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	3-UNIMOD:4	ms_run[1]:scan=1.1.2454.16	33.51777	2	1432.663847	1432.665666	R	F	94	106
PSM	VTCIDPNPNFEK	3725	tr|G3X9G9|G3X9G9_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	3-UNIMOD:4	ms_run[1]:scan=1.1.2447.20	33.32738	2	1432.663847	1432.665666	R	F	94	106
PSM	AIEINPDSAQPYK	3726	sp|Q99L47|F10A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2534.21	35.73205	2	1444.722047	1444.719809	R	W	173	186
PSM	GSGSGCVYLQTSLK	3727	sp|Q61838|PZP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	6-UNIMOD:4	ms_run[1]:scan=1.1.2513.21	35.13875	2	1455.703447	1455.702779	K	Y	1334	1348
PSM	HVFGESDELIGQK	3728	sp|P17751|TPIS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2424.19	32.69287	2	1457.715247	1457.715058	R	V	151	164
PSM	KGTDFQLNQLEGK	3729	sp|Q921I1|TRFE_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2459.8	33.64125	3	1476.758171	1476.757257	K	K	122	135
PSM	LPACVVDCGTGYTK	3730	sp|Q99JY9|ARP3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	4-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.2494.19	34.60885	2	1539.702647	1539.706150	R	L	5	19
PSM	QEQDTYALSSYTR	3731	sp|Q8QZT1|THIL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2524.21	35.45128	2	1560.706447	1560.705616	R	S	206	219
PSM	MADCGGLPQISQPAK	3732	sp|Q62433|NDRG1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	4-UNIMOD:4	ms_run[1]:scan=1.1.2563.17	36.52567	2	1571.748447	1571.743598	K	L	286	301
PSM	YAAELHLVHWNTK	3733	sp|P00920|CAH2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2523.12	35.41587	3	1580.807471	1580.809962	K	Y	114	127
PSM	HSENILYVSSETIK	3734	sp|Q91XE0|GLYAT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2557.19	36.35977	2	1618.826447	1618.820252	K	K	128	142
PSM	GCITIIGGGDTATCCAK	3735	sp|P09411|PGK1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	2-UNIMOD:4,14-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=1.1.2563.19	36.52733	2	1753.785647	1753.779726	R	W	366	383
PSM	TDYNASVSVPDSSGPER	3736	sp|P61979|HNRPK_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2444.21	33.24535	2	1779.799847	1779.791136	R	I	70	87
PSM	RNFILDQTNVSAAAQR	3737	sp|Q8VEK3|HNRPU_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2564.18	36.55443	3	1802.934671	1802.938744	K	R	551	567
PSM	KYDTDHSGFIETEELK	3738	sp|P12658|CALB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2382.18	31.52542	3	1910.895971	1910.889788	R	N	109	125
PSM	LGQSDPAPLQHQVDIYQK	3739	sp|P40142|TKT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2541.19	35.9263	3	2036.041871	2036.032704	R	R	187	205
PSM	ECCHGDLLECADDRAELAK	3740	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	2-UNIMOD:4,3-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.2437.13	33.04572	4	2260.958094	2260.951102	K	Y	268	287
PSM	SCESDAPFPVHPGTPECCTK	3741	sp|P21614|VTDB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	2-UNIMOD:4,17-UNIMOD:4,18-UNIMOD:4	ms_run[1]:scan=1.1.2433.17	32.94265	3	2274.940271	2274.934389	K	E	95	115
PSM	DGVVLFK	3742	sp|P09103|PDIA1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2704.2	40.4318	2	776.437447	776.443240	K	K	203	210
PSM	EALELLK	3743	sp|P17182|ENOA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2581.2	37.0184	2	814.473847	814.480020	K	T	222	229
PSM	IAAYLFK	3744	sp|Q68FD5|CLH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2637.3	38.567	2	824.473447	824.479626	R	G	1510	1517
PSM	GLVGEIIK	3745	sp|P15532|NDKA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2625.3	38.23252	2	827.507447	827.511654	R	R	19	27
PSM	GIAISFAR	3746	sp|Q9DBM2|ECHP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2632.4	38.4286	2	833.470847	833.475938	R	V	309	317
PSM	GIGFAITR	3747	sp|P48758|CBR1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2604.2	37.65887	2	833.471247	833.475938	K	D	16	24
PSM	GLVVPVIR	3748	sp|Q9D2G2|ODO2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2777.2	42.47682	2	851.554247	851.559273	R	N	327	335
PSM	TPALIALR	3749	sp|P70694|DHB5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2637.5	38.56867	2	853.533447	853.538538	R	Y	251	259
PSM	KAPDFVFYAPR	3750	sp|P26040|EZRI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2740.3	41.44985	3	1309.678871	1309.681908	K	L	263	274
PSM	FDLMYAK	3751	sp|P05213|TBA1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2708.2	40.54643	2	886.422247	886.425876	K	R	395	402
PSM	DLSQYIR	3752	sp|P08905|LYZ2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2764.2	42.11365	2	893.456447	893.460681	R	N	138	145
PSM	LVADFMAK	3753	sp|P00329|ADH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2584.2	37.10103	2	893.461447	893.468075	K	K	332	340
PSM	DLAGCIHGLSNVK	3754	sp|P54071|IDHP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	5-UNIMOD:4	ms_run[1]:scan=1.1.2664.6	39.32343	3	1382.691671	1382.697634	K	L	414	427
PSM	IHYLLNEDIMK	3755	sp|Q61838|PZP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2759.5	41.97588	3	1387.716371	1387.716973	R	N	477	488
PSM	LLEVIPSR	3756	sp|Q9DBM2|ECHP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2643.10	38.74287	2	925.555647	925.559667	R	Y	437	445
PSM	SQISTESFLHLR	3757	sp|Q8K010|OPLA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2766.4	42.17123	3	1416.732071	1416.736128	R	Y	570	582
PSM	LYSEFLGK	3758	sp|O35660|GSTM6_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2651.6	38.9665	2	955.498847	955.501484	K	Q	137	145
PSM	GNVGFVFTK	3759	sp|P14869|RLA0_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2634.8	38.48777	2	967.509847	967.512717	R	E	84	93
PSM	AALQELLSK	3760	sp|P62852|RS25_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2711.7	40.6362	2	971.561047	971.565147	R	G	86	95
PSM	GITAFIVEK	3761	sp|Q9JHI5|IVD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2779.5	42.53508	2	976.554447	976.559333	R	G	222	231
PSM	LTPIGYIPK	3762	sp|Q9Z2V4|PCKGC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2707.8	40.52285	2	1000.594847	1000.595718	K	E	552	561
PSM	YIQELWR	3763	sp|Q9CZM2|RL15_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2732.3	41.22837	2	1006.516847	1006.523616	K	K	6	13
PSM	LLAEPVPGIK	3764	sp|P61089|UBE2N_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2664.9	39.32593	2	1035.627447	1035.632832	R	A	15	25
PSM	MSDGLFLQK	3765	sp|Q9D6R2|IDH3A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2655.7	39.07905	2	1037.516447	1037.521567	R	C	206	215
PSM	GIYAYGFEK	3766	tr|A0A0N4SVP8|A0A0N4SVP8_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2606.8	37.71862	2	1046.502447	1046.507297	R	P	52	61
PSM	ELEEDFIR	3767	sp|Q9CQI6|COTL1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2697.10	40.23874	2	1049.498847	1049.502940	K	S	119	127
PSM	VPEWVDTVK	3768	sp|Q9CZX8|RS19_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2640.10	38.65771	2	1071.558847	1071.560061	K	L	30	39
PSM	AVASAAAALVLK	3769	sp|P26039|TLN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2781.8	42.59422	2	1083.662447	1083.665195	K	A	674	686
PSM	ELEEWYAR	3770	sp|O08585|CLCA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2625.13	38.24085	2	1094.503447	1094.503275	K	Q	141	149
PSM	AGDFGAAFVER	3771	sp|Q8K010|OPLA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2703.14	40.41303	2	1138.541247	1138.540723	R	Y	605	616
PSM	KWLPELVDR	3772	sp|Q9EQ20|MMSA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2668.2	39.42823	3	1154.641571	1154.644794	K	A	331	340
PSM	HFCPNVPIILVGNKK	3773	sp|Q62159|RHOC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	3-UNIMOD:4	ms_run[1]:scan=1.1.2679.16	39.74803	3	1734.957071	1734.960331	K	D	105	120
PSM	QFSYTHICAGASAFGK	3774	sp|Q99LC5|ETFA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	8-UNIMOD:4	ms_run[1]:scan=1.1.2646.15	38.83192	3	1743.805871	1743.803890	K	N	102	118
PSM	VAFITGGGTGLGK	3775	sp|Q9CQ62|DECR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2650.13	38.94403	2	1176.648447	1176.650273	K	A	61	74
PSM	IDIIPNPQER	3776	sp|P11499|HS90B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2694.11	40.15647	2	1193.638447	1193.640437	K	T	73	83
PSM	LVQAFQFTDK	3777	sp|P35700|PRDX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2779.10	42.53925	2	1195.626047	1195.623724	R	H	159	169
PSM	WGVISASVDDR	3778	sp|P97494|GSH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2734.12	41.29023	2	1203.590247	1203.588401	R	T	297	308
PSM	AIEMLGGELGSK	3779	sp|P97807|FUMH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2771.13	42.31795	2	1203.614647	1203.616924	R	K	158	170
PSM	LPDLPGNYVTK	3780	sp|Q61838|PZP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2757.14	41.92735	2	1215.650647	1215.649939	R	G	1323	1334
PSM	NFGIGQDIQPK	3781	sp|P12970|RL7A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2586.17	37.16875	2	1215.624047	1215.624787	K	R	38	49
PSM	APILIATDVASR	3782	sp|Q501J6|DDX17_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2761.16	42.0413	2	1225.704847	1225.703037	K	G	390	402
PSM	RPDPIDWSLK	3783	sp|Q9D964|GATM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2624.16	38.21603	2	1225.643647	1225.645522	R	Y	143	153
PSM	IYVVDVGSEPR	3784	sp|P17563|SBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2606.13	37.7228	2	1232.639447	1232.640102	R	A	104	115
PSM	KLGESCIFAPANVTSEK	3785	sp|O08756|HCD2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	6-UNIMOD:4	ms_run[1]:scan=1.1.2594.15	37.39326	3	1849.927571	1849.924400	K	E	53	70
PSM	LEVDPNIQAVR	3786	sp|P11679|K2C8_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2644.15	38.7752	2	1252.678447	1252.677551	K	T	84	95
PSM	LIQFHFHWGSSDGQGSEHTVNK	3787	sp|P00920|CAH2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2620.13	38.10538	4	2510.190494	2510.172720	R	K	90	112
PSM	VTHAVVTVPAYFNDAQR	3788	sp|P20029|BIP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2711.15	40.64288	3	1886.981471	1886.963896	K	Q	166	183
PSM	TIAMDGTEGLVR	3789	sp|P56480|ATPB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2642.15	38.71872	2	1261.632647	1261.633637	R	G	110	122
PSM	RTPFGAYGGLLK	3790	sp|Q8BWT1|THIM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2678.18	39.72122	2	1278.705647	1278.708457	K	D	14	26
PSM	KYTPEQVAMATVTALHR	3791	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	9-UNIMOD:35	ms_run[1]:scan=1.1.2705.13	40.46968	3	1931.002871	1930.993482	K	T	243	260
PSM	SFLVGSAAQSLSK	3792	sp|Q9R0H0|ACOX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2721.14	40.92955	2	1293.693047	1293.692866	R	A	283	296
PSM	TSCEFTGDILR	3793	sp|P62814|VATB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	3-UNIMOD:4	ms_run[1]:scan=1.1.2724.14	41.0154	2	1297.596847	1297.597252	K	T	110	121
PSM	TCLLISYTTNK	3794	sp|P60766|CDC42_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	2-UNIMOD:4	ms_run[1]:scan=1.1.2714.17	40.73045	2	1312.667447	1312.669688	K	F	17	28
PSM	SLLPGCQSVISR	3795	sp|Q9DCM0|ETHE1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	6-UNIMOD:4	ms_run[1]:scan=1.1.2677.14	39.68933	2	1315.692447	1315.691821	R	L	93	105
PSM	AEAERDVLFPGYTHLQR	3796	sp|Q91YI0|ARLY_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2609.15	37.8072	3	2001.010871	2001.006824	R	A	147	164
PSM	NTNAGAPPGTAYQSPLSLSR	3797	sp|Q60597|ODO1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2761.20	42.04463	3	2001.000071	2000.991568	R	S	82	102
PSM	ILLTEPPMNPTK	3798	sp|P61161|ARP2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2762.19	42.07193	2	1352.739447	1352.737374	K	N	107	119
PSM	FHADFLLQHVK	3799	sp|Q8R164|BPHL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2602.5	37.6063	3	1353.714671	1353.719356	R	G	250	261
PSM	TDFAPQLQSLNK	3800	sp|Q8R164|BPHL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2766.15	42.1804	2	1360.700647	1360.698680	K	K	75	87
PSM	AYSTDVCVPISR	3801	sp|Q7TNG8|LDHD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	7-UNIMOD:4	ms_run[1]:scan=1.1.2603.18	37.64473	2	1366.655847	1366.655101	K	L	363	375
PSM	LSDGNEYLFQAK	3802	sp|Q62261|SPTB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2685.18	39.91885	2	1383.662647	1383.667045	R	D	2278	2290
PSM	TPSCCYLWCGK	3803	sp|Q62468|VILI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	4-UNIMOD:4,5-UNIMOD:4,9-UNIMOD:4	ms_run[1]:scan=1.1.2635.18	38.52397	2	1430.580047	1430.578113	K	G	550	561
PSM	DNPGVVTCLDEAR	3804	sp|Q02053|UBA1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	8-UNIMOD:4	ms_run[1]:scan=1.1.2633.20	38.46983	2	1444.665447	1444.661643	K	H	227	240
PSM	FAEVYFAQSQQK	3805	sp|Q6ZQI3|MLEC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2650.18	38.94822	2	1444.704247	1444.698680	K	V	126	138
PSM	VQPIYGGTNEIMK	3806	sp|P51174|ACADL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2627.20	38.30212	2	1448.736647	1448.733351	R	E	407	420
PSM	TTPSVVAFTADGER	3807	sp|P38647|GRP75_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2683.19	39.8644	2	1449.711047	1449.709973	R	L	86	100
PSM	LQAGTVFVNTYNK	3808	sp|Q8R0Y6|AL1L1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2643.20	38.7512	2	1453.758847	1453.756529	K	T	853	866
PSM	QFVTPADVVSGNPK	3809	sp|Q3V0K9|PLSI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2720.18	40.90434	2	1457.749647	1457.751444	R	L	350	364
PSM	SQFTITPGSEQIR	3810	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2637.20	38.58118	2	1462.745847	1462.741607	K	A	412	425
PSM	HWLFGHALEIQK	3811	sp|Q64462|CP4B1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2735.5	41.31173	3	1477.781171	1477.783019	K	T	52	64
PSM	YGYTHLSAGELLR	3812	sp|Q9DBP5|KCY_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2679.11	39.74387	3	1478.751371	1478.751778	K	D	27	40
PSM	ECYQTWAQLER	3813	sp|Q9D826|SOX_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	2-UNIMOD:4	ms_run[1]:scan=1.1.2766.18	42.18292	2	1482.663647	1482.656163	K	E	70	81
PSM	ENLQLNQEVGAIR	3814	sp|Q60866|PTER_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2710.16	40.61514	2	1482.782847	1482.779056	R	E	69	82
PSM	VCIVGSGNWGSAVAK	3815	sp|Q3ULJ0|GPD1L_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	2-UNIMOD:4	ms_run[1]:scan=1.1.2770.19	42.2951	2	1503.757047	1503.750398	K	I	8	23
PSM	IFVGGLNPEATEEK	3816	sp|Q99020|ROAA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2761.21	42.04547	2	1502.762447	1502.761674	K	I	161	175
PSM	SSLQSQCLNEVLK	3817	sp|Q9JHU4|DYHC1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	7-UNIMOD:4	ms_run[1]:scan=1.1.2690.17	40.05457	2	1504.746047	1504.755543	R	A	3704	3717
PSM	EVSFQATGDSEWR	3818	sp|O35658|C1QBP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2702.18	40.38757	2	1510.673647	1510.668836	K	D	204	217
PSM	SLTNDWEDHLAVK	3819	sp|P11499|HS90B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2745.5	41.59203	3	1526.738171	1526.736522	K	H	307	320
PSM	LINSLYPEGQAPVK	3820	sp|Q9WVA4|TAGL2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2719.18	40.87555	2	1527.832847	1527.829694	K	K	65	79
PSM	QEPGENSEILPSLK	3821	sp|P46412|GPX3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2748.19	41.68612	2	1539.782647	1539.778053	K	Y	107	121
PSM	NSCPPTAELLGSPGR	3822	sp|P46412|GPX3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	3-UNIMOD:4	ms_run[1]:scan=1.1.2604.20	37.67388	2	1554.748447	1554.746041	K	L	154	169
PSM	MLLEYTDSSYDEK	3823	sp|P10649|GSTM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:35	ms_run[1]:scan=1.1.2599.20	37.53672	2	1608.688847	1608.686520	R	R	19	32
PSM	MISSYVGENAEFER	3824	sp|Q9D0K2|SCOT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2731.14	41.21457	2	1630.735047	1630.729722	R	Q	111	125
PSM	NQVAMNPTNTVFDAK	3825	sp|P63017|HSP7C_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2680.19	39.77913	2	1648.792047	1648.787906	K	R	57	72
PSM	STYNHLSSWLTDAR	3826	sp|Q91V41|RAB14_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2775.10	42.42798	3	1649.786771	1649.779784	R	N	97	111
PSM	FAAYFQQGDMESNGK	3827	sp|P06745|G6PI_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2676.20	39.66573	2	1691.730847	1691.724971	R	Y	348	363
PSM	QLEVEPEGLEPEAEK	3828	sp|Q8CGK3|LONM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2719.21	40.87807	2	1695.831447	1695.820311	R	Q	207	222
PSM	STDCCGDNDPIDVCEIGSK	3829	sp|Q91VM9|IPYR2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	4-UNIMOD:4,5-UNIMOD:4,14-UNIMOD:4	ms_run[1]:scan=1.1.2723.17	40.9893	3	2140.836371	2140.834735	K	V	153	172
PSM	NTNDANSCQIIIPQNQVNR	3830	sp|P50396|GDIA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	8-UNIMOD:4	ms_run[1]:scan=1.1.2592.20	37.34023	3	2198.055971	2198.049828	K	K	310	329
PSM	AGESVLVHGASGGVGLATCQIAR	3831	sp|P47199|QOR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	19-UNIMOD:4	ms_run[1]:scan=1.1.2729.14	41.15588	3	2209.135271	2209.127350	R	A	148	171
PSM	GVEVTVGHEQEEGGKWPYAGTAEAIK	3832	sp|Q9D172|GAL3A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2666.12	39.38647	4	2741.338094	2741.329674	K	A	187	213
PSM	VVFGLFGK	3833	sp|P24369|PPIB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3103.2	51.61507	2	865.503447	865.506175	R	T	60	68
PSM	VLGLTLLQK	3834	sp|Q9CPU0|LGUL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3046.4	50.01152	2	983.634647	983.637918	R	L	52	61
PSM	DASVVGFFR	3835	sp|P27773|PDIA3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3115.4	51.9464	2	996.502247	996.502881	K	D	153	162
PSM	DLTDYLMK	3836	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3184.3	53.8894	2	997.477647	997.479034	R	I	184	192
PSM	MDELQLFR	3837	sp|Q01853|TERA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3048.5	50.06982	2	1050.518447	1050.516816	K	G	46	54
PSM	FYLLGVDAR	3838	sp|Q99LB7|SARDH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3111.2	51.83635	2	1052.563647	1052.565481	K	K	580	589
PSM	VSFELFADK	3839	sp|P17742|PPIA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3080.3	50.96544	2	1054.534847	1054.533512	R	V	20	29
PSM	LLIYTEFGK	3840	sp|O09173|HGD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2997.4	48.65465	2	1082.597247	1082.601198	K	M	163	172
PSM	LLIYTEFGK	3841	sp|O09173|HGD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3003.4	48.82452	2	1082.597247	1082.601198	K	M	163	172
PSM	INEAFDLLR	3842	sp|P00329|ADH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3047.7	50.0428	2	1089.580847	1089.581859	K	S	356	365
PSM	YFDLGLPNR	3843	sp|P54071|IDHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3006.5	48.90997	2	1093.551047	1093.555644	K	D	81	90
PSM	AGLLEPEVFHLNPAR	3844	sp|P52825|CPT2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3059.5	50.37283	3	1661.890571	1661.888940	R	S	168	183
PSM	VFDAIMNFR	3845	sp|P58252|EF2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3176.4	53.66677	2	1111.550847	1111.548451	K	K	300	309
PSM	TPFGAYGGLLK	3846	sp|Q8BWT1|THIM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2990.4	48.46477	2	1122.603247	1122.607346	R	D	15	26
PSM	DLETPIIVVK	3847	sp|Q62468|VILI_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3110.4	51.811	2	1125.663247	1125.664526	R	Q	690	700
PSM	SPAHGISLFLVENGMK	3848	sp|P51174|ACADL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3026.3	49.4523	3	1698.877871	1698.876327	R	G	225	241
PSM	IHPEPGTWEEFLEK	3849	sp|Q3UZZ6|ST1D1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3049.7	50.1002	3	1710.828071	1710.825337	K	F	148	162
PSM	AIVAIENPADVSVISSR	3850	sp|P14206|RSSA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3129.4	52.33987	3	1739.941271	1739.941764	R	N	64	81
PSM	IHFPLATYAPVISAEK	3851	sp|P05213|TBA1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3153.5	53.027	3	1755.961871	1755.955957	R	A	265	281
PSM	EGLLLWCQR	3852	sp|O88990|ACTN3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	7-UNIMOD:4	ms_run[1]:scan=1.1.3116.3	51.97287	2	1173.596847	1173.596464	K	K	161	170
PSM	QRVEAEVGESLFQEAHEVVLK	3853	sp|Q99L20|GSTT3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3126.10	52.25958	4	2396.244494	2396.233589	R	A	196	217
PSM	RFDEILEASDGIMVAR	3854	sp|P52480|KPYM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3186.4	53.94547	3	1820.917571	1820.909084	R	G	279	295
PSM	DFANVYVDAVK	3855	sp|Q00623|APOA1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2995.6	48.60157	2	1239.615047	1239.613553	K	D	36	47
PSM	FMAGQVSFGPWYDHVK	3856	sp|Q3UZZ6|ST1D1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3106.8	51.70322	3	1867.878671	1867.871576	K	S	162	178
PSM	RGWDENVYYTVPLVR	3857	sp|O55125|NIPS1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3084.7	51.08347	3	1865.949671	1865.942433	K	H	254	269
PSM	FEELNADLFR	3858	sp|P17156|HSP72_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3135.9	52.51308	2	1252.608247	1252.608802	R	G	305	315
PSM	GLTPSQIGVILR	3859	sp|P62301|RS13_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3104.6	51.6461	2	1252.749047	1252.750322	K	D	44	56
PSM	FLASVSTVLTSK	3860	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3056.5	50.29485	2	1251.708447	1251.707454	K	Y	129	141
PSM	IHLFDIDVPGK	3861	sp|Q9JHW2|NIT2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3083.2	51.05037	3	1252.674671	1252.681573	K	I	113	124
PSM	IGASSLLSDIER	3862	sp|Q91YP3|DEOC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3070.10	50.68805	2	1259.672647	1259.672131	R	Q	288	300
PSM	IVLLDSSLEYK	3863	sp|P80318|TCPG_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3055.6	50.26537	2	1278.704247	1278.707119	R	K	238	249
PSM	FLSDVYPDGFK	3864	sp|Q91ZA3|PCCA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3032.8	49.6177	2	1286.620047	1286.618304	K	G	499	510
PSM	MAENLGFLGSLK	3865	sp|Q9Z2I8|SUCB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:35	ms_run[1]:scan=1.1.3059.14	50.38035	2	1294.662647	1294.659124	R	N	208	220
PSM	SLEDHTPLPGITVGDIGPK	3866	sp|Q9QXD1|ACOX2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3077.9	50.88577	3	1945.017971	1945.015657	R	M	226	245
PSM	DIGNIISDAMKK	3867	sp|P63038|CH60_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3024.2	49.39597	3	1303.675271	1303.680587	K	V	181	193
PSM	GDRDDGPAVAIDLSGFNEK	3868	sp|Q3V0K9|PLSI_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3004.12	48.85954	3	1974.941771	1974.928299	K	N	312	331
PSM	GIVNEQFLLQR	3869	sp|P50544|ACADV_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2995.10	48.60492	2	1315.727647	1315.724835	K	L	558	569
PSM	IEWLESHQDADIEDFK	3870	sp|P20029|BIP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3032.9	49.61853	3	1973.904671	1973.900687	K	A	603	619
PSM	LYCIYVAIGQK	3871	sp|Q03265|ATPA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	3-UNIMOD:4	ms_run[1]:scan=1.1.3012.7	49.08695	2	1326.697447	1326.700594	K	R	242	253
PSM	VVVCNLYPFVK	3872	sp|Q9CWJ9|PUR9_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	4-UNIMOD:4	ms_run[1]:scan=1.1.3130.7	52.37077	2	1336.723447	1336.721330	R	T	98	109
PSM	IHKPDPWLSEFLSQYR	3873	sp|Q9DBM2|ECHP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3189.10	54.03298	3	2015.034371	2015.026497	R	E	584	600
PSM	DQDGYYWITGR	3874	sp|Q9QXG4|ACSA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3125.8	52.22948	2	1372.610847	1372.604780	R	I	557	568
PSM	TPVLLMLGQEDR	3875	sp|Q8R146|APEH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3170.12	53.50577	2	1370.728047	1370.722786	K	R	665	677
PSM	TPVLLMLGQEDR	3876	sp|Q8R146|APEH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3176.10	53.67177	2	1370.728047	1370.722786	K	R	665	677
PSM	ALYGDTLVTGFAR	3877	sp|Q3ULD5|MCCB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3113.7	51.89454	2	1382.721447	1382.719415	K	I	349	362
PSM	ALAGCDFLTISPK	3878	sp|Q93092|TALDO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	5-UNIMOD:4	ms_run[1]:scan=1.1.3074.10	50.80222	2	1391.714447	1391.711887	K	L	246	259
PSM	ALAGCDFLTISPK	3879	sp|Q93092|TALDO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	5-UNIMOD:4	ms_run[1]:scan=1.1.3086.14	51.147	2	1391.714447	1391.711887	K	L	246	259
PSM	ELEEIVQPIISK	3880	sp|P20029|BIP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3080.13	50.97378	2	1396.785647	1396.781347	K	L	623	635
PSM	ALGMTPAAFSALPR	3881	sp|Q62468|VILI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3170.13	53.5066	2	1401.746847	1401.743856	R	W	801	815
PSM	IKAEYEGDGIPTVFVSVAGR	3882	sp|Q9DCL9|PUR6_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3139.13	52.6302	3	2107.092971	2107.094970	R	S	312	332
PSM	VLDPFTIKPLDR	3883	sp|P40142|TKT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3026.2	49.45063	3	1412.798771	1412.802751	R	K	531	543
PSM	GNWGYLDQAAALR	3884	sp|Q91WG0|EST2C_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3076.10	50.8585	2	1433.707447	1433.705162	R	W	196	209
PSM	VNLLSFTGSTQVGK	3885	sp|Q9DBF1|AL7A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3067.16	50.60667	2	1449.785847	1449.782744	R	E	267	281
PSM	CMALSTAILVGEAK	3886	sp|Q9EQ20|MMSA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:4	ms_run[1]:scan=1.1.3124.15	52.20693	2	1462.755647	1462.752372	R	K	317	331
PSM	VIISAPSADAPMFVMGVNHEK	3887	tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3150.13	52.9467	3	2212.111571	2212.102046	R	Y	117	138
PSM	EDIYAVEIVGGATR	3888	sp|Q61316|HSP74_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3067.18	50.60833	2	1491.760247	1491.756923	K	I	333	347
PSM	EILQSVYECIEK	3889	sp|Q64516|GLPK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	9-UNIMOD:4	ms_run[1]:scan=1.1.3122.19	52.15363	2	1509.745647	1509.738496	K	T	59	71
PSM	FAPPEAPEPWSGVR	3890	tr|E9PV38|E9PV38_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2998.19	48.695	2	1538.752847	1538.751778	R	D	75	89
PSM	LLLINNAATLGDVSK	3891	sp|Q64105|SPRE_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3142.12	52.71555	2	1540.886247	1540.882458	R	G	96	111
PSM	YCLVVLNQPLDAR	3892	sp|Q9R0M5|TPK1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	2-UNIMOD:4	ms_run[1]:scan=1.1.3156.15	53.12243	2	1559.812447	1559.812999	K	F	19	32
PSM	GFGFVDFNSEEDAK	3893	sp|P09405|NUCL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3148.16	52.89142	2	1560.678647	1560.673253	K	A	608	622
PSM	TPILLGSLAHQIYR	3894	sp|Q99L13|3HIDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3077.18	50.89328	2	1580.910047	1580.903862	K	M	297	311
PSM	IIPGFMCQGGDFTR	3895	sp|P17742|PPIA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	7-UNIMOD:4	ms_run[1]:scan=1.1.3098.3	51.47787	3	1597.737371	1597.738119	R	H	56	70
PSM	GFGFVCFSSPEEATK	3896	tr|A2A5N3|A2A5N3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	6-UNIMOD:4	ms_run[1]:scan=1.1.3179.18	53.76387	2	1661.750447	1661.739559	K	A	334	349
PSM	TPDFESTGLYSAMPR	3897	sp|Q9D964|GATM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3077.20	50.89495	2	1670.769447	1670.761022	K	D	155	170
PSM	SSGLPITSAVDLEDAAK	3898	sp|Q9Z2I8|SUCB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3121.17	52.12362	2	1672.861047	1672.851946	K	K	408	425
PSM	NVVTIFSAPNYCYR	3899	sp|P62715|PP2AB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	12-UNIMOD:4	ms_run[1]:scan=1.1.3148.18	52.89308	2	1702.823647	1702.813727	R	C	255	269
PSM	VAGALAEEGMGLEEITK	3900	sp|Q8VC30|TKFC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3076.17	50.86433	2	1716.864047	1716.860402	K	R	163	180
PSM	EGGSIPVTLTFQEATGK	3901	sp|Q9D1A2|CNDP2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3113.11	51.90122	2	1733.894447	1733.883580	R	N	414	431
PSM	TLNEWSSQISPDLVR	3902	sp|O09172|GSH0_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3152.20	53.01045	2	1743.886247	1743.879164	K	E	50	65
PSM	AAFGLSEAGFNTACLTK	3903	sp|Q8K2B3|SDHA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	14-UNIMOD:4	ms_run[1]:scan=1.1.3177.17	53.70613	2	1756.855647	1756.845421	R	L	76	93
PSM	LISWYDNEYGYSNR	3904	tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3031.19	49.59952	2	1778.798247	1778.790014	K	V	308	322
PSM	AEEYEFLTPMEEAPK	3905	sp|Q99PT1|GDIR1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3164.12	53.34708	2	1782.811847	1782.802218	R	G	153	168
PSM	IYGADDIELLPEAQNK	3906	sp|Q922D8|C1TC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3171.20	53.54015	2	1787.903447	1787.894145	R	A	833	849
PSM	AYHEQLTVAEITNACFEPANQMVK	3907	sp|P68373|TBA1C_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	15-UNIMOD:4	ms_run[1]:scan=1.1.3142.20	52.72223	3	2763.319571	2763.299637	K	C	281	305
PSM	TIGTGLVTDVPAMTEEDK	3908	sp|Q8BFR5|EFTU_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3073.20	50.78227	2	1875.919447	1875.913560	K	N	430	448
PSM	ETECTYFSTPLLLGKK	3909	sp|P08249|MDHM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	4-UNIMOD:4	ms_run[1]:scan=1.1.3007.12	48.94367	3	1885.949771	1885.949552	K	G	282	298
PSM	LCNPPVNAISPTVITEVR	3910	sp|Q9DBM2|ECHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	2-UNIMOD:4	ms_run[1]:scan=1.1.3155.21	53.09852	2	1979.066447	1979.050997	R	N	16	34
PSM	GNDQVRFELTCYSLAPQIK	3911	sp|P16460|ASSY_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	11-UNIMOD:4	ms_run[1]:scan=1.1.3144.13	52.77377	3	2238.121871	2238.110303	K	V	122	141
PSM	SHSNQLVTDCISAMNPDTVLR	3912	sp|Q9Z0S1|BPNT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	10-UNIMOD:4	ms_run[1]:scan=1.1.3039.20	49.82435	3	2357.121671	2357.110379	R	V	197	218
PSM	HTGPGILSMANAGPNTNGSQFFICTAK	3913	sp|P17742|PPIA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	24-UNIMOD:4	ms_run[1]:scan=1.1.3175.21	53.65258	3	2790.349571	2790.321769	K	T	92	119
PSM	GLVDKFPLFTAVYK	3914	sp|P13707|GPDA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3420.3	60.50178	3	1596.893171	1596.891566	K	V	314	328
PSM	EDILSFLEK	3915	sp|P53395|ODB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3540.5	63.84967	2	1092.571447	1092.570292	K	Q	203	212
PSM	LLLPWLEAR	3916	sp|Q68FD5|CLH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3562.4	64.48272	2	1109.658847	1109.659716	K	I	857	866
PSM	TDLALILSAGDN	3917	sp|P12658|CALB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3609.6	65.80027	2	1201.620647	1201.619033	R	-	250	262
PSM	SWAMLFASGGFK	3918	sp|Q99KP3|CRYL1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3505.5	62.86187	2	1300.629847	1300.627429	R	V	20	32
PSM	VDVHFCGVNFADILACR	3919	sp|Q3UNZ8|QORL2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	6-UNIMOD:4,16-UNIMOD:4	ms_run[1]:scan=1.1.3532.9	63.62312	3	1991.946371	1991.934587	R	G	56	73
PSM	MLELPEAFLAGR	3920	sp|O88533|DDC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3526.6	63.44772	2	1345.709247	1345.706408	K	A	125	137
PSM	ILTDIVWPVIAK	3921	sp|Q9DBL7|COASY_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3613.8	65.91705	2	1366.825447	1366.822424	K	L	438	450
PSM	LLIQSEFPSLLK	3922	sp|P97816|S100G_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3468.5	61.81612	2	1386.818247	1386.812253	K	A	34	46
PSM	NSNILEDLETLR	3923	sp|Q5XJY5|COPD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3462.5	61.65235	2	1415.732447	1415.725623	K	L	73	85
PSM	NTLFNLSNFLDK	3924	sp|Q61548|AP180_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3613.11	65.91956	2	1424.734047	1424.729980	R	S	101	113
PSM	AVLDVAETGTEAAAATGVIGGIR	3925	tr|A0A0R4J0I1|A0A0R4J0I1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1000663, ProteinPilot, ]	16		ms_run[1]:scan=1.1.3431.5	60.81148	3	2141.1423706434903	2141.1328115731994	K	K	361	384
PSM	FSLPSEAFYMIR	3926	sp|Q9QXN5|MIOX_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3575.14	64.85713	2	1459.723447	1459.716973	K	F	207	219
PSM	EEGWLAEHMLILGITNPEGK	3927	sp|Q9Z2V4|PCKGC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3629.12	66.38423	3	2236.134971	2236.119805	K	K	257	277
PSM	DIVLVAYGVLGTQR	3928	sp|Q91WR5|AK1CL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3591.12	65.29507	2	1502.853047	1502.845679	K	Y	210	224
PSM	TFGENYVQELLEK	3929	sp|Q9Z2Y8|PLPHP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3462.9	61.65737	2	1568.779647	1568.772239	R	A	64	77
PSM	DAVLNAWAEDVDLR	3930	sp|P52480|KPYM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3496.16	62.61517	2	1585.781247	1585.773636	K	V	476	490
PSM	LLGQFTLIGIPPAPR	3931	sp|P38647|GRP75_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3618.13	66.06627	2	1591.952047	1591.944999	K	G	499	514
PSM	LLGQFTLIGIPPAPR	3932	sp|P38647|GRP75_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3612.13	65.8925	2	1591.952047	1591.944999	K	G	499	514
PSM	VVLAYEPVWAIGTGK	3933	sp|P17751|TPIS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3420.17	60.51347	2	1601.891047	1601.881730	K	T	211	226
PSM	SFFPEEISSMVLTK	3934	sp|P17879|HS71B_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3620.11	66.12448	2	1613.811647	1613.801096	R	M	113	127
PSM	ISALQSAGVVVSMSPAQLGTTIYK	3935	sp|Q9WUM5|SUCA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3567.14	64.63158	3	2420.317571	2420.298497	K	E	315	339
PSM	EIWLAPPQFYEMR	3936	sp|P11930|NUD19_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3626.13	66.29812	2	1678.829247	1678.817749	K	R	232	245
PSM	AVFVDLEPTVIDEVR	3937	sp|P05213|TBA1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3481.17	62.18837	2	1700.910047	1700.898502	R	T	65	80
PSM	EFADSLGVPFLETSAK	3938	sp|Q9D1G1|RAB1B_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3566.16	64.60515	2	1709.866447	1709.851218	K	N	138	154
PSM	QLLQANPILEAFGNAK	3939	sp|O08638|MYH11_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3548.19	64.09373	2	1725.953647	1725.941370	K	T	217	233
PSM	VGLLEALLPGQPEAVAR	3940	sp|P51855|GSHB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3621.13	66.15504	2	1731.998847	1731.988320	R	L	314	331
PSM	TVFTEQPTWVIDPIDGTTNFVHR	3941	tr|A0A0A6YW07|A0A0A6YW07_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3576.13	64.89142	3	2672.349371	2672.323467	K	F	79	102
PSM	ILGTLALIDQSETDWK	3942	sp|Q91VM9|IPYR2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3528.16	63.51358	2	1801.955247	1801.946181	K	I	183	199
PSM	DMGMVTILVHNTASALR	3943	sp|P34914|HYES_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3532.21	63.63312	2	1827.948847	1827.933524	R	E	195	212
PSM	SLDWGWGQAISHQLLK	3944	sp|P28825|MEP1A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3450.5	61.31804	3	1837.952471	1837.947518	R	R	563	579
PSM	TYYMSAGLQPVPIVFR	3945	sp|Q9D051|ODPB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3534.20	63.68982	2	1840.962647	1840.954577	K	G	130	146
PSM	ILPNVPEVEDSTDFFK	3946	sp|Q8R0Y6|AL1L1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3475.18	62.0191	2	1848.929847	1848.914546	R	S	334	350
PSM	ILPNVPEVEDSTDFFK	3947	sp|Q8R0Y6|AL1L1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3471.18	61.90899	2	1848.929847	1848.914546	R	S	334	350
PSM	AYSEALAAFGNGALFVEK	3948	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3520.20	63.28677	2	1856.944647	1856.930865	R	F	220	238
PSM	TFVPMTENIYNAIIDK	3949	sp|O35488|S27A2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3605.21	65.69783	2	1867.954647	1867.938987	K	T	601	617
PSM	FALGISAINEAVDSGDVGR	3950	sp|Q9JKF1|IQGA1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3447.20	61.2476	2	1889.967047	1889.948306	R	T	623	642
PSM	RAGADIIITYFAPQLLK	3951	sp|P10518|HEM2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3618.3	66.05793	3	1889.075171	1889.077470	R	W	309	326
PSM	FFNQLFSGLDPHALAGR	3952	sp|Q9DBE0|CSAD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3505.4	62.86103	3	1888.967171	1888.958417	R	I	89	106
PSM	LQVELDSVTGLLSQSDSK	3953	sp|Q8VDD5|MYH9_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3477.21	62.07765	2	1918.002647	1917.989502	K	S	1278	1296
PSM	IAVIGQSLFGQEVYCQLR	3954	sp|Q8R0Y6|AL1L1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	15-UNIMOD:4	ms_run[1]:scan=1.1.3540.9	63.85302	3	2080.086671	2080.077546	K	K	3	21
PSM	KLPSDVTEGEVISLGLPFGK	3955	sp|P17225|PTBP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3416.10	60.3925	3	2085.142571	2085.135772	R	V	64	84
PSM	DVQFAVQQVLQEEHFDAR	3956	sp|Q8R146|APEH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3437.3	60.9662	3	2158.048571	2158.044332	K	R	562	580
PSM	FAELVYTGFWHSPECEFVR	3957	sp|P16460|ASSY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	15-UNIMOD:4	ms_run[1]:scan=1.1.3476.15	62.0445	3	2373.104171	2373.088839	K	H	317	336
PSM	GVDDLDFFIGDEAIEKPTYATK	3958	sp|Q99JY9|ARP3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3456.19	61.50089	3	2443.199771	2443.179488	K	W	54	76
PSM	LVTSPCCIVTSTYGWTANMER	3959	sp|P07901|HS90A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	6-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=1.1.3418.16	60.45522	3	2445.126371	2445.112688	R	I	593	614
PSM	SGPFGQIFRPDNFVFGQSGAGNNWAK	3960	sp|P68372|TBB4B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3539.20	63.83345	3	2797.363871	2797.336097	R	G	78	104
PSM	CSYDEHAK	3961	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1804.19	15.49422	2	991.3633	991.3700	K	L	58	66
PSM	HGSIIYHPSLLPR	3962	sp|Q8K009|AL1L2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2403.11	32.10358	3	1488.816071	1488.820132	K	H	122	135
PSM	EIAEAYLGK	3963	sp|P63017|HSP7C_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2403.11	32.10358	2	992.513047	992.517862	K	T	129	138
PSM	GYENGNFVGPTIISNVKPSMTCYK	3964	sp|Q9EQ20|MMSA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	22-UNIMOD:4	ms_run[1]:scan=1.1.3144.19	52.77877	3	2676.274571	2675.272359	K	E	392	416
PSM	QFYPDLIR	3965	sp|P17563|SBP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:28	ms_run[1]:scan=1.1.3598.3	65.4819	2	1033.5192	1033.5228	K	E	412	420
PSM	IGIEIIK	3966	sp|P63038|CH60_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2686.2	39.93253	2	784.498447	784.505841	K	R	463	470
PSM	LLEACTFHKH	3967	sp|Q921I1|TRFE_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	5-UNIMOD:4	ms_run[1]:scan=1.1.1903.10	18.25587	3	1255.616471	1254.617927	R	-	688	698
PSM	ANHAPFETDISTLTR	3968	sp|Q9QXD6|F16P1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1	ms_run[1]:scan=1.1.3088.7	51.19888	3	1713.8339	1713.8317	M	F	2	17
PSM	ARPFPDGLAEDIDKGEVSAR	3969	sp|P58252|EF2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	16		ms_run[1]:scan=1.1.2740.21	41.46488	3	2143.0842	2142.0702	K	Q	606	626
PSM	CLYASVLTAQPR	3970	sp|P58252|EF2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.3592.6	65.3177	2	1360.6863	1360.6804	R	L	728	740
PSM	VLAAVYK	3971	tr|A6ZI46|A6ZI46_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2091.6	23.46143	2	762.457447	762.463976	K	A	264	271
PSM	TAVCDIPPR	3972	sp|P68372|TBB4B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	4-UNIMOD:4	ms_run[1]:scan=1.1.2101.12	23.7387	2	1028.513447	1027.512065	K	G	351	360
PSM	QHGIPIPVTPK	3973	sp|P16460|ASSY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:28	ms_run[1]:scan=1.1.2703.15	40.41387	2	1168.6605	1168.6599	K	S	166	177
PSM	MWITNGGK	3974	sp|P45952|ACADM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2266.6	28.32242	2	906.445047	905.442923	K	A	190	198
PSM	FIVFNSK	3975	sp|P21995|EMB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2664.3	39.32093	2	853.464047	853.469790	R	Q	132	139
PSM	YFDSFGDLSSASAIMGNAK	3976	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3568.21	64.66547	2	1980.895247	1979.893493	R	V	42	61
PSM	AYGIESHVLSPAETK	3977	sp|Q99LB7|SARDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2423.14	32.66063	3	1600.806971	1600.809687	K	S	175	190
PSM	MQQVEASLQPETLRK	3978	sp|P07759|SPA3K_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:35	ms_run[1]:scan=1.1.2264.15	28.2745	3	1772.906471	1772.909084	R	W	283	298
PSM	TNQETIISHR	3979	sp|A2ARV4|LRP2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1817.10	15.85247	3	1197.601271	1197.610199	K	L	3261	3271
PSM	GVVPLAGTNGETTTQGLDGLSER	3980	tr|A6ZI46|A6ZI46_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3081.16	51.00477	3	2272.130171	2271.134269	K	C	167	190
PSM	ALSDHHVYLEGTLLKPNMVTPGHACTQK	3981	tr|A6ZI46|A6ZI46_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	25-UNIMOD:4	ms_run[1]:scan=1.1.2608.17	37.78119	5	3116.571118	3116.553560	K	F	271	299
PSM	SDGKIDVSVEAASGGK	3982	sp|O08749|DLDH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2168.16	25.62185	3	1518.767471	1518.752566	K	A	285	301
PSM	ASSHTVLMR	3983	sp|Q9Z0S1|BPNT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1	ms_run[1]:scan=1.1.2174.17	25.79417	2	1042.5183	1042.5224	M	L	2	11
PSM	AESFFQTK	3984	sp|Q8R146|APEH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2303.11	29.3475	2	956.454847	956.460347	K	A	173	181
PSM	QGLLGINIAEK	3985	tr|A0A0R4J083|A0A0R4J083_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:28	ms_run[1]:scan=1.1.3539.4	63.8201	2	1137.6375	1137.6388	K	H	96	107
PSM	SNNGLAVHIFLCNSSMENR	3986	sp|O09173|HGD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	12-UNIMOD:4	ms_run[1]:scan=1.1.3105.13	51.67965	3	2163.002471	2161.999707	K	C	127	146
PSM	VIVVGNPANTNCLTASK	3987	sp|P14152|MDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	12-UNIMOD:4	ms_run[1]:scan=1.1.2723.21	40.99263	2	1757.907647	1756.914169	K	S	126	143
PSM	QGTFHSQQALEYGTK	3988	sp|Q9WUM5|SUCA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:28	ms_run[1]:scan=1.1.2493.19	34.58121	2	1676.7821	1676.7789	K	L	67	82
PSM	FLASVSTVLTSK	3989	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3007.11	48.94283	2	1251.707847	1251.707454	K	Y	129	141
PSM	VVQDLCK	3990	sp|Q99LC5|ETFA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	6-UNIMOD:4	ms_run[1]:scan=1.1.1826.12	16.1091	2	860.444847	860.442589	K	V	63	70
PSM	KVEFVSELPK	3991	sp|Q91VA0|ACSM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2428.17	32.80355	2	1174.657047	1174.659775	R	T	545	555
PSM	SADAAAGEPLPR	3992	sp|P70441|NHRF1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1	ms_run[1]:scan=1.1.2557.11	36.35308	2	1195.5793	1195.5828	M	L	2	14
PSM	RIPQSTLSEFYPR	3993	sp|P62814|VATB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2721.4	40.9212	3	1593.820871	1592.831091	K	D	494	507
PSM	AAGTLYTYPENWR	3994	sp|Q9D8N0|EF1G_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1	ms_run[1]:scan=1.1.3440.9	61.04975	2	1582.7552	1582.7412	M	A	2	15
PSM	AGQAFRK	3995	sp|Q64433|CH10_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1	ms_run[1]:scan=1.1.1861.8	17.083	2	818.4326	818.4394	M	F	2	9
PSM	FLTATSLAR	3996	sp|Q9WVM8|AADAT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2515.8	35.18533	2	978.545047	978.549831	R	K	6	15
PSM	ATSASSHLNK	3997	sp|P15105|GLNA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1	ms_run[1]:scan=1.1.1806.17	15.5488	2	1056.5142	1056.5195	M	G	2	12
PSM	EAVTFLR	3998	sp|Q9D2G2|ODO2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2463.4	33.74595	2	834.452047	834.459953	R	K	432	439
PSM	FQHYMVGPK	3999	sp|P40936|INMT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2057.3	22.51713	3	1105.532771	1105.537886	R	K	202	211
PSM	SSSRPVALVTGANK	4000	sp|P48758|CBR1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1	ms_run[1]:scan=1.1.2368.19	31.143	2	1427.7755	1427.7727	M	G	2	16
PSM	HLYTLDGGDIINALCFSPNR	4001	sp|P68040|RACK1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	15-UNIMOD:4	ms_run[1]:scan=1.1.3536.11	63.73958	3	2275.120871	2275.105552	K	Y	226	246
PSM	NYYEQWGK	4002	sp|O88569|ROA2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2370.16	31.19353	2	1086.471647	1086.477060	R	L	39	47
PSM	CLAFHDISPQAPTHFLVIPK	4003	sp|P70349|HINT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.3550.10	64.14323	3	2273.1872	2273.1662	R	K	38	58
PSM	TYIIGELHPDDR	4004	sp|P56395|CYB5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2568.17	36.66587	2	1428.696047	1427.704494	K	S	78	90
PSM	AGKPVLHYFDGR	4005	sp|P30115|GSTA3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1	ms_run[1]:scan=1.1.2613.4	37.90923	3	1400.7164	1400.7196	M	G	2	14
PSM	IHTLEDFQR	4006	sp|O08756|HCD2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2236.3	27.49645	3	1157.584571	1157.582922	K	V	108	117
PSM	TLAMDTILANAR	4007	sp|O88958|GNPI1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3059.12	50.37868	2	1288.670847	1288.680921	K	F	161	173
PSM	ATNFLAHEK	4008	sp|P57776|EF1D_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1	ms_run[1]:scan=1.1.2507.9	34.95985	2	1071.5321	1071.5344	M	I	2	11
PSM	LCSIPIHGIR	4009	sp|O55023|IMPA1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	2-UNIMOD:4	ms_run[1]:scan=1.1.2409.2	32.26263	3	1164.643571	1164.643748	K	S	182	192
PSM	IINTPEVVR	4010	sp|Q9WVK4|EHD1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2328.12	30.04368	2	1039.597047	1039.602595	K	V	243	252
PSM	DGNGYISAAELR	4011	sp|P0DP26|CALM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2692.12	40.10288	2	1264.606447	1264.604780	K	H	96	108
PSM	PALLHSTFFPALQGAQTK	4012	sp|P32921|SYWC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.3070.12	50.68973	3	1926.039971	1926.036333	K	M	336	354
PSM	LTPLSHEVISR	4013	sp|Q9Z0N1|IF2G_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2227.10	27.25788	3	1251.707771	1250.698286	K	Q	28	39
PSM	FLEQQNQVLQTK	4014	sp|P04104|K2C1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2471.16	33.97097	2	1475.773647	1474.777993	R	W	208	220
PSM	VKGDVDVSLPK	4015	tr|E9Q616|E9Q616_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2192.7	26.29295	3	1155.651671	1155.649939	K	V	1332	1343
PSM	DSDILGK	4016	sp|Q64433|CH10_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2031.8	21.81123	2	748.381247	746.381034	R	Y	93	100
PSM	GATQQILDEAER	4017	sp|P80314|TCPB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2486.15	34.38145	2	1328.641247	1329.652458	R	S	377	389
PSM	VRPCVVYGGAEIGQQIR	4018	sp|Q62167|DDX3X_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16	4-UNIMOD:4	ms_run[1]:scan=1.1.2580.10	36.99753	3	1899.984071	1900.994151	R	D	295	312
PSM	LAANAFLAQR	4019	sp|O70475|UGDH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2587.12	37.19235	2	1072.585047	1073.598178	K	I	221	231
PSM	MEIQEIQLK	4020	sp|P58771|TPM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.2781.11	42.59673	2	1131.597047	1130.600546	K	E	141	150
PSM	LSDHPDVR	4021	sp|Q8R0Y6|AL1L1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1728.4	13.36103	3	937.453571	937.461744	R	K	637	645
PSM	KYEATLEK	4022	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1742.7	13.75272	3	980.508671	980.517862	K	C	376	384
PSM	VAANAPK	4023	sp|Q68FD5|CLH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1587.4	9.47115	2	669.378847	669.380974	K	G	383	390
PSM	LAADVGK	4024	sp|P48962|ADT1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1745.6	13.83333	2	672.374047	672.380640	R	G	141	148
PSM	AAICSGK	4025	sp|P16858|G3P_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	4-UNIMOD:4	ms_run[1]:scan=1.1.1599.4	9.807683	2	705.345647	705.347960	R	V	19	26
PSM	LETPSAK	4026	sp|P51174|ACADL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1754.10	14.08683	2	744.395847	744.401770	R	K	36	43
PSM	SEGEIAR	4027	sp|Q61598|GDIB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1663.6	11.56845	2	760.366047	760.371532	K	C	270	277
PSM	ATAEQLK	4028	sp|P07724|ALBU_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1670.7	11.76205	2	759.407047	759.412669	K	T	563	570
PSM	YDDIKK	4029	tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1608.11	10.05573	2	780.395047	780.401770	K	V	253	259
PSM	HIYIDK	4030	sp|Q9WUM5|SUCA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1763.8	14.33827	2	787.415447	787.422839	K	N	49	55
PSM	VTAQDVR	4031	sp|P26041|MOES_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1710.9	12.87758	2	787.421047	787.418817	K	K	65	72
PSM	NVLHSAR	4032	sp|P97807|FUMH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1626.11	10.55628	2	795.428247	795.435135	K	L	412	419
PSM	ALFHSAR	4033	sp|P47199|QOR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1754.13	14.08933	2	800.422447	800.429322	R	A	139	146
PSM	TMGCLATTHSK	4034	sp|P61922|GABT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	4-UNIMOD:4	ms_run[1]:scan=1.1.1761.15	14.2882	3	1205.545871	1205.553278	R	A	221	232
PSM	NMEAGAGR	4035	sp|Q8VC30|TKFC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1628.17	10.61657	2	804.347447	804.354836	K	A	536	544
PSM	LAEQAER	4036	sp|O70456|1433S_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1647.14	11.13207	2	815.406047	815.413731	K	Y	12	19
PSM	SPEDLEK	4037	sp|P06745|G6PI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1762.9	14.31123	2	816.378447	816.386513	K	L	455	462
PSM	HLAGEVAK	4038	sp|Q8VDM4|PSMD2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1642.14	10.9925	2	823.447847	823.455202	R	E	161	169
PSM	QKPITPETAEK	4039	sp|P60766|CDC42_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1729.13	13.3958	3	1240.658471	1240.666317	K	L	134	145
PSM	ACQIAHDHTDHVIR	4040	sp|Q64462|CP4B1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	2-UNIMOD:4	ms_run[1]:scan=1.1.1749.13	13.94898	4	1671.783294	1671.789972	R	Q	249	263
PSM	TMVVHEK	4041	sp|P08228|SODC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1639.12	10.90853	2	842.425447	842.432024	R	Q	117	124
PSM	VSQLQER	4042	sp|Q9D0F9|PGM1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1716.10	13.04523	2	858.448447	858.455930	K	T	546	553
PSM	ETIEQEK	4043	tr|A2AEH9|A2AEH9_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1662.16	11.54887	2	875.417447	875.423627	K	E	67	74
PSM	KIVDEAVK	4044	sp|Q99NB1|ACS2L_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1739.14	13.67633	2	900.522647	900.528033	K	S	226	234
PSM	LQDYEQK	4045	sp|P26040|EZRI_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1752.14	14.03373	2	922.431847	922.439612	R	T	351	358
PSM	TEELGHPR	4046	sp|Q91VM9|IPYR2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1654.16	11.32905	2	937.454847	937.461744	R	S	32	40
PSM	TRFQESEERPK	4047	sp|Q61316|HSP74_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15		ms_run[1]:scan=1.1.1686.15	12.21453	3	1405.6850	1405.6945	K	L	688	699
PSM	EVDEYCK	4048	sp|Q64442|DHSO_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	6-UNIMOD:4	ms_run[1]:scan=1.1.1754.17	14.09267	2	941.375247	941.380048	R	I	101	108
PSM	IAGQVAAANK	4049	sp|Q9CZX8|RS19_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1729.19	13.40082	2	941.520647	941.529430	R	K	134	144
PSM	DREAAEGLGSHER	4050	sp|O08529|CAN2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1705.16	12.74677	3	1425.654371	1425.659669	K	A	11	24
PSM	TSATDLQTK	4051	sp|Q9Z0S1|BPNT1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1755.19	14.12243	2	963.480647	963.487290	K	A	41	50
PSM	KEECPAVR	4052	sp|P09103|PDIA1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	4-UNIMOD:4	ms_run[1]:scan=1.1.1631.11	10.69853	2	987.473247	987.480765	K	L	311	319
PSM	DTGNIGQER	4053	sp|Q62261|SPTB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1751.18	14.009	2	988.455247	988.457387	R	V	1746	1755
PSM	DATNDQVTK	4054	sp|O88844|IDHC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1634.21	10.78053	2	990.453447	990.461804	R	D	50	59
PSM	DSETGENIR	4055	sp|P38647|GRP75_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1768.18	14.48678	2	1019.446847	1019.451967	K	Q	626	635
PSM	NIIHGSDSVK	4056	sp|P15532|NDKA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1769.18	14.51475	2	1068.550247	1068.556373	R	S	115	125
PSM	KVNVVEQEK	4057	sp|P17182|ENOA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1678.17	11.99097	2	1071.585247	1071.592424	K	I	81	90
PSM	EEFEHQQK	4058	sp|P63017|HSP7C_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1623.17	10.47718	2	1073.470847	1073.477788	K	E	590	598
PSM	LQGATCSNNK	4059	sp|Q9JHU4|DYHC1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	6-UNIMOD:4	ms_run[1]:scan=1.1.1584.5	9.3951	2	1091.495847	1091.502957	K	L	4563	4573
PSM	SASPDHTCIK	4060	sp|Q91VA0|ACSM1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	8-UNIMOD:4	ms_run[1]:scan=1.1.1658.20	11.44165	2	1114.502447	1114.507708	K	S	201	211
PSM	HAEMVHTGLK	4061	sp|P40124|CAP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1732.20	13.48457	2	1121.556047	1121.565163	K	L	71	81
PSM	AYSEAHEISK	4062	sp|P61982|1433G_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1723.21	13.23845	2	1133.530047	1133.535303	K	E	153	163
PSM	VENTEENRR	4063	sp|Q91Y97|ALDOB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1565.18	8.868667	2	1145.538247	1145.542514	K	Q	49	58
PSM	VEYTEEERK	4064	sp|P16331|PH4H_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1698.21	12.5573	2	1181.548247	1181.556432	R	T	177	186
PSM	KPVHPNDHVNK	4065	sp|P97807|FUMH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1566.13	8.892217	3	1283.664971	1283.673468	K	S	170	181
PSM	EESGKPGAHVTVK	4066	sp|O88569|ROA2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1645.15	11.07672	3	1337.685671	1337.693929	R	K	100	113
PSM	HVETNSCDVQR	4067	sp|Q62468|VILI_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	7-UNIMOD:4	ms_run[1]:scan=1.1.1650.21	11.22228	2	1343.580247	1343.588812	K	L	128	139
PSM	AQPSQAAEEPAEK	4068	sp|Q9R1P4|PSA1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1759.20	14.23577	2	1354.630047	1354.636474	K	A	244	257
PSM	LIGDAAK	4069	sp|P16627|HS71L_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1773.4	14.61577	2	686.389447	686.396290	R	N	52	59
PSM	HVAFLK	4070	sp|Q91XE4|ACY3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1907.6	18.36165	2	713.416247	713.422445	K	S	291	297
PSM	MGHAGAIIAGGK	4071	sp|Q9WUM5|SUCA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1855.8	16.91605	3	1081.562771	1081.570249	R	G	297	309
PSM	ALVSSVR	4072	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1896.7	18.06062	2	730.427447	730.433738	K	Q	213	220
PSM	FLEEAK	4073	sp|P07758|A1AT1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1921.11	18.7508	2	735.373647	735.380306	K	N	148	154
PSM	EIASVVK	4074	sp|P05202|AATM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1945.5	19.41295	2	744.439647	744.438155	K	K	228	235
PSM	LPCVAAK	4075	tr|Q80X68|Q80X68_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	3-UNIMOD:4	ms_run[1]:scan=1.1.1950.6	19.55323	2	757.408647	757.415646	K	I	209	216
PSM	LAAQLDK	4076	sp|Q5U5V2|HYKK_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1863.7	17.13845	2	757.427247	757.433404	R	A	153	160
PSM	SVTAPYK	4077	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1833.5	16.29973	2	764.401047	764.406855	K	Y	534	541
PSM	TEVHESYYK	4078	sp|Q9R0H0|ACOX1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1793.8	15.17608	3	1154.515871	1154.524404	K	H	644	653
PSM	RIPGNNNFVK	4079	sp|Q64516|GLPK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1937.9	19.19848	3	1157.621171	1157.630541	K	S	129	139
PSM	TREEIQEVR	4080	sp|P35486|ODPA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1778.10	14.75997	3	1158.588671	1158.599300	R	S	303	312
PSM	ICDQLK	4081	sp|P13707|GPDA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	2-UNIMOD:4	ms_run[1]:scan=1.1.1829.8	16.19045	2	775.383247	775.389825	K	G	101	107
PSM	LAEAGYR	4082	sp|Q8VCR7|ABHEB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1812.10	15.7123	2	778.390447	778.397353	R	A	57	64
PSM	YEEIVK	4083	sp|P10126|EF1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1953.12	19.64277	2	779.400047	779.406521	R	E	167	173
PSM	YEEIVK	4084	sp|P10126|EF1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1947.8	19.47088	2	779.400047	779.406521	R	E	167	173
PSM	DMAAVQR	4085	sp|P37804|TAGL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1822.9	15.99345	2	789.381247	789.380323	K	T	122	129
PSM	ALYVSDK	4086	sp|Q8R0Y6|AL1L1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1917.12	18.64025	2	794.409847	794.417420	K	L	846	853
PSM	QLDALNK	4087	sp|Q9JII6|AK1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1911.8	18.47263	2	800.434047	800.439218	K	N	288	295
PSM	VQQLVPK	4088	sp|P57780|ACTN4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1000663, ProteinPilot, ]	15		ms_run[1]:scan=1.1.1951.11	19.58555	2	810.48884709566	810.4963383602199	K	R	627	634
PSM	IEQLSSR	4089	sp|Q99KR3|LACB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1800.13	15.37645	2	831.437847	831.445031	R	V	8	15
PSM	VVFEQTK	4090	sp|P17751|TPIS_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1930.10	19.00278	2	849.454647	849.459619	K	V	193	200
PSM	TAVAPIER	4091	sp|P48962|ADT1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1955.11	19.69875	2	855.474447	855.481417	K	V	24	32
PSM	ETGVDLTK	4092	sp|P38647|GRP75_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1957.12	19.75658	2	861.441047	861.444363	R	D	293	301
PSM	YSALEQR	4093	sp|Q3TNA1|XYLB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1869.13	17.31378	2	865.422247	865.429381	R	I	535	542
PSM	RVLIAAHGNSLR	4094	sp|Q9DBJ1|PGAM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1874.14	17.4546	3	1305.757571	1305.762952	K	G	180	192
PSM	EQALAVSR	4095	sp|P62814|VATB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1907.13	18.3675	2	872.466247	872.471580	R	N	30	38
PSM	IIEVSGQK	4096	sp|Q91V41|RAB14_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1890.12	17.89595	2	872.493047	872.496733	R	I	52	60
PSM	SCALSNVK	4097	sp|Q8R0Y6|AL1L1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	2-UNIMOD:4	ms_run[1]:scan=1.1.1809.15	15.63212	2	877.425447	877.432752	K	K	661	669
PSM	ALLNNSHYYHMAHGK	4098	sp|O08749|DLDH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1964.12	19.95343	4	1754.833294	1754.831108	K	D	90	105
PSM	LEENLNR	4099	sp|Q9DCU9|HOGA1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1866.14	17.2297	2	886.446247	886.450845	K	L	51	58
PSM	VCLLHEK	4100	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	2-UNIMOD:4	ms_run[1]:scan=1.1.1839.16	16.47643	2	897.468847	897.474223	R	T	484	491
PSM	SGYLSSER	4101	sp|P26040|EZRI_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1858.13	17.0038	2	897.411047	897.419211	K	L	144	152
PSM	GADINAPDK	4102	sp|P62774|MTPN_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1788.14	15.04367	2	899.429447	899.434861	K	H	58	67
PSM	INYTENR	4103	sp|P06745|G6PI_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1804.13	15.48922	2	908.427447	908.435195	K	A	90	97
PSM	AEMDAAVESCKR	4104	sp|Q9EQ20|MMSA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	10-UNIMOD:4	ms_run[1]:scan=1.1.1868.14	17.28645	3	1365.598871	1365.601685	K	A	77	89
PSM	AEMDAAVESCKR	4105	sp|Q9EQ20|MMSA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	10-UNIMOD:4	ms_run[1]:scan=1.1.1872.12	17.3972	3	1365.598871	1365.601685	K	A	77	89
PSM	KGYFEDR	4106	sp|P15105|GLNA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1818.15	15.88495	2	913.424247	913.429381	K	R	334	341
PSM	NIQLEDGK	4107	sp|Q8R0Y6|AL1L1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1963.12	19.92557	2	915.462047	915.466161	K	M	291	299
PSM	RVLVYGGR	4108	sp|Q8BVI4|DHPR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1882.13	17.67433	2	918.535047	918.539935	R	G	9	17
PSM	GDASKEDIDTAMK	4109	sp|Q61425|HCDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1957.16	19.75992	3	1379.619071	1379.623860	R	L	237	250
PSM	DTDGHLIR	4110	sp|Q9JIL4|NHRF3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1813.14	15.74348	2	925.453847	925.461744	K	V	29	37
PSM	DTDGHLIR	4111	sp|Q9JIL4|NHRF3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1819.14	15.91253	2	925.453847	925.461744	K	V	29	37
PSM	LIAEGTAPR	4112	sp|Q8R0Y6|AL1L1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1962.10	19.89603	2	926.512447	926.518531	R	R	182	191
PSM	GPSSVEDIK	4113	sp|Q61937|NPM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1937.18	19.206	2	930.461047	930.465826	K	A	238	247
PSM	HNQGLAFR	4114	sp|Q91VA0|ACSM1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1858.14	17.00463	2	941.478647	941.483148	K	S	234	242
PSM	HPYEVAIK	4115	sp|Q9DBM2|ECHP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1951.18	19.59138	2	955.506447	955.512717	K	E	241	249
PSM	VTDALNATR	4116	sp|P63038|CH60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1930.16	19.0078	2	959.500447	959.503609	R	A	421	430
PSM	RLAEDGAHVVVSSR	4117	sp|Q99LB2|DHRS4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1940.18	19.28757	3	1494.790871	1494.790289	R	K	52	66
PSM	ETPQEIASK	4118	sp|Q64442|DHSO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1873.16	17.4285	2	1001.499847	1001.502940	K	V	227	236
PSM	LLQATHAIR	4119	sp|Q8BH86|GLUCM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1923.3	18.7998	3	1021.597871	1021.603263	R	G	179	188
PSM	LVEPGSPAEK	4120	sp|P70441|NHRF1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1935.16	19.14788	2	1025.535647	1025.539326	R	S	41	51
PSM	AHIAQLCEK	4121	sp|Q68FD5|CLH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	7-UNIMOD:4	ms_run[1]:scan=1.1.1796.21	15.27035	2	1068.531447	1068.538614	R	A	611	620
PSM	YHLGMYHR	4122	sp|Q60597|ODO1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1943.4	19.35743	3	1075.499471	1075.502169	K	R	349	357
PSM	HSGPNSADSANDGFVR	4123	sp|Q9Z2X1|HNRPF_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1926.18	18.89628	3	1629.714371	1629.713161	K	L	99	115
PSM	TVVPCCSGPK	4124	sp|P28271|ACOC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	5-UNIMOD:4,6-UNIMOD:4	ms_run[1]:scan=1.1.1938.19	19.2341	2	1103.509647	1103.510351	K	R	365	375
PSM	LYHVSDSEGK	4125	sp|Q62468|VILI_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1790.20	15.10335	2	1133.530047	1133.535303	K	L	255	265
PSM	ESNCYDPER	4126	sp|Q68FD5|CLH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	4-UNIMOD:4	ms_run[1]:scan=1.1.1850.20	16.78797	2	1168.441647	1168.445502	R	V	750	759
PSM	DGASEEETNLSK	4127	sp|Q8VCT4|CES1D_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1942.17	19.3427	2	1278.557447	1278.557555	K	M	481	493
PSM	ALVADSHPESER	4128	sp|Q62261|SPTB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1811.21	15.69355	2	1309.623447	1309.626243	R	I	1657	1669
PSM	ASNGDAWVEAHGK	4129	sp|P38647|GRP75_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1929.21	18.98373	2	1340.610247	1340.610928	R	L	147	160
PSM	RAGELTEDEVER	4130	tr|A0A1Y7VKY1|A0A1Y7VKY1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1945.21	19.4263	2	1402.669647	1402.668836	K	V	55	67
PSM	IHAEGLGYR	4131	sp|Q3TNA1|XYLB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1966.4	20.00272	3	1014.515171	1014.524679	R	V	436	445
PSM	RPEFQALR	4132	sp|Q99JW2|ACY1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2033.4	21.8629	3	1015.551071	1015.556313	K	A	161	169
PSM	VHPISTMIK	4133	sp|P06151|LDHA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2061.4	22.62815	3	1024.564271	1024.573937	R	G	270	279
PSM	AKWDSWNK	4134	sp|P31786|ACBP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2120.2	24.25867	3	1033.489571	1033.498130	K	L	54	62
PSM	DAAITLK	4135	sp|Q5FWK3|RHG01_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2138.4	24.76165	2	730.428847	730.422505	K	A	405	412
PSM	DGVDFGK	4136	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2084.9	23.26708	2	736.332847	736.339169	K	W	141	148
PSM	IGIMPGHIHK	4137	sp|Q9WUM5|SUCA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1989.8	20.63998	3	1101.603971	1101.611720	K	K	183	193
PSM	LNLVQR	4138	tr|A0A1B0GSX0|A0A1B0GSX0_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1000663, ProteinPilot, ]	15		ms_run[1]:scan=1.1.2083.4	23.23523	2	741.44364709566	741.4497225209699	R	N	136	142
PSM	LNLVQR	4139	sp|P06151|LDHA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2076.6	23.0452	2	741.443647	741.449723	R	N	107	113
PSM	LVEIAAK	4140	sp|Q9R0H0|ACOX1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2032.6	21.8372	2	742.452447	742.458890	R	N	494	501
PSM	SAQLGFK	4141	sp|O08749|DLDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2020.6	21.50468	2	749.399847	749.407189	K	T	60	67
PSM	LSVDYGK	4142	sp|P05213|TBA1B_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2063.8	22.6869	2	780.395847	780.401770	R	K	157	164
PSM	YQQLIK	4143	sp|Q9EQ20|MMSA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2016.4	21.39428	2	791.448047	791.454139	R	E	108	114
PSM	IIAPPER	4144	tr|E9Q3M9|E9Q3M9_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2016.5	21.39512	2	794.459847	794.465038	R	D	477	484
PSM	IIAPPER	4145	tr|E9Q3M9|E9Q3M9_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2018.7	21.4512	2	794.459847	794.465038	R	D	477	484
PSM	ACTIAIR	4146	sp|Q9R0H0|ACOX1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	2-UNIMOD:4	ms_run[1]:scan=1.1.2032.9	21.8397	2	803.425247	803.432358	K	Y	296	303
PSM	VGVNGFGR	4147	tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2141.7	24.84975	2	804.418847	804.424236	K	I	4	12
PSM	VGVNGFGR	4148	tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2135.6	24.67762	2	804.418847	804.424236	K	I	4	12
PSM	YNQILR	4149	sp|P17182|ENOA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2027.8	21.69952	2	805.438847	805.444637	K	I	407	413
PSM	GKLDGNQDLIR	4150	sp|P54071|IDHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2081.9	23.18475	3	1227.649571	1227.657149	R	F	383	394
PSM	VTSELLR	4151	sp|Q6P1B1|XPP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2109.9	23.95673	2	816.463847	816.470518	K	Q	5	12
PSM	NTEISFK	4152	sp|O08716|FABP9_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2128.6	24.48213	2	837.415647	837.423233	R	L	60	67
PSM	VHAYIISSLKK	4153	sp|Q9QXY6|EHD3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2105.6	23.84463	3	1257.733871	1257.744508	K	E	306	317
PSM	EVSTYIK	4154	sp|P10126|EF1A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2030.12	21.78667	2	838.437047	838.443634	K	K	173	180
PSM	ITFQESK	4155	sp|Q9JHW2|NIT2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1969.10	20.09243	2	851.431647	851.438883	K	T	124	131
PSM	GANPVEIR	4156	sp|P63038|CH60_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2005.13	21.09393	2	854.456447	854.461016	K	R	134	142
PSM	PAIDVVDK	4157	sp|Q920A5|RISC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2160.9	25.38963	2	855.467047	855.470183	K	L	348	356
PSM	EGPEGFAR	4158	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1989.13	20.64415	2	861.392647	861.398081	R	A	548	556
PSM	IDIVENR	4159	sp|P16460|ASSY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2131.10	24.568	2	857.454247	857.460681	R	F	266	273
PSM	AFAAGADIK	4160	sp|Q8BH95|ECHM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2116.11	24.15272	2	862.451047	862.454868	K	E	93	102
PSM	SRNDQVVTDLR	4161	sp|Q91YI0|ARLY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2011.12	21.26382	3	1301.661971	1301.668777	R	L	112	123
PSM	YGAATFTR	4162	sp|Q61838|PZP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2088.10	23.38052	2	885.430247	885.434467	K	S	1282	1290
PSM	TIQATLSR	4163	sp|Q9D826|SOX_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2039.10	22.03207	2	887.504647	888.502881	K	Q	105	113
PSM	IITSTLEK	4164	sp|Q9DBM2|ECHP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2093.5	23.51488	2	903.520847	903.527698	K	E	337	345
PSM	KLTDIGIR	4165	tr|A0A0R4J083|A0A0R4J083_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2148.9	25.0493	2	914.547647	914.554916	K	R	43	51
PSM	EDIDTAMK	4166	sp|Q61425|HCDH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2034.15	21.89945	2	921.406047	921.411348	K	L	242	250
PSM	SCEEFMK	4167	sp|P12658|CALB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	2-UNIMOD:4	ms_run[1]:scan=1.1.1997.14	20.86818	2	929.356647	929.362290	K	T	99	106
PSM	VAVNGVHLHYQR	4168	sp|Q8R164|BPHL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2058.13	22.55272	3	1391.730671	1391.742216	K	V	44	56
PSM	YLAEVACGDDRK	4169	sp|P68254|1433T_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	7-UNIMOD:4	ms_run[1]:scan=1.1.2010.14	21.2371	3	1395.642071	1395.645264	R	Q	128	140
PSM	NMGLYGER	4170	sp|P05202|AATM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2160.13	25.39297	2	938.422047	938.428001	K	V	280	288
PSM	SSETAAFVK	4171	sp|Q920A5|RISC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2011.16	21.26715	2	938.462047	938.470912	K	S	408	417
PSM	YLSNAYAR	4172	sp|Q9Z1Q5|CLIC1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2012.14	21.2929	2	956.465847	956.471580	R	E	209	217
PSM	AIVVTDGER	4173	sp|P06801|MAOX_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2017.14	21.42982	2	958.501247	958.508360	K	I	147	156
PSM	AADAVEDLR	4174	sp|Q9WVE8|PACN2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2126.12	24.43278	2	958.465447	958.471974	K	W	276	285
PSM	RVTLELGGK	4175	sp|P47738|ALDH2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15		ms_run[1]:scan=1.1.2038.14	22.00793	2	971.5694	971.5759	K	S	283	292
PSM	CIEEAIDK	4176	sp|P15105|GLNA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	1-UNIMOD:4	ms_run[1]:scan=1.1.2063.15	22.69275	2	976.449847	976.453547	K	L	269	277
PSM	LLADQAEAR	4177	sp|P84099|RL19_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1971.16	20.15327	2	985.513847	985.519259	K	R	154	163
PSM	ALELEQER	4178	sp|P26041|MOES_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1000663, ProteinPilot, ]	15		ms_run[1]:scan=1.1.2135.14	24.6843	2	986.49724709566	986.5032742154599	R	K	372	380
PSM	ALQLEEER	4179	sp|P26040|EZRI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1000663, ProteinPilot, ]	15		ms_run[1]:scan=1.1.2128.12	24.48715	2	986.49724709566	986.5032742154598	K	R	372	380
PSM	KYEEIDNAPEER	4180	sp|Q8BFR5|EFTU_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1968.14	20.06758	3	1491.681071	1491.684152	K	A	91	103
PSM	YYSIASSSK	4181	sp|P37040|NCPR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2020.17	21.51387	2	1004.477247	1004.481476	R	V	455	464
PSM	HELQANCYEEVK	4182	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	7-UNIMOD:4	ms_run[1]:scan=1.1.2036.12	21.95145	3	1518.675371	1518.677293	K	D	133	145
PSM	AGTHILCIK	4183	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	7-UNIMOD:4	ms_run[1]:scan=1.1.2052.15	22.39222	2	1011.545647	1011.553536	R	D	733	742
PSM	KFYEAFSK	4184	sp|P11499|HS90B_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2124.14	24.38005	2	1018.511447	1018.512383	K	N	428	436
PSM	ALHDQLGLR	4185	sp|O35488|S27A2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2098.2	23.64788	3	1021.557071	1021.566878	R	Q	94	103
PSM	TAVCDIPPR	4186	sp|P68372|TBB4B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	4-UNIMOD:4	ms_run[1]:scan=1.1.2160.17	25.3963	2	1027.510047	1027.512065	K	G	351	360
PSM	TAVCDIPPR	4187	sp|P68372|TBB4B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	4-UNIMOD:4	ms_run[1]:scan=1.1.2154.18	25.22793	2	1027.510047	1027.512065	K	G	351	360
PSM	TSVPLTAPQK	4188	sp|Q60648|SAP3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2128.15	24.48965	2	1040.579647	1040.586610	K	V	72	82
PSM	AQEIALQNR	4189	sp|Q3ULD5|MCCB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2020.20	21.51637	2	1041.550647	1041.556707	R	L	156	165
PSM	ETAMVVDQR	4190	sp|Q8BH86|GLUCM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2010.17	21.2396	2	1047.494247	1047.501894	K	A	371	380
PSM	IQEGAAVLQK	4191	sp|P61750|ARF4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2094.16	23.55112	2	1055.590847	1055.597509	R	M	100	110
PSM	NMMAACDPR	4192	sp|P68372|TBB4B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	6-UNIMOD:4	ms_run[1]:scan=1.1.2024.17	21.6237	2	1064.416447	1064.420156	K	H	298	307
PSM	QLPEGNICR	4193	sp|Q8R164|BPHL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	8-UNIMOD:4	ms_run[1]:scan=1.1.2107.16	23.90795	2	1085.521047	1085.528778	K	H	218	227
PSM	IANPVEGSSGR	4194	sp|P60335|PCBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1972.18	20.18263	2	1085.540647	1085.546536	K	Q	315	326
PSM	VNEVSQFAAK	4195	sp|P16546|SPTN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2161.14	25.42183	2	1091.555247	1091.561124	R	L	205	215
PSM	MVVYQGGTSR	4196	sp|Q62468|VILI_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2032.19	21.84805	2	1096.525847	1096.533529	R	K	496	506
PSM	SPPGQVTEAVK	4197	sp|P45376|ALDR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1981.19	20.42725	2	1111.583247	1111.587339	K	V	23	34
PSM	STWVILHHK	4198	sp|P56395|CYB5_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2042.20	22.12298	2	1119.613047	1119.618913	K	V	25	34
PSM	NYTDNELEK	4199	sp|P26443|DHE3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2003.19	21.04225	2	1124.495447	1124.498583	K	I	192	201
PSM	ALELDSNNEK	4200	sp|P30416|FKBP4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2017.21	21.43565	2	1131.538847	1131.540782	K	G	345	355
PSM	ALANSLACQGK	4201	tr|A6ZI46|A6ZI46_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	8-UNIMOD:4	ms_run[1]:scan=1.1.2034.20	21.90362	2	1131.566047	1131.570643	R	Y	387	398
PSM	VTLTPEEEAR	4202	sp|P06151|LDHA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2161.16	25.4235	2	1143.574647	1143.577168	K	L	306	316
PSM	RQAVTNPNNTFYATK	4203	sp|P38647|GRP75_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2080.18	23.16502	3	1723.866671	1723.864182	K	R	107	122
PSM	LCENIAGHLK	4204	sp|P24270|CATA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	2-UNIMOD:4	ms_run[1]:scan=1.1.2096.4	23.59527	3	1153.581671	1153.591378	R	D	459	469
PSM	LNRPLTLSEK	4205	sp|Q99KI0|ACON_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2030.7	21.78248	3	1169.670671	1169.676822	R	I	59	69
PSM	ITAHLVHELR	4206	sp|Q8BWT1|THIM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2002.9	21.0055	3	1187.670671	1187.677491	R	R	361	371
PSM	ITAHLVHELR	4207	sp|Q8BWT1|THIM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2003.6	21.0314	3	1187.670671	1187.677491	R	R	361	371
PSM	TEYLSNADER	4208	sp|Q9JHU4|DYHC1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2040.18	22.06615	2	1196.526647	1196.530946	R	L	3548	3558
PSM	NDQCYDDIR	4209	sp|Q9WUM4|COR1C_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	4-UNIMOD:4	ms_run[1]:scan=1.1.2068.20	22.83645	2	1197.467447	1197.472051	K	V	20	29
PSM	RCHGSQASYLFQQDK	4210	sp|Q9DBE0|CSAD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	2-UNIMOD:4	ms_run[1]:scan=1.1.2001.21	20.98718	3	1823.834771	1823.837316	K	F	327	342
PSM	ITQCSVEIQR	4211	sp|O70439|STX7_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	4-UNIMOD:4	ms_run[1]:scan=1.1.2136.20	24.71783	2	1232.613247	1232.618321	K	T	25	35
PSM	SYEPQEDPGVK	4212	sp|Q93092|TALDO_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2029.20	21.76532	2	1247.563247	1247.566997	K	S	205	216
PSM	YNDLGEQHFK	4213	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2020.9	21.50718	3	1249.566671	1249.572751	R	G	35	45
PSM	YVGSMVADIHR	4214	sp|Q9QXD6|F16P1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	5-UNIMOD:35	ms_run[1]:scan=1.1.2088.9	23.37968	3	1262.601671	1262.607757	R	T	245	256
PSM	INISEGNCPER	4215	sp|P57722|PCBP3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	8-UNIMOD:4	ms_run[1]:scan=1.1.2090.21	23.44602	2	1287.583447	1287.587750	R	I	79	90
PSM	HRPELIEYDK	4216	sp|P57780|ACTN4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1966.11	20.00855	3	1298.658071	1298.661900	R	L	206	216
PSM	HQEGEIFDTEK	4217	sp|P47911|RL6_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2045.21	22.2072	2	1331.600847	1331.599360	R	E	235	246
PSM	VVAGVAAALAHK	4218	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2266.4	28.32075	3	1105.655771	1105.660778	K	Y	134	146
PSM	LHVDPENFR	4219	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2323.2	29.89528	3	1125.551771	1125.556707	K	L	97	106
PSM	GTAFGGWK	4220	sp|P28474|ADHX_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2340.2	30.36923	2	822.397047	822.402438	K	S	316	324
PSM	LCDVLAQAGHR	4221	sp|Q8R086|SUOX_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	2-UNIMOD:4	ms_run[1]:scan=1.1.2188.4	26.17632	3	1238.609771	1238.618990	R	L	299	310
PSM	LVAQLYK	4222	sp|Q9CZU6|CISY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2245.7	27.74443	2	833.496447	833.501090	K	I	376	383
PSM	SKFDNLYGCR	4223	sp|P50247|SAHH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	9-UNIMOD:4	ms_run[1]:scan=1.1.2172.8	25.72947	3	1258.570271	1258.576457	K	E	187	197
PSM	VCADLIR	4224	sp|P60867|RS20_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	2-UNIMOD:4	ms_run[1]:scan=1.1.2193.10	26.32365	2	845.437847	845.442923	K	G	35	42
PSM	TQIDHYVGIAR	4225	sp|Q9ES97|RTN3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2308.3	29.48113	3	1271.670371	1271.662235	K	D	931	942
PSM	DSDFLEK	4226	sp|P11930|NUD19_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2233.5	27.41747	2	852.383247	852.386513	K	N	294	301
PSM	KIPVVFR	4227	sp|Q9R0P3|ESTD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2243.7	27.68963	2	857.543647	857.548709	K	L	247	254
PSM	IFAQLDR	4228	sp|Q99KP3|CRYL1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2366.5	31.07547	2	861.464647	861.470852	K	I	105	112
PSM	FYGDLEK	4229	sp|P14211|CALR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2248.5	27.82588	2	870.407247	870.412334	K	D	56	63
PSM	LASFYER	4230	sp|P50516|VATA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2261.8	28.18615	2	884.433047	884.439218	R	A	382	389
PSM	PVTFVDGR	4231	sp|Q64462|CP4B1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2217.6	26.97805	2	889.460047	889.465767	K	S	390	398
PSM	LELAQYR	4232	sp|Q03265|ATPA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2330.9	30.09755	2	891.475447	891.481417	K	E	435	442
PSM	ADEGISFR	4233	sp|P35700|PRDX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2260.9	28.15968	2	893.418847	893.424296	K	G	121	129
PSM	GVNVSALSR	4234	sp|P50516|VATA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2179.9	25.92895	2	901.491847	901.498130	R	D	121	130
PSM	FPFAANSR	4235	sp|O08749|DLDH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2366.9	31.07882	2	908.446647	908.450451	K	A	421	429
PSM	KFPPDGSAPYGAR	4236	sp|Q9QXD6|F16P1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2283.9	28.79695	3	1361.674571	1361.672800	K	Y	232	245
PSM	GMPGFSTSK	4237	sp|Q9JHI5|IVD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2178.13	25.90503	2	910.415447	910.421853	K	K	231	240
PSM	IVVVTAGVR	4238	sp|P16125|LDHB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2304.7	29.37258	2	912.571247	912.575652	K	Q	92	101
PSM	YLAEFATGNDRK	4239	sp|P62259|1433E_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2198.11	26.46477	3	1383.674171	1383.678279	R	E	131	143
PSM	LADIGACAQIVHK	4240	sp|Q8VCN5|CGL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	7-UNIMOD:4	ms_run[1]:scan=1.1.2369.11	31.16193	3	1394.729171	1394.734020	K	R	165	178
PSM	VYYDLTR	4241	sp|Q60597|ODO1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2363.6	30.99552	2	928.462847	928.465432	K	E	908	915
PSM	RLIELYK	4242	sp|Q93092|TALDO_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2220.10	27.06405	2	933.560247	933.564753	R	E	124	131
PSM	HELIEFR	4243	sp|Q68FD5|CLH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2305.6	29.40012	2	942.487647	942.492316	K	R	1502	1509
PSM	SGEVLVNVK	4244	sp|Q9QZD9|EIF3I_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2196.9	26.40678	2	943.530647	943.533846	K	E	177	186
PSM	GEAALLESR	4245	sp|P28825|MEP1A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2178.14	25.90587	2	944.484847	944.492710	R	I	324	333
PSM	LNIMTAGSR	4246	sp|P24270|CATA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2294.14	29.09785	2	961.496247	961.501500	K	G	39	48
PSM	VAVVNQIAR	4247	sp|Q62261|SPTB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2193.13	26.32615	2	968.571247	968.576714	R	Q	905	914
PSM	KPPPDGPYVEVVR	4248	sp|P24472|GSTA4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2283.11	28.79862	3	1451.772071	1451.777265	R	T	205	218
PSM	DPAQGQLLK	4249	sp|P13707|GPDA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2171.14	25.70575	2	968.524447	968.529095	K	D	170	179
PSM	YYAGWADK	4250	sp|P47738|ALDH2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2288.10	28.93257	2	972.428847	972.434132	R	Y	150	158
PSM	AVLCPPPVK	4251	sp|P60764|RAC3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	4-UNIMOD:4	ms_run[1]:scan=1.1.2282.10	28.77005	2	979.542847	979.552474	R	K	175	184
PSM	MLEIDPQK	4252	sp|Q8QZT1|THIL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	1-UNIMOD:35	ms_run[1]:scan=1.1.2164.16	25.50847	2	988.488647	988.489933	K	V	363	371
PSM	AVILGPPGSGK	4253	sp|Q9WUR9|KAD4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2312.11	29.59648	2	994.574847	994.581131	R	G	8	19
PSM	IVFSPEEAK	4254	sp|Q9Z2I9|SUCB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2366.13	31.08215	2	1018.528447	1018.533512	K	A	121	130
PSM	IGGHGAEYGAEALER	4255	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2214.7	26.89752	3	1528.729271	1528.727020	K	M	18	33
PSM	GLLPGAGGTQR	4256	sp|Q3TLP5|ECHD2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2230.15	27.34507	2	1025.558647	1025.561792	R	L	170	181
PSM	TAVCDIPPR	4257	sp|P68372|TBB4B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	4-UNIMOD:4	ms_run[1]:scan=1.1.2216.16	26.95925	2	1027.507447	1027.512065	K	G	351	360
PSM	ESILDGLKR	4258	sp|Q68FL4|SAHH3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2278.11	28.65908	2	1029.577647	1029.581859	R	T	378	387
PSM	RPISADSAIMNPASK	4259	sp|Q68FD5|CLH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2232.10	27.39473	3	1556.792771	1556.798076	R	V	64	79
PSM	NQDLEFER	4260	sp|P28271|ACOC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2239.11	27.5841	2	1049.476447	1049.477788	K	N	142	150
PSM	CQVLLEAAR	4261	sp|Q9JLJ2|AL9A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	1-UNIMOD:4	ms_run[1]:scan=1.1.2343.9	30.45493	2	1058.549447	1058.554265	R	I	74	83
PSM	KLDALCNIHENIR	4262	sp|Q8CIE6|COPA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	6-UNIMOD:4	ms_run[1]:scan=1.1.2299.16	29.23818	3	1594.825571	1594.824960	R	V	517	530
PSM	YAIGSLNEGR	4263	sp|Q9DBL1|ACDSB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2363.11	30.99968	2	1078.541647	1078.540723	K	I	285	295
PSM	DSEDVYNLK	4264	sp|Q8R1G2|CMBL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2347.16	30.56858	2	1081.487847	1081.492769	R	N	160	169
PSM	QINDIQLSR	4265	sp|Q9QZD9|EIF3I_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2315.14	29.68145	2	1085.576847	1085.582922	R	D	190	199
PSM	EVNLAVENAK	4266	sp|Q9JLJ2|AL9A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2173.16	25.76472	2	1085.566647	1085.571688	K	A	50	60
PSM	EVNLAVENAK	4267	sp|Q9JLJ2|AL9A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2169.18	25.652	2	1085.566647	1085.571688	K	A	50	60
PSM	FADLSEAANR	4268	sp|P20152|VIME_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2297.14	29.18043	2	1092.515447	1092.519987	K	N	295	305
PSM	EIVLSAGSTPK	4269	sp|Q9JHU4|DYHC1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2297.15	29.18127	2	1100.600847	1100.607740	K	I	3911	3922
PSM	SLSQNYGVLK	4270	sp|Q61171|PRDX2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2365.12	31.0544	2	1107.588047	1107.592424	K	N	110	120
PSM	ATAGDTHLGGEDFDNR	4271	sp|P16627|HS71L_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2163.19	25.48253	3	1674.728771	1674.723391	K	L	223	239
PSM	IAGPGLSSCVR	4272	sp|Q80X90|FLNB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	9-UNIMOD:4	ms_run[1]:scan=1.1.2250.17	27.8921	2	1115.572247	1115.575728	K	A	1426	1437
PSM	QVEYLVNEK	4273	sp|P05201|AATC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2257.17	28.08495	2	1120.574047	1120.576440	K	H	370	379
PSM	LIEQPELASK	4274	sp|P00375|DYR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2314.17	29.6564	2	1126.614447	1126.623390	R	V	100	110
PSM	HYFIEVNSR	4275	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2263.17	28.24857	2	1163.567047	1163.572357	K	L	320	329
PSM	VMLGETNPADSKPGTIR	4276	sp|P15532|NDKA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2332.17	30.16077	3	1784.913371	1784.909084	R	G	89	106
PSM	WNGQETTLTR	4277	sp|P11404|FABPH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2189.19	26.21732	2	1204.575447	1204.583650	K	E	98	108
PSM	YVGSMVADIHR	4278	sp|Q9QXD6|F16P1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2315.3	29.67228	3	1246.608071	1246.612842	R	T	245	256
PSM	DHGGALGPEEFK	4279	sp|P57780|ACTN4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2229.18	27.31992	2	1255.578847	1255.583316	K	A	781	793
PSM	FPGQLNADLRK	4280	sp|A2AQ07|TBB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2331.7	30.12413	3	1257.676871	1257.682970	R	L	242	253
PSM	AVAGNISDPGLQK	4281	sp|Q64727|VINC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2240.21	27.61957	2	1268.669247	1268.672465	K	S	803	816
PSM	ITWSNPPAQGAR	4282	sp|P05201|AATC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2330.19	30.1059	2	1296.654847	1296.657484	R	I	294	306
PSM	NCIIVSPDAGGAK	4283	sp|Q9CS42|PRPS2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	2-UNIMOD:4	ms_run[1]:scan=1.1.2319.17	29.7953	2	1300.642247	1300.644536	R	R	164	177
PSM	VTDSSVSVQLRE	4284	sp|G3X9C2|FBX50_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2369.19	31.1686	2	1318.669247	1318.672859	R	-	255	267
PSM	MAEHNLLLHLR	4285	sp|Q99KR3|LACB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2371.2	31.20942	4	1345.722894	1345.728875	K	K	256	267
PSM	INVYYNEAAGNK	4286	sp|Q7TMM9|TBB2A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2301.20	29.29823	2	1354.652247	1354.651730	R	Y	47	59
PSM	GAAQNIIPASTGAAK	4287	tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2302.18	29.3249	2	1368.736047	1368.736128	R	A	199	214
PSM	VAELNPDENCIR	4288	sp|Q9R112|SQOR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	10-UNIMOD:4	ms_run[1]:scan=1.1.2350.20	30.65393	2	1428.664647	1428.666728	R	T	118	130
PSM	DINAYNGETPTEK	4289	sp|O08709|PRDX6_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2239.17	27.59245	2	1450.657647	1450.657603	K	L	85	98
PSM	AFGPGLQGGNAGSPAR	4290	sp|Q8BTM8|FLNA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2315.20	29.68647	2	1455.723247	1455.721875	K	F	1072	1088
PSM	SEGTYCCGPVSVR	4291	sp|P21981|TGM2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	6-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=1.1.2267.21	28.36283	2	1470.623047	1470.623149	K	A	365	378
PSM	EYAEDDNIYQQK	4292	sp|Q7TQI3|OTUB1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2253.21	27.97898	2	1514.652447	1514.652518	K	I	60	72
PSM	IGGHGAEYGAEALER	4293	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2247.11	27.80308	3	1528.720571	1528.727020	K	M	18	33
PSM	KTDGVYDPVEYEK	4294	sp|Q99K67|AASS_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2290.13	28.99548	2	1541.722647	1541.724954	R	Y	274	287
PSM	KGAAIEALNDGELQK	4295	sp|Q99L47|F10A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2313.13	29.62548	3	1555.819571	1555.820586	K	A	117	132
PSM	RTALVANTSNMPVAAR	4296	sp|P50516|VATA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2263.15	28.2469	3	1670.888471	1670.888623	K	E	308	324
PSM	ECCHGDLLECADDR	4297	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	2-UNIMOD:4,3-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.2226.16	27.23532	3	1748.655071	1748.655254	K	A	268	282
PSM	RAPAAQPPAAAAPSAVGSPAAAPR	4298	tr|B2RPU8|B2RPU8_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2264.21	28.2795	3	2152.153871	2152.150134	R	Q	28	52
PSM	HLDLSNVASYK	4299	sp|Q9WVE8|PACN2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2464.7	33.78036	2	1245.640047	1245.635351	K	T	254	265
PSM	LEEETGQVVGFHQPGSIR	4300	sp|Q9DBT9|M2GD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2548.14	36.11123	3	1982.000171	1981.985754	R	L	112	130
PSM	ALVILAK	4301	sp|Q99LX0|PARK7_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2433.3	32.92764	2	726.493247	726.500361	R	G	6	13
PSM	DDSWLK	4302	sp|P14152|MDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2413.3	32.37572	2	762.347247	762.354819	K	G	215	221
PSM	NLGEILK	4303	sp|P52760|RIDA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2419.3	32.54038	2	785.459047	785.464704	K	A	61	68
PSM	GVFIVAAK	4304	sp|Q8BWT1|THIM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2420.6	32.5704	2	803.485047	803.490525	R	R	6	14
PSM	HLSVNDLPVGR	4305	sp|P20108|PRDX3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2413.5	32.37738	3	1205.648471	1205.651670	K	S	198	209
PSM	AVYIFAK	4306	sp|Q61133|GSTT2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2489.4	34.457	2	810.456847	810.463976	R	K	16	23
PSM	FAELTLK	4307	sp|Q8R0Y6|AL1L1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2544.2	35.99332	2	820.461447	820.469455	K	A	609	616
PSM	DFGSFEK	4308	sp|P09671|SODM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2389.6	31.7112	2	828.359247	828.365384	R	F	124	131
PSM	LSFSYGR	4309	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2420.7	32.57123	2	828.407847	828.413003	K	A	298	305
PSM	LSFSYGR	4310	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2413.6	32.37822	2	828.407847	828.413003	K	A	298	305
PSM	LEDLIVK	4311	sp|Q8QZT1|THIL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2447.4	33.31403	2	828.491047	828.495670	K	D	172	179
PSM	VLSAPPHFHFGQTNR	4312	sp|Q9D8N0|EF1G_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2375.4	31.3206	4	1706.866094	1706.864123	R	T	31	46
PSM	ALDFIASK	4313	sp|O88990|ACTN3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2543.4	35.96797	2	863.468647	863.475269	K	G	109	117
PSM	YLPAFEK	4314	tr|E9Q6L7|E9Q6L7_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2413.7	32.37905	2	866.448847	866.453805	R	V	132	139
PSM	LGHILVVDEADK	4315	sp|Q8CC88|VWA8_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2394.9	31.85513	3	1307.703071	1307.708516	K	A	839	851
PSM	IGPLGLSPK	4316	sp|P35979|RL12_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2533.5	35.69112	2	880.530847	880.538203	K	K	32	41
PSM	IIAVDINK	4317	sp|P00329|ADH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2377.5	31.37618	2	884.527247	884.533118	R	D	220	228
PSM	AAVSGLWGK	4318	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2474.5	34.04315	2	887.482847	887.486502	K	V	10	19
PSM	AAVSGLWGK	4319	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2473.4	34.01505	2	887.482847	887.486502	K	V	10	19
PSM	AAVSGLWGK	4320	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2495.7	34.62637	2	887.482847	887.486502	K	V	10	19
PSM	SPAQILLR	4321	sp|Q9JII6|AK1A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15		ms_run[1]:scan=1.1.2499.3	34.73269	2	896.5391	896.5438	R	W	244	252
PSM	AALEELVR	4322	sp|Q61035|HARS1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2520.6	35.32652	2	899.501047	899.507632	R	L	5	13
PSM	AQVHEYLGWHADNIR	4323	sp|Q61133|GSTT2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2411.12	32.3267	4	1807.868894	1807.875416	R	G	93	108
PSM	RFSMVIDNGIVK	4324	sp|P99029|PRDX5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	4-UNIMOD:35	ms_run[1]:scan=1.1.2403.5	32.09858	3	1393.726571	1393.738771	K	A	176	188
PSM	QWLQEVK	4325	sp|P05202|AATM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2385.5	31.5989	2	929.495647	929.497067	K	G	339	346
PSM	RFSMVIDNGIVK	4326	sp|P99029|PRDX5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	4-UNIMOD:35	ms_run[1]:scan=1.1.2405.8	32.15676	3	1393.726571	1393.738771	K	A	176	188
PSM	RFSMVIDNGIVK	4327	sp|P99029|PRDX5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	4-UNIMOD:35	ms_run[1]:scan=1.1.2404.14	32.1339	3	1393.726571	1393.738771	K	A	176	188
PSM	NINLIVQK	4328	sp|O35643|AP1B1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2431.4	32.87437	2	940.564847	940.570566	R	R	305	313
PSM	EHHFEAIALVEK	4329	sp|Q8CG76|ARK72_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2405.10	32.15843	3	1421.729771	1421.730314	K	A	275	287
PSM	ALTSDIFEEQRK	4330	sp|Q9JI75|NQO2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2439.8	33.09733	3	1435.727771	1435.730708	K	V	80	92
PSM	FGLGPEPPR	4331	sp|P11930|NUD19_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2477.5	34.12593	2	968.503647	968.507966	R	Q	74	83
PSM	QTALAELVK	4332	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2564.7	36.54525	2	971.562447	971.565147	K	H	550	559
PSM	GEVGLLVCK	4333	sp|O35488|S27A2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	8-UNIMOD:4	ms_run[1]:scan=1.1.2449.7	33.37187	2	973.524847	973.526653	K	I	420	429
PSM	SSHYDELLAAEAR	4334	sp|Q78PY7|SND1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2442.6	33.17803	3	1460.698271	1460.689572	R	A	473	486
PSM	TIVMGASFR	4335	sp|Q93092|TALDO_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2541.8	35.91712	2	980.504047	980.511337	K	N	231	240
PSM	LATLGALEAK	4336	sp|Q9WUZ9|ENTP5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2539.10	35.86272	2	985.578647	985.580797	R	G	251	261
PSM	VVGNPFDSR	4337	sp|P47738|ALDH2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2390.13	31.745	2	989.488647	989.493044	R	T	349	358
PSM	LVIAGHLLR	4338	sp|Q07417|ACADS_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2498.5	34.7069	2	990.630247	990.633835	R	S	400	409
PSM	LFPSGLDQK	4339	sp|P14211|CALR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2499.7	34.73602	2	1003.530847	1003.533846	K	D	112	121
PSM	FKPPPPNSDIGWR	4340	sp|P97494|GSH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2489.14	34.46533	3	1509.769871	1509.772848	R	V	411	424
PSM	IAGNMGLAMK	4341	sp|P32020|NLTP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2383.12	31.54843	2	1004.514847	1004.514708	K	L	525	535
PSM	EGMTAFVEK	4342	sp|Q8BH95|ECHM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2384.14	31.57828	2	1010.473447	1010.474283	R	R	274	283
PSM	ELNQLLGPK	4343	sp|Q91XE4|ACY3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2507.5	34.95652	2	1010.574847	1010.576046	R	G	95	104
PSM	IPVGPETLGR	4344	sp|P56480|ATPB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2482.12	34.2682	2	1037.581647	1037.586945	K	I	134	144
PSM	NLSTFAVDGK	4345	sp|Q9D172|GAL3A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2430.8	32.85153	2	1050.530247	1050.534575	K	D	140	150
PSM	FAFQAEVNR	4346	sp|P08113|ENPL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2541.15	35.92295	2	1080.534447	1080.535243	K	M	76	85
PSM	EAQVYEAFK	4347	sp|Q9Z2I8|SUCB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2412.16	32.35826	2	1083.519647	1083.523676	K	L	340	349
PSM	DLEEWNQR	4348	sp|Q6IRU5|CLCB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2439.13	33.10152	2	1088.487247	1088.488687	K	Q	135	143
PSM	IMFVGGPNTR	4349	sp|Q78JT3|3HAO_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2571.9	36.74377	2	1090.555847	1090.559350	K	K	34	44
PSM	VFSGVVSTGLK	4350	sp|P58252|EF2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2566.10	36.60365	2	1092.614047	1092.617910	R	V	416	427
PSM	LEILQIHTK	4351	sp|Q01853|TERA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2485.10	34.3494	2	1093.648247	1093.649545	R	N	378	387
PSM	VANVELYYK	4352	sp|Q68FD5|CLH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2505.14	34.90832	2	1097.570447	1097.575711	K	A	1398	1407
PSM	TIAQDYGVLK	4353	sp|P35700|PRDX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2540.15	35.8949	2	1106.594647	1106.597175	R	A	111	121
PSM	LCAATATILDKPEDR	4354	sp|O35215|DOPD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	2-UNIMOD:4	ms_run[1]:scan=1.1.2438.17	33.07695	3	1672.844471	1672.845421	R	V	23	38
PSM	NYEYYASHVPESVK	4355	sp|Q9Z0S1|BPNT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2444.11	33.237	3	1684.771271	1684.773302	R	N	290	304
PSM	VNLQGDIVDR	4356	sp|Q9QYC0|ADDA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2443.10	33.20878	2	1127.591047	1127.593487	K	G	200	210
PSM	KITISDCGQL	4357	sp|P17742|PPIA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	7-UNIMOD:4	ms_run[1]:scan=1.1.2460.12	33.674	2	1133.571647	1133.575060	K	-	155	165
PSM	IRENMASLQSSPQHQELFR	4358	sp|P50544|ACADV_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2438.18	33.07778	4	2270.135694	2270.122599	R	N	615	634
PSM	SSEEIESAFR	4359	sp|P16546|SPTN1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2414.15	32.41398	2	1153.521047	1153.525132	K	A	2405	2415
PSM	SIYYITGESK	4360	sp|P11499|HS90B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2454.10	33.5086	2	1159.572447	1159.576105	K	E	482	492
PSM	YSLDPENPTK	4361	sp|Q9CPR4|RL17_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2374.17	31.3042	2	1162.548047	1162.550619	R	S	4	14
PSM	AGQAVDDFIEK	4362	sp|Q9DCD0|6PGD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2496.11	34.6571	2	1191.586247	1191.577168	K	L	77	88
PSM	ITLDNAYMEK	4363	sp|P52480|KPYM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2564.17	36.5536	2	1196.571047	1196.574725	K	C	142	152
PSM	AVFPSIVGRPR	4364	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2497.5	34.67947	2	1197.695047	1197.698226	R	H	29	40
PSM	VIESLGATNLGK	4365	sp|Q9DCY0|KEG1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2500.10	34.766	2	1200.670047	1200.671403	K	V	113	125
PSM	YIAIVSTTVETKEPEK	4366	sp|Q61598|GDIB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2493.11	34.57453	3	1806.960371	1806.961496	K	E	349	365
PSM	EVEIAYSDVAK	4367	sp|Q9QYB1|CLIC4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2524.15	35.44628	2	1222.604247	1222.608134	K	R	239	250
PSM	AGNLGGGVVTIER	4368	sp|P67984|RL22_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2480.14	34.21548	2	1241.668647	1241.672800	K	S	53	66
PSM	TDYMVGSYGPR	4369	sp|Q99PT1|GDIR1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2517.14	35.24755	2	1244.545647	1244.549573	K	A	142	153
PSM	AVIFCLSADKK	4370	sp|Q9R0P5|DEST_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	5-UNIMOD:4	ms_run[1]:scan=1.1.2459.13	33.64875	2	1250.661847	1250.669294	K	C	35	46
PSM	HNFGPITTDIR	4371	sp|Q9D6Y7|MSRA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2456.17	33.5681	2	1269.645247	1269.646585	K	E	184	195
PSM	SVEGLQEGSVLR	4372	sp|Q5SW19|CLU_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2512.18	35.10748	2	1272.677647	1272.667380	R	V	106	118
PSM	ELISNASDALDK	4373	sp|P08113|ENPL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2526.20	35.50703	2	1274.631847	1274.635411	R	I	103	115
PSM	AQIWDTAGQER	4374	sp|P46638|RB11B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2398.19	31.97277	2	1273.605047	1273.605114	K	Y	62	73
PSM	LMIEMDGTENK	4375	sp|P17182|ENOA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2573.17	36.8067	2	1279.577247	1279.578824	K	S	93	104
PSM	LVMEEAPESYK	4376	sp|Q99LF4|RTCB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2418.19	32.52625	2	1294.606447	1294.611504	K	N	466	477
PSM	EPLGPALAHELR	4377	sp|P17563|SBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2570.3	36.71063	3	1301.704571	1301.709185	K	Y	449	461
PSM	EPLGPALAHELR	4378	sp|P17563|SBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2558.18	36.38665	2	1301.707047	1301.709185	K	Y	449	461
PSM	TIYAGNALCTVK	4379	sp|Q99LC5|ETFA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	9-UNIMOD:4	ms_run[1]:scan=1.1.2486.14	34.38062	2	1309.668247	1309.670023	R	C	147	159
PSM	LTPEEEEILNK	4380	sp|P62242|RS8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2566.15	36.60783	2	1313.670047	1313.671462	K	K	129	140
PSM	NFITQGPYENR	4381	sp|P62814|VATB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2507.17	34.96653	2	1337.639047	1337.636414	K	T	461	472
PSM	SFDTPPPPMDEK	4382	sp|O70250|PGAM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2491.19	34.52565	2	1359.599047	1359.601668	R	H	118	130
PSM	YQHQDFAVFSK	4383	sp|Q3UNZ8|QORL2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2386.7	31.62855	3	1368.643571	1368.646250	R	S	292	303
PSM	ANAGEESVMNLDK	4384	sp|Q8K2B3|SDHA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2387.19	31.66643	2	1376.620247	1376.624194	K	L	486	499
PSM	ENPSANYTTMMK	4385	sp|Q3UZZ6|ST1D1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2379.20	31.44363	2	1385.597047	1385.595537	K	E	234	246
PSM	SQQALLQGQLAEK	4386	sp|Q9Z1Z0|USO1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2441.20	33.16238	2	1412.759647	1412.762343	K	D	744	757
PSM	SLYSSSPGGAYVTR	4387	sp|P20152|VIME_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2434.20	32.96903	2	1443.705047	1443.699408	R	S	51	65
PSM	GTFASLSELHCDK	4388	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	11-UNIMOD:4	ms_run[1]:scan=1.1.2487.5	34.40115	3	1463.672771	1463.671479	K	L	84	97
PSM	TALVANTSNMPVAAR	4389	sp|P50516|VATA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2518.20	35.28113	2	1514.786647	1514.787512	R	E	309	324
PSM	LPACVVDCGTGYTK	4390	sp|Q99JY9|ARP3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	4-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.2488.19	34.44113	2	1539.702647	1539.706150	R	L	5	19
PSM	GVPGAIVNVSSQASQR	4391	sp|Q91X52|DCXR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2531.21	35.64925	2	1568.830247	1568.827068	R	A	126	142
PSM	ESSYACYYDEER	4392	sp|O89017|LGMN_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	6-UNIMOD:4	ms_run[1]:scan=1.1.2409.21	32.27848	2	1570.587847	1570.588203	K	G	216	228
PSM	NKQELDINNITTYK	4393	sp|P12658|CALB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2547.9	36.08513	3	1692.865271	1692.868265	K	K	222	236
PSM	MQQVEASLQPETLRK	4394	sp|P07759|SPA3K_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2376.16	31.35798	3	1756.916171	1756.914169	R	W	283	298
PSM	TCEWIHDSSLSASCK	4395	sp|Q61207|SAP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	2-UNIMOD:4,14-UNIMOD:4	ms_run[1]:scan=1.1.2402.13	32.07758	3	1779.752471	1779.755620	K	E	93	108
PSM	AADKDTCFSTEGPNLVTR	4396	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	7-UNIMOD:4	ms_run[1]:scan=1.1.2471.19	33.97513	2	1980.931047	1980.921105	K	C	585	603
PSM	EATQAVLDKPETLSSDASTR	4397	sp|P50544|ACADV_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2407.19	32.22212	3	2118.048071	2118.044057	R	E	44	64
PSM	TRLEAYHTQTTPLVEYYR	4398	sp|Q9WTP6|KAD2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2568.19	36.66753	3	2240.123771	2240.122582	K	K	185	203
PSM	ECCHGDLLECADDRAELAK	4399	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	2-UNIMOD:4,3-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.2424.20	32.6937	3	2260.957571	2260.951102	K	Y	268	287
PSM	AIYIFAK	4400	sp|Q64471|GSTT1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2662.2	39.26708	2	824.474447	824.479626	R	K	16	23
PSM	GLVGEIIK	4401	sp|P15532|NDKA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2632.3	38.42776	2	827.507447	827.511654	R	R	19	27
PSM	VPQLILR	4402	sp|Q64462|CP4B1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2609.2	37.79635	2	837.538847	837.543623	K	S	487	494
PSM	TPALIALR	4403	sp|P70694|DHB5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2649.6	38.90963	2	853.533447	853.538538	R	Y	251	259
PSM	LPMPYLK	4404	sp|P17563|SBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2699.3	40.28928	2	860.478247	860.482997	R	D	63	70
PSM	LPMPYLK	4405	sp|P17563|SBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2705.2	40.4605	2	860.478247	860.482997	R	D	63	70
PSM	FFQPVLK	4406	sp|Q9CQ62|DECR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2656.3	39.1034	2	877.501247	877.506175	K	P	43	50
PSM	NFDEILR	4407	sp|O08709|PRDX6_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2663.3	39.29397	2	905.455647	905.460681	R	V	156	163
PSM	GIEIPEVR	4408	sp|O08749|DLDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2640.6	38.65438	2	911.502647	911.507632	R	L	110	118
PSM	GIEIPEVR	4409	sp|O08749|DLDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2634.5	38.48525	2	911.502647	911.507632	R	L	110	118
PSM	FVDAYFR	4410	sp|Q99NB1|ACS2L_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2681.3	39.79436	2	916.440847	916.444303	R	A	510	517
PSM	GLLVLEGPK	4411	sp|Q64462|CP4B1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2765.6	42.14497	2	924.561247	924.564418	K	W	125	134
PSM	ITAVPTLLK	4412	sp|Q9CQM5|TXD17_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2737.3	41.36528	2	954.605047	954.611368	K	Y	90	99
PSM	QLFDQVVK	4413	sp|P26040|EZRI_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2604.8	37.66387	2	975.533247	975.538932	K	T	28	36
PSM	VLSIGDGIAR	4414	sp|Q03265|ATPA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2591.7	37.3008	2	999.567847	999.571295	R	V	74	84
PSM	AVDSLVPIGR	4415	sp|Q03265|ATPA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2701.8	40.35053	2	1025.582847	1025.586945	K	G	195	205
PSM	YEALLLTHETSIR	4416	sp|Q8VCM7|FIBG_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2675.8	39.62733	3	1544.816171	1544.819858	K	Y	121	134
PSM	DILIQYDR	4417	sp|P14131|RS16_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2741.6	41.48063	2	1034.537447	1034.539660	K	T	110	118
PSM	YIATPIFSK	4418	sp|P10649|GSTM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2726.5	41.06536	2	1038.573647	1038.574983	R	M	203	212
PSM	GIVVLNTSLK	4419	sp|Q91WR5|AK1CL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2722.12	40.95653	2	1042.636047	1042.638646	R	E	264	274
PSM	MFASFPTTK	4420	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	1-UNIMOD:35	ms_run[1]:scan=1.1.2579.9	36.9691	2	1044.492247	1044.495018	R	T	33	42
PSM	ILLLGAGESGK	4421	sp|P27600|GNA12_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2686.4	39.93503	2	1056.608047	1056.617910	K	S	58	69
PSM	EIQAALTLAK	4422	sp|O08756|HCD2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2592.10	37.3319	2	1056.612247	1056.617910	K	E	70	80
PSM	RIPQSTLSEFYPR	4423	sp|P62814|VATB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2715.7	40.75098	3	1592.833571	1592.831091	K	D	494	507
PSM	ARPFPDGLAEDIDKGEVSAR	4424	sp|P58252|EF2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15		ms_run[1]:scan=1.1.2755.7	41.86625	4	2142.0812	2142.0702	K	Q	606	626
PSM	RGGGSVVIVGSVAGFTR	4425	sp|Q99LB2|DHRS4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2706.10	40.4958	3	1617.901571	1617.895088	K	F	160	177
PSM	VNCLAPGLIK	4426	sp|Q99LB2|DHRS4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	3-UNIMOD:4	ms_run[1]:scan=1.1.2589.9	37.24577	2	1083.606447	1083.611051	R	T	208	218
PSM	GGHVNLTMLGAMQVSK	4427	sp|Q9D0K2|SCOT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2775.9	42.42715	3	1641.835571	1641.833082	R	Y	391	407
PSM	LLDEAIQAVK	4428	sp|Q9EQH3|VPS35_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2720.7	40.89515	2	1098.624447	1098.628475	K	V	15	25
PSM	LSAEERDQLLPNLR	4429	sp|P61458|PHS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2670.9	39.48886	3	1652.886371	1652.884583	R	A	8	22
PSM	ILMVGLDAAGK	4430	sp|P61205|ARF3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	3-UNIMOD:35	ms_run[1]:scan=1.1.2613.10	37.91423	2	1102.612847	1102.605632	R	T	20	31
PSM	ILRGENHCGIESEIVAGIPR	4431	sp|P10605|CATB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	8-UNIMOD:4	ms_run[1]:scan=1.1.2726.7	41.06703	4	2219.151694	2219.148085	K	T	312	332
PSM	QSMWTSTISSHLATK	4432	sp|Q8BVI4|DHPR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2678.11	39.71537	3	1676.818571	1676.819206	K	H	107	122
PSM	FPGQLNADLR	4433	sp|A2AQ07|TBB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2644.10	38.77103	2	1129.585847	1129.588007	R	K	242	252
PSM	FPGQLNADLR	4434	sp|A2AQ07|TBB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2650.11	38.94237	2	1129.585847	1129.588007	R	K	242	252
PSM	FPGQLNADLR	4435	sp|A2AQ07|TBB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2643.16	38.74787	2	1129.585847	1129.588007	R	K	242	252
PSM	IRVTVPALLR	4436	sp|Q91XE4|ACY3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2774.2	42.39347	3	1136.733671	1136.739363	K	L	300	310
PSM	FLENYDAIR	4437	sp|Q9JKB1|UCHL3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2699.11	40.29597	2	1139.558047	1139.561124	K	V	137	146
PSM	IGQFQLMQGK	4438	sp|Q9JHI5|IVD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2650.12	38.9432	2	1148.600647	1148.601214	K	M	317	327
PSM	FYADLAPEAR	4439	sp|Q3TW96|UAP1L_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2620.10	38.10288	2	1151.559447	1151.561124	R	A	22	32
PSM	KWLPELVDR	4440	sp|Q9EQ20|MMSA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2672.12	39.54673	2	1154.641447	1154.644794	K	A	331	340
PSM	QFSYTHICAGASAFGK	4441	sp|Q99LC5|ETFA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	8-UNIMOD:4	ms_run[1]:scan=1.1.2640.13	38.66022	3	1743.805871	1743.803890	K	N	102	118
PSM	TGPNLHGLFGR	4442	sp|P62897|CYC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2590.3	37.2689	3	1167.608471	1167.614891	K	K	29	40
PSM	STLNEIYFGK	4443	sp|P47757|CAPZB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2777.16	42.4885	2	1170.590847	1170.592090	R	T	226	236
PSM	DVRPITEQIAVTAGCK	4444	sp|Q91WU0|CES1F_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	15-UNIMOD:4	ms_run[1]:scan=1.1.2682.13	39.83109	3	1756.921871	1756.914169	K	T	259	275
PSM	ILEATAHAQAQLGCPVIIHPGR	4445	sp|Q60866|PTER_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	14-UNIMOD:4	ms_run[1]:scan=1.1.2673.17	39.57875	4	2351.258894	2351.253219	K	N	183	205
PSM	NPITSVDAAFR	4446	sp|Q91X72|HEMO_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2776.9	42.45498	2	1189.607447	1189.609137	K	G	92	103
PSM	FATVEVTDKPVDEALR	4447	sp|Q9R257|HEBP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2704.9	40.43765	3	1788.932471	1788.925779	K	E	41	57
PSM	ALNDHHVYLEGTLLKPNMVTAGHACTK	4448	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15	25-UNIMOD:4	ms_run[1]:scan=1.1.2590.14	37.27808	5	2989.5102	2989.4902	K	K	216	243
PSM	SGAQATWTEVSWPHEK	4449	sp|Q91X72|HEMO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2709.15	40.58577	3	1812.840671	1812.843112	K	V	385	401
PSM	LTGTIQNDILK	4450	sp|P16332|MUTA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2632.13	38.4361	2	1214.684447	1214.687053	K	E	211	222
PSM	VLVMEGAGHPCYLDKPDEWHK	4451	sp|Q8VCR7|ABHEB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	11-UNIMOD:4	ms_run[1]:scan=1.1.2590.16	37.27975	4	2480.169694	2480.161687	R	G	180	201
PSM	IQLVEEELDR	4452	tr|D3Z2H9|D3Z2H9_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2729.11	41.15339	2	1242.645647	1242.645582	R	A	56	66
PSM	IQLVEEELDR	4453	tr|D3Z2H9|D3Z2H9_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2736.14	41.34673	2	1242.645647	1242.645582	R	A	56	66
PSM	QVVDSAYEVIK	4454	sp|P06151|LDHA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2610.14	37.8343	2	1249.651647	1249.655418	K	L	233	244
PSM	EKLEASITEYA	4455	sp|P10639|THIO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2706.15	40.49998	2	1252.617247	1252.618698	K	-	95	106
PSM	EIEELQSQAQALSQEGK	4456	sp|Q62261|SPTB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2770.13	42.29008	3	1886.932271	1886.922151	K	S	1435	1452
PSM	YMACCLLYR	4457	sp|P05213|TBA1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	2-UNIMOD:35,4-UNIMOD:4,5-UNIMOD:4	ms_run[1]:scan=1.1.2595.13	37.41998	2	1264.542247	1264.540271	K	G	312	321
PSM	MAEDLILYGTK	4458	sp|Q91YI0|ARLY_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	1-UNIMOD:35	ms_run[1]:scan=1.1.2761.18	42.04296	2	1268.632047	1268.632240	R	E	256	267
PSM	GELASYDMQLR	4459	tr|Q91VA7|Q91VA7_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2691.11	40.07497	2	1281.602847	1281.602337	K	R	122	133
PSM	SFNDDAMLIEK	4460	sp|Q99MR8|MCCA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2779.13	42.54175	2	1281.592647	1281.591103	K	F	234	245
PSM	LCVIAECGELK	4461	sp|Q9CR16|PPID_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	2-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=1.1.2627.17	38.29962	2	1290.634447	1290.631195	K	E	175	186
PSM	LEAYHTQTTPLVEYYR	4462	sp|Q9WTP6|KAD2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2710.12	40.61178	3	1982.974571	1982.973792	R	K	187	203
PSM	GTPLDTEVPLER	4463	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2744.17	41.5741	2	1325.682647	1325.682696	K	V	819	831
PSM	FLIPNASQPESK	4464	sp|P63101|1433Z_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2602.16	37.61548	2	1329.693647	1329.692866	K	V	104	116
PSM	YALYDATYETK	4465	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2595.16	37.4225	2	1336.616847	1336.618698	R	E	82	93
PSM	DYEEIGPSICR	4466	sp|Q99JY9|ARP3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	10-UNIMOD:4	ms_run[1]:scan=1.1.2670.16	39.4947	2	1337.591847	1337.592166	K	H	399	410
PSM	LTSEDLSDDAFK	4467	sp|Q9DBT9|M2GD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2668.16	39.43992	2	1339.614847	1339.614341	K	F	637	649
PSM	HFSVEGQLEFR	4468	sp|P07901|HS90A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2663.10	39.30398	2	1347.658247	1347.657149	K	A	329	340
PSM	ILLTEPPMNPTK	4469	sp|P61161|ARP2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2768.18	42.23865	2	1352.739447	1352.737374	K	N	107	119
PSM	ATLPSPDKLPGFK	4470	sp|Q02053|UBA1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2722.5	40.9507	3	1369.759571	1369.760552	K	M	831	844
PSM	ELAEQLGLSTGEK	4471	sp|Q9Z1D1|EIF3G_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2675.16	39.63402	2	1373.713647	1373.703825	K	E	181	194
PSM	YSGCLTESNLIK	4472	sp|P21981|TGM2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	4-UNIMOD:4	ms_run[1]:scan=1.1.2587.17	37.19652	2	1383.668247	1383.670417	K	V	550	562
PSM	SLVESVPTPSMNK	4473	sp|Q91VM9|IPYR2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2638.14	38.60427	2	1387.702447	1387.701716	R	E	304	317
PSM	FAEVLPDGTYQR	4474	sp|Q9QXD1|ACOX2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2715.17	40.75933	2	1394.686847	1394.683030	R	L	271	283
PSM	GNPTVEVDLYTAK	4475	sp|P17182|ENOA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2702.16	40.3859	2	1405.710847	1405.708910	R	G	16	29
PSM	QLFHPEQLITGK	4476	sp|P05213|TBA1B_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2760.4	42.00317	3	1409.765471	1409.766700	R	E	85	97
PSM	ETTIQGLDGLSER	4477	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2646.19	38.83527	2	1417.708047	1417.704888	K	C	122	135
PSM	TGTAEMSSILEER	4478	sp|Q03265|ATPA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2734.16	41.29357	2	1422.668847	1422.666059	K	I	46	59
PSM	TINEVENQILTR	4479	sp|P57780|ACTN4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2753.19	41.82168	2	1428.755047	1428.757257	R	D	747	759
PSM	LTGFHETSNINDFSAGVANR	4480	sp|P15105|GLNA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2719.16	40.87388	3	2149.027271	2149.018845	R	G	300	320
PSM	MVNSNLASVEELK	4481	sp|P35486|ODPA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2701.18	40.35887	2	1432.725447	1432.723180	R	E	324	337
PSM	LVPGWTKPITIGR	4482	sp|P54071|IDHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2764.4	42.11532	3	1436.848571	1436.850370	R	H	160	173
PSM	YHTSQSGDEMTSLSEYVSR	4483	sp|P11499|HS90B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2716.20	40.7906	3	2175.943571	2175.937877	R	M	457	476
PSM	LREMLNISGPPLK	4484	sp|Q9CPY7|AMPL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2714.5	40.72045	3	1466.823371	1466.827920	K	A	67	80
PSM	VILSSSSSCLLPSK	4485	sp|Q99KP3|CRYL1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	9-UNIMOD:4	ms_run[1]:scan=1.1.2735.19	41.32342	2	1476.788247	1476.785781	R	L	117	131
PSM	TASNVEEAFINTAK	4486	sp|P53994|RAB2A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2747.20	41.6597	2	1493.734447	1493.736188	K	E	152	166
PSM	GVIALCIEDGSIHR	4487	sp|Q8K2B3|SDHA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	6-UNIMOD:4	ms_run[1]:scan=1.1.2777.9	42.48267	3	1538.788871	1538.787512	R	I	233	247
PSM	AEAEAQAEELSFPR	4488	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2716.21	40.79143	2	1546.732647	1546.726351	R	S	929	943
PSM	NTQIIIQEESGIPK	4489	sp|P16332|MUTA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2717.21	40.8204	2	1568.844047	1568.840987	R	V	405	419
PSM	NAVTQEFGPVPDTAR	4490	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2696.21	40.22012	2	1600.787047	1600.784535	R	Y	634	649
PSM	IQPLPSYEDQNFR	4491	sp|Q5U5V2|HYKK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2776.20	42.46415	2	1605.784247	1605.778721	K	V	37	50
PSM	TSQVTSSDLESTLEK	4492	sp|Q6PB66|LPPRC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2588.21	37.22778	2	1623.785047	1623.783926	K	L	655	670
PSM	HGGTIPVVPTAEFQDR	4493	sp|P26443|DHE3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2673.21	39.58208	2	1722.871847	1722.868933	K	I	481	497
PSM	HLEINPDHPIVETLR	4494	sp|P11499|HS90B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2610.13	37.83347	3	1781.942171	1781.942433	K	Q	625	640
PSM	SQIFSTASDNQPTVTIK	4495	sp|P20029|BIP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2745.20	41.60455	2	1835.933047	1835.926508	K	V	449	466
PSM	FDALTMHVQPQVAAQQK	4496	sp|Q62468|VILI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2667.7	39.4102	3	1910.966171	1910.967267	K	M	375	392
PSM	FFQEEVIPHHTEWEK	4497	sp|P51174|ACADL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2613.6	37.9109	4	1954.927294	1954.921363	K	A	67	82
PSM	SVVLMSHLGRPDGVPMPDK	4498	sp|P09411|PGK1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2703.19	40.4172	3	2034.050171	2034.039052	K	Y	57	76
PSM	RAATVMLAAGWTHSSPAGFR	4499	sp|P11930|NUD19_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2705.17	40.47301	3	2086.058471	2086.053062	R	L	9	29
PSM	MGLLAVLR	4500	sp|Q9CYR6|AGM1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3084.2	51.0793	2	871.526647	871.531344	R	S	42	50
PSM	LFFLQVK	4501	sp|P26040|EZRI_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3128.2	52.30983	2	893.532847	893.537475	K	D	101	108
PSM	EFMWALK	4502	sp|P62774|MTPN_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3074.2	50.79555	2	923.453247	923.457510	K	N	5	12
PSM	QFSLFLGK	4503	sp|P48774|GSTM5_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3064.2	50.5091	2	938.519647	938.522553	K	F	140	148
PSM	IIWQFIK	4504	sp|P54071|IDHP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3165.2	53.36015	2	946.560247	946.564024	R	E	61	68
PSM	ISVNDFIIK	4505	sp|Q8BMF4|ODP2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3170.2	53.49743	2	1047.596047	1047.596447	K	A	469	478
PSM	MDELQLFR	4506	sp|Q01853|TERA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3042.4	49.897	2	1050.518447	1050.516816	K	G	46	54
PSM	GDFWLMGDR	4507	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3163.3	53.30652	2	1095.480247	1095.480765	R	G	440	449
PSM	GDFWLMGDR	4508	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3176.3	53.66593	2	1095.480247	1095.480765	R	G	440	449
PSM	AGLLEPEVFHLNPAR	4509	sp|P52825|CPT2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3058.2	50.3432	3	1661.890571	1661.888940	R	S	168	183
PSM	QGEIFLLPAR	4510	sp|Q78JT3|3HAO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3054.7	50.23915	2	1142.642247	1142.644794	R	V	79	89
PSM	LVFLGLDNAGK	4511	sp|P36536|SAR1A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3078.5	50.9106	2	1145.637847	1145.644459	K	T	28	39
PSM	DHINLPGFCGQNPLR	4512	sp|P23492|PNPH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	9-UNIMOD:4	ms_run[1]:scan=1.1.2984.3	48.3024	3	1736.854271	1736.841673	R	G	134	149
PSM	ISVAGVTSGNVGYLAHAIHQVTK	4513	sp|P05202|AATM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3078.6	50.91143	4	2321.259294	2321.249179	R	-	408	431
PSM	TAVETAVLLLR	4514	sp|P80318|TCPG_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3182.4	53.83537	2	1184.712447	1184.712873	K	I	508	519
PSM	ELVPIAAQLDREHLFPTAQVK	4515	sp|Q07417|ACADS_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3178.10	53.72887	4	2374.311294	2374.300881	K	K	52	73
PSM	YIIWSPVCR	4516	sp|P11352|GPX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	8-UNIMOD:4	ms_run[1]:scan=1.1.3047.9	50.04447	2	1192.608047	1192.606300	K	N	147	156
PSM	DAGTIAGLNVLR	4517	sp|P63017|HSP7C_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3096.9	51.42758	2	1198.669447	1198.666986	K	I	160	172
PSM	FATEAAITILR	4518	sp|P11983|TCPA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3028.9	49.5097	2	1204.675047	1204.681573	K	I	516	527
PSM	LYLVDLAGSEK	4519	sp|P28738|KIF5C_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3009.8	48.99612	2	1206.645447	1206.649604	K	V	228	239
PSM	ALLANALTSALR	4520	sp|Q9CR67|TMM33_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3177.5	53.69612	2	1212.716447	1212.719021	R	L	58	70
PSM	DVVVDLVCYR	4521	tr|E9Q7L0|E9Q7L0_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	8-UNIMOD:4	ms_run[1]:scan=1.1.3152.7	52.9996	2	1236.618047	1236.617259	K	R	506	516
PSM	TFESLVDFCK	4522	sp|Q61425|HCDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	9-UNIMOD:4	ms_run[1]:scan=1.1.3107.8	51.73098	2	1244.575847	1244.574725	K	T	193	203
PSM	SYQANSLVITAGPWTNR	4523	sp|Q9D826|SOX_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3155.8	53.08767	3	1876.944971	1876.943161	K	L	192	209
PSM	PLPGITVGDIGPK	4524	sp|Q9R0H0|ACOX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3000.12	48.74563	2	1262.721647	1262.723438	K	F	217	230
PSM	VGEIEFEGLMR	4525	sp|Q9QYB5|ADDG_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3155.9	53.0885	2	1278.628047	1278.627823	K	T	366	377
PSM	AATFFGCIGIDK	4526	sp|P55264|ADK_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	7-UNIMOD:4	ms_run[1]:scan=1.1.3142.5	52.70972	2	1298.631847	1298.632909	K	F	99	111
PSM	TQEILSQLPFK	4527	sp|Q9QUH0|GLRX1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3123.13	52.177	2	1302.723847	1302.718353	K	Q	29	40
PSM	DVLSVAFSSDNR	4528	sp|P68040|RACK1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3048.13	50.0765	2	1308.631047	1308.630994	K	Q	107	119
PSM	LGQLNIDISNIK	4529	sp|Q64516|GLPK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3066.11	50.57372	2	1326.752647	1326.750716	K	A	75	87
PSM	AVDLLYAMCDR	4530	sp|P17427|AP2A2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	9-UNIMOD:4	ms_run[1]:scan=1.1.3124.10	52.20277	2	1325.612647	1325.610793	R	S	388	399
PSM	DVFHMVVEVPR	4531	sp|Q9D819|IPYR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3109.3	51.78243	3	1326.676571	1326.675442	K	W	42	53
PSM	LAGQIFLGGSIVR	4532	sp|P17563|SBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3147.11	52.85835	2	1329.779847	1329.776871	R	G	345	358
PSM	LQYAVISEAWR	4533	sp|Q99KP3|CRYL1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3075.11	50.83123	2	1334.703247	1334.698286	R	L	198	209
PSM	FLVYVANFDEK	4534	sp|Q61598|GDIB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3176.9	53.67093	2	1343.682647	1343.676154	K	D	143	154
PSM	TLTIVDTGIGMTK	4535	sp|P07901|HS90A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2996.11	48.63305	2	1348.728447	1348.727203	R	A	88	101
PSM	IEDLELVPVESK	4536	sp|Q62468|VILI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15		ms_run[1]:scan=1.1.2987.6	48.39072	2	1369.7389	1369.7335	R	W	405	417
PSM	ETTDDPVEYVLK	4537	sp|Q5U5V2|HYKK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2988.4	48.41187	2	1407.676047	1407.676942	K	I	57	69
PSM	DAGVSTYMYEFR	4538	tr|D3Z5G7|D3Z5G7_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3140.15	52.66055	2	1437.626247	1437.623466	R	Y	439	451
PSM	SDIDEIVLVGGSTR	4539	sp|P20029|BIP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3071.16	50.72168	2	1459.753847	1459.751838	K	I	355	369
PSM	SEVPGIFCAGADLK	4540	sp|Q9JLZ3|AUHM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	8-UNIMOD:4	ms_run[1]:scan=1.1.3046.16	50.02153	2	1462.718047	1462.712616	R	E	106	120
PSM	TGLVFMPGTIQMR	4541	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	12-UNIMOD:35	ms_run[1]:scan=1.1.3084.12	51.08764	2	1465.743647	1465.742142	R	S	129	142
PSM	LGVEFDEITADDR	4542	sp|P04117|FABP4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15		ms_run[1]:scan=1.1.3035.19	49.71029	2	1478.7002	1478.6882	K	K	67	80
PSM	EANELQQWITEK	4543	sp|P16546|SPTN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3041.18	49.87998	2	1487.730247	1487.725623	R	E	1099	1111
PSM	EADLVFISVNTPTK	4544	sp|O70475|UGDH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3177.13	53.7028	2	1532.808647	1532.808624	R	T	81	95
PSM	GQFSTDELVAEVEK	4545	sp|Q68FD5|CLH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3090.14	51.26167	2	1550.751247	1550.746418	R	R	838	852
PSM	VKPGYLGTAFAHYDVQVIDEQGNVLPPGK	4546	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3173.18	53.59412	4	3111.629694	3111.602936	K	E	379	408
PSM	AMGAAQVVVTDLSASR	4547	sp|Q64442|DHSO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2996.18	48.63888	2	1574.814447	1574.808641	K	L	194	210
PSM	FTVTPSTTQVVGILK	4548	sp|P47754|CAZA2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3176.17	53.67762	2	1589.910447	1589.902859	K	I	179	194
PSM	VDGLLTCCSVFINK	4549	sp|Q9CWS0|DDAH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	7-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.3136.15	52.54623	2	1624.803047	1624.795300	K	K	268	282
PSM	GVNLPGAAVDLPAVSEK	4550	sp|P52480|KPYM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3103.16	51.62675	2	1635.889647	1635.883186	K	D	208	225
PSM	GFGFVCFSSPEEATK	4551	tr|A2A5N3|A2A5N3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	6-UNIMOD:4	ms_run[1]:scan=1.1.3186.19	53.95798	2	1661.750447	1661.739559	K	A	334	349
PSM	VLGCNPGPMTLQGTNTYLVGTGSR	4552	sp|Q99KR3|LACB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	4-UNIMOD:4	ms_run[1]:scan=1.1.3163.10	53.31652	3	2492.206271	2492.215179	R	R	18	42
PSM	DENATLDGGDVLFTGR	4553	sp|Q9CWS0|DDAH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3174.20	53.62366	2	1678.786847	1678.779843	K	E	121	137
PSM	LSQTFPNADFAEITK	4554	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3090.19	51.26585	2	1680.846247	1680.835902	R	L	243	258
PSM	VLAQNSGFDLQETLVK	4555	sp|P80317|TCPZ_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3099.20	51.51962	2	1760.935247	1760.930865	K	V	450	466
PSM	KQGGLGPMNIPLISDPK	4556	sp|P35700|PRDX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2996.21	48.6414	2	1763.962647	1763.960391	K	R	93	110
PSM	QGGLGPMNIPLISDPKR	4557	sp|P35700|PRDX1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3066.7	50.57038	3	1791.969971	1791.966539	K	T	94	111
PSM	GSRVEIEAIAVQGPFIK	4558	sp|P52760|RIDA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3049.10	50.10272	3	1813.011371	1813.009784	R	A	118	135
PSM	SLPAGSLISLHIYALHR	4559	sp|Q64462|CP4B1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3060.8	50.40267	3	1847.046671	1847.041753	R	N	398	415
PSM	ECDVLPDDTVSTLYNR	4560	sp|Q8R0Y6|AL1L1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	2-UNIMOD:4	ms_run[1]:scan=1.1.3061.21	50.44105	2	1895.865447	1895.857108	K	F	151	167
PSM	GHEVVVVVPEVSWQLTK	4561	sp|Q6ZQM8|UD17C_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3191.10	54.08783	3	1905.038171	1905.035999	K	P	52	69
PSM	SVPMSTVFYPSDGVATEK	4562	sp|P40142|TKT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3037.21	49.76823	2	1913.918447	1913.908081	R	A	439	457
PSM	HNQLPLVIEFTEQTAPK	4563	sp|P09103|PDIA1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3156.10	53.11825	3	1964.043671	1964.036727	K	I	233	250
PSM	HVLSTFGPVPEFSGATVER	4564	sp|Q99KP3|CRYL1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3031.11	49.59285	3	2029.029071	2029.026891	K	V	261	280
PSM	FGTCTGILTSLEEHSEQLK	4565	sp|Q8BH86|GLUCM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	4-UNIMOD:4	ms_run[1]:scan=1.1.3145.12	52.80172	3	2149.044371	2149.036135	K	E	94	113
PSM	AFVVLAPEFLSHDRDQLTK	4566	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3119.4	52.0566	4	2185.163694	2185.153154	K	V	508	527
PSM	YFHVVIAGPQDSPFEGGTFK	4567	sp|P61089|UBE2N_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3186.11	53.95132	3	2195.085371	2195.068755	R	L	34	54
PSM	EATSVLGEHQALCTITSFPR	4568	sp|P97494|GSH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	13-UNIMOD:4	ms_run[1]:scan=1.1.3067.17	50.6075	3	2216.098271	2216.089567	K	L	130	150
PSM	QAPQTVHLPSGETLDVFDAAER	4569	sp|P28271|ACOC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3141.16	52.69013	3	2380.178771	2380.165903	K	Y	737	759
PSM	VTYMVHDFEEGGGVAMGMYNQDK	4570	sp|O88844|IDHC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3066.18	50.57957	3	2577.116471	2577.097431	K	S	165	188
PSM	GSNTCELVFEDCKVPAANVLSQESK	4571	sp|Q9JHI5|IVD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	5-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.3025.10	49.43867	3	2781.313271	2781.294946	R	G	248	273
PSM	TFPTVNPSTGEVICQVAEGNKEDVDK	4572	sp|P47738|ALDH2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	14-UNIMOD:4	ms_run[1]:scan=1.1.3031.21	49.60118	3	2833.360271	2833.344004	K	A	55	81
PSM	LLSHCLLVTLASHHPADFTPAVHASLDK	4573	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	5-UNIMOD:4	ms_run[1]:scan=1.1.3061.11	50.43272	5	3049.599618	3049.580761	K	F	101	129
PSM	TADGDLAGTVHPQLQDHDFEPLRPGEPIFK	4574	sp|Q91XE4|ACY3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3060.11	50.40517	5	3299.648618	3299.621105	R	L	233	263
PSM	TLTQCSWLLDGFPR	4575	sp|Q9WTP7|KAD3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	5-UNIMOD:4	ms_run[1]:scan=1.1.3504.7	62.8397	2	1692.841447	1692.829377	K	T	81	95
PSM	DFLGGLAFR	4576	sp|P16331|PH4H_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3420.2	60.50095	2	994.521247	994.523616	R	V	253	262
PSM	TLLELIPELR	4577	sp|Q6PB66|LPPRC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3628.3	66.34789	2	1195.719247	1195.717624	K	D	1304	1314
PSM	ETYLAILMDR	4578	sp|Q9Z2I8|SUCB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3410.4	60.213	2	1223.624447	1223.622010	R	S	152	162
PSM	SIESTLDDLFR	4579	sp|A2ASQ1|AGRIN_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3630.5	66.40735	2	1294.644647	1294.640496	R	N	1052	1063
PSM	IVPVEITISLLK	4580	sp|Q9DBP5|KCY_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3624.6	66.23421	2	1323.839847	1323.837740	K	R	62	74
PSM	FVFSLVDAMNGK	4581	sp|P08249|MDHM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3454.9	61.43498	2	1326.667247	1326.664209	R	E	258	270
PSM	DDGSAVIWVTFR	4582	sp|Q9CQI6|COTL1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3566.9	64.5993	2	1364.682247	1364.672465	R	Y	19	31
PSM	SLYALVQQFATK	4583	sp|P70158|ASM3A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3496.9	62.60933	2	1367.746847	1367.744902	K	D	384	396
PSM	LLIQSEFPSLLK	4584	sp|P97816|S100G_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3472.9	61.9289	2	1386.818247	1386.812253	K	A	34	46
PSM	DSPLLLQQISAMR	4585	sp|O08788|DCTN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3475.7	62.00992	2	1470.795647	1470.786449	K	L	1089	1102
PSM	DPENFPFVVLGNK	4586	sp|P51150|RAB7A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3529.15	63.5415	2	1474.752847	1474.745630	R	I	114	127
PSM	DIVLVAYGVLGTQR	4587	sp|Q91WR5|AK1CL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3616.6	66.00217	2	1502.853047	1502.845679	K	Y	210	224
PSM	TLAESALQLLYTAK	4588	sp|P26039|TLN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3619.9	66.09206	2	1520.848047	1520.845010	K	E	1767	1781
PSM	APVVMGSSEDVQEFLEIYRK	4589	sp|Q9QXD6|F16P1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3424.9	60.61887	3	2296.158971	2296.140934	K	H	315	335
PSM	DTLVWDTPYHTVWDCDFR	4590	sp|Q99NB1|ACS2L_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	15-UNIMOD:4	ms_run[1]:scan=1.1.3565.12	64.57373	3	2325.032471	2325.016068	R	T	72	90
PSM	ILNKPVPSLPNMDSVFAEAIAK	4591	sp|Q9DBM2|ECHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3472.13	61.93225	3	2353.288571	2353.271554	R	V	196	218
PSM	MPIPVIQAFGILKR	4592	sp|P97807|FUMH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3488.2	62.37383	3	1581.945071	1581.942890	R	A	85	99
PSM	MPIPVIQAFGILKR	4593	sp|P97807|FUMH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3482.2	62.20435	3	1581.945071	1581.942890	R	A	85	99
PSM	YFLVGAGAIGCELLK	4594	sp|P31254|UBA1Y_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	11-UNIMOD:4	ms_run[1]:scan=1.1.3556.10	64.31548	2	1609.858647	1609.853801	K	N	470	485
PSM	LYTLVTYVPVTTFK	4595	sp|P62900|RL31_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3487.12	62.35385	2	1643.929447	1643.917447	K	N	102	116
PSM	IAEVGGVPYLLPLVNK	4596	sp|Q91V76|CK054_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3613.16	65.92374	2	1680.994047	1680.981444	R	K	59	75
PSM	VTKEEWDIIEGLIR	4597	sp|Q9CQ62|DECR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3498.2	62.66162	3	1699.918571	1699.914486	K	K	317	331
PSM	ILGTLALIDQSETDWK	4598	sp|Q91VM9|IPYR2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3523.5	63.36063	3	1801.952471	1801.946181	K	I	183	199
PSM	EIGLLTEEVELYGETK	4599	sp|Q922D8|C1TC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3479.19	62.13275	2	1821.935047	1821.924776	R	A	337	353
PSM	KEGGLGPLNIPLLADVTK	4600	sp|Q61171|PRDX2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3480.7	62.1513	3	1834.062971	1834.056400	R	S	92	110
PSM	VAPAPAGVFTDIPISNIR	4601	sp|Q8BMF4|ODP2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3420.21	60.5168	2	1837.019047	1837.009784	R	R	407	425
PSM	TQGPYDVVVLPGGNLGAQNLSESPMVK	4602	sp|Q99LX0|PARK7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3466.19	61.77302	3	2769.427871	2769.400731	K	E	63	90
PSM	SLRPGVAIADFVIFPPR	4603	sp|O09173|HGD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3529.7	63.53483	3	1854.058871	1854.051589	K	W	305	322
PSM	TLSLDEVYLIDSGAQYK	4604	sp|Q6P1B1|XPP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3449.20	61.30267	2	1913.970247	1913.962225	R	D	405	422
PSM	INVLPLGSGAIAGNPLGVDR	4605	sp|Q91YI0|ARLY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3486.21	62.33312	2	1932.092447	1932.079260	R	E	194	214
PSM	TFSDIQDVQILCHFVR	4606	sp|Q9D826|SOX_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	12-UNIMOD:4	ms_run[1]:scan=1.1.3426.11	60.67612	3	1976.993171	1976.977832	K	D	288	304
PSM	LLVEHQGVSFLLAEMAMK	4607	sp|P45952|ACADM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3541.6	63.87938	3	2015.069771	2015.058390	K	V	312	330
PSM	AREYLISLDPENLTLLEK	4608	sp|Q9DC50|OCTC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3478.9	62.09597	3	2116.157771	2116.141586	K	I	251	269
PSM	KAQGTGELTQLLNSLCTAIK	4609	sp|Q9QXD6|F16P1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	16-UNIMOD:4	ms_run[1]:scan=1.1.3602.6	65.59918	3	2145.158771	2145.146354	R	A	24	44
PSM	FSIASDYRLEEDVLPEMGIK	4610	tr|A0A0R4J0I1|A0A0R4J0I1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3495.16	62.58618	3	2311.159871	2311.140600	K	E	315	335
PSM	AIVAGDEVAQEVDAVAPDCSFLK	4611	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	19-UNIMOD:4	ms_run[1]:scan=1.1.3517.20	63.20115	3	2403.182471	2403.162792	R	I	156	179
PSM	ENTEGEYSGIEHVIVDGVVQSIK	4612	sp|Q9D6R2|IDH3A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3569.19	64.69186	3	2501.247671	2501.228563	R	L	147	170
PSM	HGLEVIYMIEPIDEYCVQQLK	4613	sp|P07901|HS90A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	16-UNIMOD:4	ms_run[1]:scan=1.1.3601.13	65.57623	3	2576.286071	2576.265483	K	E	515	536
PSM	IDATQVEVNPFGETPEGQVVCFDAK	4614	sp|Q9Z2I8|SUCB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	21-UNIMOD:4	ms_run[1]:scan=1.1.3522.19	63.34353	3	2749.315871	2749.290512	K	I	236	261
PSM	RPLIDQVVQTALSETQDPEEVSVTVK	4615	sp|Q68FD5|CLH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3625.14	66.27393	3	2880.534371	2880.508033	R	A	968	994
PSM	CSYDEHAK	4616	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1798.19	15.32495	2	991.3633	991.3700	K	L	58	66
PSM	QEPERNECFLQHK	4617	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15	1-UNIMOD:28,8-UNIMOD:4	ms_run[1]:scan=1.1.2194.17	26.3575	3	1696.7617	1696.7622	K	D	118	131
PSM	SGQASAKPNLR	4618	sp|Q9DBM2|ECHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1658.8	11.43165	3	1127.597171	1127.604720	K	F	349	360
PSM	GYENGNFVGPTIISNVKPSMTCYK	4619	sp|Q9EQ20|MMSA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	22-UNIMOD:4	ms_run[1]:scan=1.1.3142.18	52.72057	3	2676.274571	2675.272359	K	E	392	416
PSM	IDIIPNPQER	4620	sp|P11499|HS90B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2697.12	40.2404	2	1193.638447	1193.640437	K	T	73	83
PSM	SIYYITGESK	4621	sp|P11499|HS90B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2447.14	33.32236	2	1159.572447	1159.576105	K	E	482	492
PSM	ARPFPDGLAEDIDKGEVSAR	4622	sp|P58252|EF2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15		ms_run[1]:scan=1.1.2755.21	41.87793	3	2142.0822	2142.0702	K	Q	606	626
PSM	RCLYASVLTAQPR	4623	sp|P58252|EF2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	2-UNIMOD:4	ms_run[1]:scan=1.1.2488.9	34.43279	3	1533.801071	1533.808582	R	L	727	740
PSM	AHRFPALTPEQK	4624	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15	1-UNIMOD:1	ms_run[1]:scan=1.1.2302.8	29.31655	3	1435.7534	1435.7567	M	K	2	14
PSM	TAVCDIPPR	4625	sp|P68372|TBB4B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	4-UNIMOD:4	ms_run[1]:scan=1.1.2086.13	23.32647	2	1028.513447	1027.512065	K	G	351	360
PSM	TASSVLLHTGQK	4626	sp|Q9JII6|AK1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15	1-UNIMOD:1	ms_run[1]:scan=1.1.2509.17	35.022	2	1282.6859	1282.6876	M	M	2	14
PSM	QGFGNLPICMAK	4627	sp|Q922D8|C1TC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	9-UNIMOD:4	ms_run[1]:scan=1.1.2990.13	48.47227	2	1335.649047	1334.647513	K	T	855	867
PSM	RQVEIAQR	4628	sp|P16460|ASSY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1701.3	12.62462	3	998.552171	998.562127	R	E	101	109
PSM	VIPELNGK	4629	sp|P16858|G3P_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15		ms_run[1]:scan=1.1.2208.5	26.73768	2	868.4955	868.5013	K	L	218	226
PSM	QASEGPLK	4630	sp|P16858|G3P_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15	1-UNIMOD:28	ms_run[1]:scan=1.1.2138.7	24.76417	2	811.4004	811.4071	K	G	262	270
PSM	IHFPLATYAPVISAEK	4631	sp|P05213|TBA1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3123.6	52.17117	3	1755.954971	1755.955957	R	A	265	281
PSM	FDLMYAK	4632	sp|P05213|TBA1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2702.3	40.37505	2	886.422247	886.425876	K	R	395	402
PSM	LTEVPALVHK	4633	sp|Q61838|PZP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2285.2	28.8476	3	1105.643171	1105.649545	K	D	899	909
PSM	TQSTVENLSK	4634	sp|Q64516|GLPK_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1862.19	17.12023	2	1105.557647	1105.561518	R	R	119	129
PSM	VVAGVAAALAHK	4635	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2273.4	28.51412	3	1105.655771	1105.660778	K	Y	134	146
PSM	AYGIESHVLSPAETK	4636	sp|Q99LB7|SARDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2426.15	32.74567	3	1600.806971	1600.809687	K	S	175	190
PSM	FHHSLTDHTR	4637	sp|Q99LB7|SARDH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1651.12	11.24273	3	1249.584371	1249.595218	R	W	446	456
PSM	ESGSDAWK	4638	sp|Q9DBF1|AL7A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1796.15	15.26533	2	878.371847	878.377011	R	Q	507	515
PSM	VDFNVPMK	4639	sp|P09041|PGK2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2648.4	38.87935	2	948.469647	948.473889	R	N	23	31
PSM	HFRDEELSCSVLELK	4640	sp|P07759|SPA3K_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	9-UNIMOD:4	ms_run[1]:scan=1.1.2682.17	39.83443	3	1860.912071	1860.903998	R	Y	252	267
PSM	MQQVEASLQPETLRK	4641	sp|P07759|SPA3K_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2383.18	31.55345	3	1756.916171	1756.914169	R	W	283	298
PSM	SSLPGSREPLLR	4642	sp|Q91XE4|ACY3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15	1-UNIMOD:1	ms_run[1]:scan=1.1.2668.17	39.44075	2	1352.7411	1352.7407	M	V	2	14
PSM	QNPGMPCR	4643	sp|Q91XE4|ACY3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15	1-UNIMOD:28,7-UNIMOD:4	ms_run[1]:scan=1.1.2199.10	26.49208	2	941.3811	941.3842	R	L	145	153
PSM	THINIVVIGHVDSGK	4644	sp|P10126|EF1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15		ms_run[1]:scan=1.1.2409.10	32.2693	3	1588.8702	1587.8732	K	S	6	21
PSM	AFLEQAR	4645	sp|O35488|S27A2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15		ms_run[1]:scan=1.1.2096.6	23.59695	2	833.4333	833.4390	R	K	58	65
PSM	AFLEQAR	4646	sp|O35488|S27A2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15		ms_run[1]:scan=1.1.2089.10	23.40878	2	833.4333	833.4390	R	K	58	65
PSM	VGVPTETGALTLNR	4647	sp|Q8BWT1|THIM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2742.17	41.51802	2	1426.780247	1426.777993	R	L	77	91
PSM	ASAYVFASPGCK	4648	sp|Q9Z0S1|BPNT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	11-UNIMOD:4	ms_run[1]:scan=1.1.2422.20	32.63762	2	1256.577047	1256.585959	K	K	233	245
PSM	RDDGSWEVIEGYR	4649	sp|P26443|DHE3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2776.5	42.45163	3	1580.718671	1580.721935	R	A	124	137
PSM	LQHGSILGFPK	4650	sp|P26443|DHE3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2483.5	34.28975	3	1195.665371	1195.671343	K	A	353	364
PSM	QMVETELK	4651	sp|P62259|1433E_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15		ms_run[1]:scan=1.1.2106.16	23.88045	2	976.4835	976.4894	R	L	87	95
PSM	FLQENLAPK	4652	sp|Q9JHI5|IVD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2403.14	32.1061	2	1058.570847	1058.576046	K	A	57	66
PSM	GSNTCELVFEDCK	4653	sp|Q9JHI5|IVD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	5-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.2582.21	37.06178	2	1558.648247	1557.643944	R	V	248	261
PSM	GVYVLMSGLDLER	4654	sp|Q9JHI5|IVD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3415.10	60.36347	2	1450.752247	1450.749001	K	L	273	286
PSM	KVEFIEELPK	4655	sp|Q3UNX5|ACSM3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2623.8	38.18217	2	1231.682447	1230.685990	R	T	552	562
PSM	QVAQNLDR	4656	sp|Q8CHT0|AL4A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15	1-UNIMOD:28	ms_run[1]:scan=1.1.2297.11	29.17793	2	925.4545	925.4612	R	F	296	304
PSM	QHLQIQSSQSHLNK	4657	sp|Q91XE0|GLYAT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15	1-UNIMOD:28	ms_run[1]:scan=1.1.2082.18	23.21957	3	1629.8216	1629.8218	K	T	100	114
PSM	QHLQIQSSQSHLNK	4658	sp|Q91XE0|GLYAT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15	1-UNIMOD:28	ms_run[1]:scan=1.1.2085.21	23.30503	2	1629.8155	1629.8218	K	T	100	114
PSM	RAAAEVNQEYGLDPK	4659	sp|P97807|FUMH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15		ms_run[1]:scan=1.1.2152.17	25.16997	3	1659.8218	1659.8211	K	I	98	113
PSM	TTTSAVIVHCMR	4660	sp|Q91WU0|CES1F_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	10-UNIMOD:4	ms_run[1]:scan=1.1.2117.11	24.18098	3	1375.674071	1374.674790	K	Q	275	287
PSM	QKTEEELLEIMHK	4661	sp|Q91WU0|CES1F_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15	1-UNIMOD:28	ms_run[1]:scan=1.1.2986.2	48.35632	3	1609.8031	1609.8016	R	L	287	300
PSM	CLQNHPEHM	4662	sp|P13707|GPDA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.2361.10	30.94937	2	1147.4505	1147.4534	R	-	341	350
PSM	SHHWGYSK	4663	sp|P00920|CAH2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15	1-UNIMOD:1	ms_run[1]:scan=1.1.1816.21	15.83335	2	1042.4560	1042.4616	M	H	2	10
PSM	TYFQGSLPAR	4664	sp|P52760|RIDA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2478.12	34.15925	2	1138.574647	1138.577108	K	A	98	108
PSM	KQGGLGPMNIPLISDPK	4665	sp|P35700|PRDX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2992.6	48.52288	3	1763.951471	1763.960391	K	R	93	110
PSM	QITINDLPVGR	4666	sp|P35700|PRDX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15	1-UNIMOD:28	ms_run[1]:scan=1.1.3465.4	61.73312	2	1207.6566	1207.6556	R	S	141	152
PSM	YLVEEIK	4667	sp|Q9DBE0|CSAD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2418.4	32.51373	2	892.484247	892.490585	R	K	390	397
PSM	LSQVAPVLK	4668	sp|Q9DBE0|CSAD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2326.10	29.98587	2	954.585247	953.590967	R	E	434	443
PSM	LLVVDPETDER	4669	sp|P70441|NHRF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2622.8	38.15759	2	1284.656847	1284.656146	R	L	88	99
PSM	AVIFCLSADKK	4670	sp|Q9R0P5|DEST_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	5-UNIMOD:4	ms_run[1]:scan=1.1.2456.5	33.55808	3	1250.670071	1250.669294	K	C	35	46
PSM	NTDEMVELR	4671	sp|P61979|HNRPK_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2352.15	30.70508	2	1105.505447	1105.507374	R	I	38	47
PSM	LLIIQR	4672	sp|O89019|INVS_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2579.2	36.96325	2	754.499047	754.506509	R	E	898	904
PSM	AAALQR	4673	sp|Q99KR3|LACB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15	1-UNIMOD:1	ms_run[1]:scan=1.1.2187.3	26.14693	2	670.3693	670.3757	M	I	2	8
PSM	IFYTTTPVK	4674	sp|Q99KR3|LACB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2426.15	32.74567	2	1068.582647	1068.585548	K	K	274	283
PSM	YVWLVYEQEQPLSCDEPILSNK	4675	sp|P70296|PEBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	14-UNIMOD:4	ms_run[1]:scan=1.1.3608.15	65.77908	3	2709.322871	2709.299620	R	S	120	142
PSM	QHYIDLK	4676	tr|E9PZF0|E9PZF0_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15	1-UNIMOD:28	ms_run[1]:scan=1.1.2394.10	31.85597	2	898.4501	898.4543	K	D	165	172
PSM	HEAGDMMGGHAIR	4677	sp|P10605|CATB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1885.12	17.75655	3	1380.598271	1380.602688	K	I	269	282
PSM	DGETFQLMGLYGREPDLSSDIK	4678	sp|A2BIM8|MUP18_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3469.15	61.85188	3	2470.182071	2470.168605	K	E	129	151
PSM	DSLLQDGEFTMDLR	4679	sp|P62962|PROF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3519.9	63.2489	2	1638.765847	1638.755937	R	T	76	90
PSM	VDREQLVQK	4680	sp|P61982|1433G_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15	1-UNIMOD:1	ms_run[1]:scan=1.1.2216.19	26.96175	2	1155.6192	1155.6243	M	A	2	11
PSM	NSRPEANEALER	4681	sp|Q9QYB1|CLIC4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1803.15	15.46273	3	1384.661471	1384.669505	K	G	131	143
PSM	VRELESTIAVDPGNR	4682	sp|Q8BH86|GLUCM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2384.16	31.57995	3	1654.870871	1654.863848	K	G	296	311
PSM	ARVDLFPTDIGLHK	4683	sp|P21981|TGM2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2776.5	42.45163	3	1580.867171	1580.867477	K	L	649	663
PSM	ITDPEILESR	4684	sp|Q8K010|OPLA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15		ms_run[1]:scan=1.1.2531.17	35.6459	2	1171.6145	1171.6079	R	Y	1145	1155
PSM	LTIAEER	4685	sp|P62702|RS4X_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2014.10	21.34455	2	830.454647	830.449782	R	D	246	253
PSM	ADIQTER	4686	sp|P62281|RS11_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15	1-UNIMOD:1	ms_run[1]:scan=1.1.2140.6	24.82045	2	873.4113	873.4187	M	A	2	9
PSM	GYVSCALGCPYEGK	4687	sp|P38060|HMGCL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	5-UNIMOD:4,9-UNIMOD:4	ms_run[1]:scan=1.1.2582.21	37.06178	2	1559.673247	1559.674850	R	V	166	180
PSM	IQIWDTAGQER	4688	sp|Q8K386|RAB15_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2700.19	40.3311	2	1315.651647	1315.652064	R	Y	59	70
PSM	QHVPLDEYSANLR	4689	sp|Q9DB29|IAH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15		ms_run[1]:scan=1.1.2450.6	33.40297	3	1540.7582	1540.7629	K	D	100	113
PSM	SDAAVDTSSEITTK	4690	sp|P26350|PTMA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15	1-UNIMOD:1	ms_run[1]:scan=1.1.2566.19	36.61117	2	1465.6784	1465.6779	M	D	2	16
PSM	VGQPGAAGPVSPMCPGR	4691	sp|P29699|FETUA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	14-UNIMOD:4	ms_run[1]:scan=1.1.2397.21	31.94715	2	1637.780647	1636.781381	K	I	323	340
PSM	FASCFYGPFR	4692	sp|P10518|HEM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	4-UNIMOD:4	ms_run[1]:scan=1.1.2992.7	48.52457	2	1250.549647	1250.554265	K	D	200	210
PSM	CLDEFPNLK	4693	sp|P48774|GSTM5_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.3599.2	65.50965	2	1117.5100	1117.5109	K	A	177	186
PSM	VHIEIGPDGR	4694	sp|Q9Z2X1|HNRPF_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15		ms_run[1]:scan=1.1.2180.6	25.95387	3	1091.5687	1091.5718	R	V	317	327
PSM	AAAAVVEFQR	4695	sp|Q8BG32|PSD11_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15	1-UNIMOD:1	ms_run[1]:scan=1.1.3124.3	52.19692	2	1102.5745	1102.5766	M	A	2	12
PSM	GVNTFSPEGR	4696	sp|Q9Z2U1|PSA5_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2112.16	24.04507	2	1062.506447	1062.509423	R	L	11	21
PSM	LIFQMPQNK	4697	tr|F8VQ29|F8VQ29_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2768.13	42.23448	2	1117.597047	1117.595401	K	T	974	983
PSM	RVIEQLGGK	4698	sp|Q8BVE3|VATH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1840.18	16.50608	2	998.579247	998.587279	K	Q	426	435
PSM	AEGQVLVLDGR	4699	sp|P19253|RL13A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15	1-UNIMOD:1	ms_run[1]:scan=1.1.3161.4	53.25303	2	1197.6349	1197.6348	M	G	2	13
PSM	SDKPDMAEIEK	4700	sp|P20065-2|TYB4-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15	1-UNIMOD:1	ms_run[1]:scan=1.1.2320.19	29.82505	2	1303.5932	1303.5961	M	F	2	13
PSM	ALVVTVDAPVLGNR	4701	sp|Q9NYQ2|HAOX2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3071.15	50.72085	2	1422.815447	1422.819464	K	R	152	166
PSM	LHSYATSIR	4702	sp|P70404|IDHG1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1884.5	17.72293	3	1046.549471	1046.550893	K	K	341	350
PSM	KVEEAEPEEFVVEK	4703	sp|P23198|CBX3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2406.14	32.18975	3	1661.817371	1660.819583	K	V	21	35
PSM	ATAEKIK	4704	sp|Q69Z23|DYH17_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1670.7	11.76205	2	758.442847	759.449054	K	C	3287	3294
PSM	SQIALK	4705	sp|P14152|MDHC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.1834.5	16.32788	2	657.398447	658.401376	K	L	165	171
PSM	ENPVQFK	4706	sp|P26040|EZRI_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2137.10	24.73808	2	862.438247	860.439218	K	F	73	80
PSM	TAVCDIPPR	4707	sp|P68372|TBB4B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	4-UNIMOD:4	ms_run[1]:scan=1.1.2184.15	26.0719	2	1029.510447	1027.512065	K	G	351	360
PSM	DAADAVR	4708	sp|P84104|SRSF3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2211.3	26.8134	2	717.353247	716.345317	R	E	58	65
PSM	SDDIINSSGYR	4709	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2368.16	31.13883	2	1227.553247	1225.557495	R	I	463	474
PSM	LPSDVVTSVR	4710	sp|P29758|OAT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2426.16	32.7465	2	1072.589647	1071.592424	K	G	363	373
PSM	GAVSAEQVIAGFNR	4711	sp|O70591|PFD2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2985.7	48.33952	2	1416.721447	1417.731377	K	L	19	33
PSM	LELDQLEVREK	4712	sp|Q8VDC1|FYCO1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.2987.6	48.39072	2	1369.739447	1370.740545	R	Q	237	248
PSM	IIELSQTTAK	4713	sp|O35136|NCAM2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3096.7	51.42591	2	1102.622647	1102.623390	K	I	504	514
PSM	VTSAVEALLSADSASR	4714	sp|P56399|UBP5_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3126.17	52.26542	2	1576.801247	1575.810415	R	K	147	163
PSM	FVEGLPINDFSR	4715	sp|P14152|MDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1.1.3172.11	53.56035	2	1392.708847	1392.703765	K	E	299	311
PSM	VDLCATWEAMEK	4716	sp|Q91WR5|AK1CL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15	4-UNIMOD:4	ms_run[1]:scan=1.1.3174.15	53.61948	2	1452.642447	1451.642487	R	C	142	154
PSM	PGVTVK	4717	sp|Q9CZX8|RS19_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14		ms_run[1]:scan=1.1.1689.2	12.288	2	599.3597	599.3637	M	D	2	8
PSM	GRIPVNNR	4718	sp|O08749|DLDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1678.2	11.97843	3	924.516971	924.525347	K	F	335	343
PSM	DPTNIK	4719	tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1690.7	12.32052	2	686.353047	686.359905	R	W	79	85
PSM	SEIAHR	4720	sp|P07724|ALBU_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1571.7	9.02255	2	711.360247	711.366387	K	Y	29	35
PSM	HHPEDVEPALRK	4721	sp|Q9JII6|AK1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1762.4	14.30705	4	1426.728494	1426.731711	K	T	86	98
PSM	TMVGQGK	4722	sp|Q8CHT0|AL4A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1623.9	10.47052	2	719.356447	719.363610	K	T	146	153
PSM	TCIAEK	4723	sp|Q9R0P5|DEST_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	2-UNIMOD:4	ms_run[1]:scan=1.1.1636.12	10.82697	2	720.342647	720.347626	R	L	146	152
PSM	KQGGTVVYGGK	4724	sp|Q9DBF1|AL7A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1675.8	11.89998	3	1092.582971	1092.592758	K	V	390	401
PSM	VPQNPHGKPK	4725	sp|P09405|NUCL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1566.7	8.887217	3	1100.600771	1100.609077	K	G	515	525
PSM	IHLDEK	4726	sp|Q93092|TALDO_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1701.7	12.62795	2	753.396247	753.402104	K	A	287	293
PSM	TSHWPK	4727	sp|Q8JZZ0|UD3A2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1678.10	11.98512	2	754.371647	754.376223	K	D	333	339
PSM	APYANTK	4728	sp|Q62468|VILI_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1631.4	10.68685	2	763.380247	763.386454	K	R	602	609
PSM	NDIIHR	4729	sp|Q80W22|THNS2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1718.7	13.0907	2	766.401847	766.408586	R	T	288	294
PSM	KPPLDAK	4730	tr|E9Q6L7|E9Q6L7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1635.11	10.79913	2	767.448247	767.454139	R	Q	205	212
PSM	GCAQALR	4731	sp|P50247|SAHH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	2-UNIMOD:4	ms_run[1]:scan=1.1.1680.13	12.04375	2	774.375647	774.380657	K	G	227	234
PSM	REGMER	4732	sp|P14152|MDHC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1571.8	9.023383	2	776.352647	776.359921	R	K	93	99
PSM	KLEDGPK	4733	sp|P10126|EF1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1583.8	9.3607	2	785.420647	785.428319	K	F	386	393
PSM	AEVGVIAK	4734	sp|Q9JME5|AP3B2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1643.14	11.02017	2	785.468047	785.464704	K	A	335	343
PSM	LAEQAER	4735	sp|O70456|1433S_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1653.13	11.29932	2	815.406047	815.413731	K	Y	12	19
PSM	HFEQMK	4736	sp|P50247|SAHH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1667.14	11.6864	2	818.367447	818.374509	R	D	286	292
PSM	VDSIDDR	4737	sp|Q62261|SPTB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1758.14	14.20248	2	818.370247	818.377011	K	H	1250	1257
PSM	SSEEIEK	4738	sp|Q64516|GLPK_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1633.10	10.7445	2	820.377247	820.381428	K	L	347	354
PSM	KGEDFVK	4739	sp|P08249|MDHM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1707.12	12.79853	2	821.421847	821.428319	K	N	329	336
PSM	KCDLHR	4740	sp|P35486|ODPA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	2-UNIMOD:4	ms_run[1]:scan=1.1.1565.10	8.862	2	827.400047	827.407206	K	L	40	46
PSM	ESCLTPK	4741	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	3-UNIMOD:4	ms_run[1]:scan=1.1.1741.8	13.72652	2	833.388847	833.395304	K	L	199	206
PSM	MVQEAEK	4742	sp|P63017|HSP7C_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1631.6	10.69018	2	833.388047	833.395304	R	Y	518	525
PSM	ESCLTPK	4743	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14	3-UNIMOD:4	ms_run[1]:scan=1.1.1748.14	13.92218	2	833.3883	833.3948	K	L	199	206
PSM	QALAHGLK	4744	sp|Q99KI0|ACON_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1708.8	12.82497	2	836.480447	836.486837	K	C	402	410
PSM	ACQIAHDHTDHVIR	4745	sp|Q64462|CP4B1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	2-UNIMOD:4	ms_run[1]:scan=1.1.1751.12	14.004	4	1671.783294	1671.789972	R	Q	249	263
PSM	YKYEDK	4746	sp|Q8CG76|ARK72_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1626.14	10.55878	2	844.397047	844.396684	K	D	245	251
PSM	VSTEVDAR	4747	sp|Q93092|TALDO_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1756.14	14.14635	2	875.427847	875.434861	R	L	103	111
PSM	ETLQQHK	4748	sp|P08113|ENPL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1573.16	9.084766	2	882.447247	882.455930	R	L	449	456
PSM	RDHALLEEQSK	4749	sp|P57780|ACTN4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1721.13	13.1771	3	1324.664771	1324.673528	K	Q	634	645
PSM	VTTEDPAR	4750	sp|Q05920|PYC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1693.16	12.41268	2	887.427847	887.434861	R	S	378	386
PSM	FQEGAGKR	4751	sp|Q9DC50|OCTC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1578.14	9.223783	2	891.451647	891.456265	K	L	58	66
PSM	KYEEVAR	4752	tr|D3Z2H9|D3Z2H9_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1648.16	11.16173	2	893.453647	893.460681	R	K	125	132
PSM	DHHTADLCQEK	4753	sp|P21981|TGM2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	8-UNIMOD:4	ms_run[1]:scan=1.1.1662.18	11.55053	3	1352.575871	1352.577913	R	L	20	31
PSM	RVTSIADR	4754	tr|G3UXL2|G3UXL2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1692.12	12.38112	2	916.501047	916.509029	K	L	177	185
PSM	GRIPVNNR	4755	sp|O08749|DLDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1679.16	12.01817	2	924.519047	924.525347	K	F	335	343
PSM	ETHAFGRD	4756	sp|Q91V76|CK054_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1672.17	11.82487	2	931.407247	931.414794	K	-	308	316
PSM	LIVSQHSR	4757	sp|Q3UNX5|ACSM3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1707.18	12.80353	2	938.521247	938.529764	K	E	189	197
PSM	HLKPLQSK	4758	sp|Q9R0H0|ACOX1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1623.15	10.47552	2	949.566847	949.570901	K	L	653	661
PSM	ADHGEPIGR	4759	sp|P11499|HS90B_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14		ms_run[1]:scan=1.1.1656.13	11.38112	2	950.4586	950.4565	R	G	169	178
PSM	CEDNCIR	4760	sp|Q60759|GCDH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	1-UNIMOD:4,5-UNIMOD:4	ms_run[1]:scan=1.1.1685.19	12.18968	2	965.365647	965.369500	R	G	228	235
PSM	VLEQGQHR	4761	sp|Q78JT3|3HAO_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1578.16	9.225467	2	965.497247	965.504278	R	D	66	74
PSM	FGCQVAGKK	4762	sp|P97328|KHK_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	3-UNIMOD:4	ms_run[1]:scan=1.1.1681.17	12.07527	2	993.497447	993.506586	R	C	280	289
PSM	VEQHVVDGK	4763	sp|Q99LF4|RTCB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1645.18	11.07923	2	1009.509847	1009.519259	K	E	358	367
PSM	ATAASSSSLEK	4764	sp|P60710|ACTB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1000663, ProteinPilot, ]	14		ms_run[1]:scan=1.1.1705.19	12.74927	2	1050.5090470956602	1050.5193182024202	M	S	228	239
PSM	TDFQQGCAK	4765	sp|Q9DCM0|ETHE1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	7-UNIMOD:4	ms_run[1]:scan=1.1.1759.15	14.23158	2	1053.452447	1053.454944	R	T	164	173
PSM	EGQEDQGLTK	4766	sp|P17225|PTBP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1730.19	13.42835	2	1103.506847	1103.509482	R	D	416	426
PSM	HNGPENWHK	4767	sp|P00920|CAH2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1643.20	11.02518	2	1117.498647	1117.505340	K	D	10	19
PSM	VVQEQGTHPK	4768	sp|Q8VDD5|MYH9_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1576.19	9.171083	2	1121.577647	1121.582922	K	F	546	556
PSM	HSHPLTPAQR	4769	sp|Q8JZZ0|UD3A2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1623.21	10.48053	2	1142.589847	1142.594490	R	L	445	455
PSM	AVETTAQSDNK	4770	sp|P50516|VATA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1605.13	9.975483	2	1162.540047	1162.546596	R	I	554	565
PSM	HQATGELDDAK	4771	sp|Q8CC88|VWA8_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1676.20	11.93768	2	1183.538247	1183.546930	R	I	1673	1684
PSM	NPEAYSHSER	4772	sp|Q3TNA1|XYLB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1646.21	11.10975	2	1188.508047	1188.515964	K	I	198	208
PSM	AEMDAAVESCK	4773	sp|Q9EQ20|MMSA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	3-UNIMOD:35,10-UNIMOD:4	ms_run[1]:scan=1.1.1736.21	13.59753	2	1225.488847	1225.495489	K	R	77	88
PSM	PASPGADETQGTK	4774	sp|A2ARV4|LRP2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1685.21	12.19135	2	1257.579247	1257.583710	K	W	4575	4588
PSM	TVAHIQTVQHK	4775	sp|P51174|ACADL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1675.12	11.90332	3	1260.687371	1260.693869	K	L	323	334
PSM	LSVDYGKK	4776	sp|P05213|TBA1B_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1837.2	16.40913	3	908.487671	908.496733	R	S	157	165
PSM	SNVNDGVAQSTR	4777	sp|P17751|TPIS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1776.21	14.71338	2	1246.579047	1246.590192	K	I	245	257
PSM	DAQLIK	4778	sp|Q9DCM0|ETHE1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1933.4	19.08168	2	686.389847	686.396290	R	E	61	67
PSM	SAPSIPK	4779	sp|P14152|MDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1871.7	17.36487	2	698.390447	698.396290	K	E	143	150
PSM	SAPSIPK	4780	sp|P14152|MDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1877.4	17.52917	2	698.390447	698.396290	K	E	143	150
PSM	SQLETSLKR	4781	sp|Q8CG76|ARK72_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1844.3	16.60627	3	1060.577771	1060.587673	R	L	129	138
PSM	AVADAIR	4782	sp|P80315|TCPD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1865.4	17.19295	2	714.397647	714.402438	K	T	43	50
PSM	ADQLYK	4783	sp|P35486|ODPA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1781.6	14.84082	2	736.371647	736.375555	K	Q	78	84
PSM	FCEVAK	4784	sp|Q05920|PYC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	2-UNIMOD:4	ms_run[1]:scan=1.1.1785.8	14.95478	2	752.346247	752.352711	K	E	662	668
PSM	YLMAEK	4785	sp|P16125|LDHB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1934.9	19.11388	2	753.367047	753.373112	R	L	173	179
PSM	GMVQAVR	4786	sp|Q8R0Y6|AL1L1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1863.8	17.1393	2	759.405447	759.406143	K	L	175	182
PSM	AGIIASAR	4787	sp|P58252|EF2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1909.7	18.417	2	757.438247	757.444637	K	A	43	51
PSM	MAEAIAR	4788	sp|Q9DCC4|P5CR3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1840.5	16.49523	2	760.383447	760.390159	R	G	19	26
PSM	LATDLTK	4789	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1947.6	19.46922	2	760.427047	760.433070	K	V	258	265
PSM	ACDEGHIIPK	4790	sp|Q9JHI5|IVD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	2-UNIMOD:4	ms_run[1]:scan=1.1.1902.8	18.22702	3	1138.539371	1138.544094	K	D	347	357
PSM	VLVAQHDAYK	4791	sp|Q99LC5|ETFA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1855.11	16.91855	3	1142.602271	1142.608408	K	G	76	86
PSM	ANYLQR	4792	sp|O35488|S27A2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1874.10	17.45127	2	763.391647	763.397687	R	K	384	390
PSM	CDVDIR	4793	sp|P60710|ACTB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	1-UNIMOD:4	ms_run[1]:scan=1.1.1900.9	18.17367	2	776.343247	776.348688	K	K	285	291
PSM	EALAVER	4794	sp|Q8CGK3|LONM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1920.11	18.72295	2	786.417447	786.423568	R	-	943	950
PSM	MIYASSK	4795	sp|P18760|COF1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1813.9	15.7393	2	798.387647	798.394576	K	D	115	122
PSM	FCYADK	4796	sp|Q8CHT0|AL4A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	2-UNIMOD:4	ms_run[1]:scan=1.1.1898.14	18.12275	2	802.327647	802.331976	K	A	93	99
PSM	FCYADK	4797	sp|Q8CHT0|AL4A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	2-UNIMOD:4	ms_run[1]:scan=1.1.1892.12	17.95175	2	802.327647	802.331976	K	A	93	99
PSM	ITITNDK	4798	sp|P16627|HS71L_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1829.11	16.19295	2	803.433047	803.438883	K	G	503	510
PSM	TFIDQGK	4799	sp|Q9WTP7|KAD3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1961.10	19.86807	2	807.412447	807.412669	K	L	58	65
PSM	VGQAVALR	4800	sp|O88712|CTBP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1965.15	19.98393	2	812.485247	812.486837	R	A	185	193
PSM	YIAQAYDKPR	4801	sp|Q9CQN1|TRAP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1905.9	18.30955	3	1223.628971	1223.629872	R	F	319	329
PSM	EFQATAR	4802	sp|P45952|ACADM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1776.9	14.70337	2	821.396847	821.403166	K	K	47	54
PSM	YADVVTTTTHK	4803	sp|Q9CZN7|GLYM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1895.7	18.03227	3	1234.613171	1234.619367	K	T	270	281
PSM	LIHGGNEETLR	4804	sp|P52825|CPT2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1874.12	17.45293	3	1237.634771	1237.641499	K	K	306	317
PSM	TASSVLLHTGQK	4805	sp|Q9JII6|AK1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14		ms_run[1]:scan=1.1.1940.13	19.2834	3	1240.6708	1240.6770	M	M	2	14
PSM	DAEELEK	4806	sp|P16546|SPTN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1780.10	14.81615	2	832.377247	832.381428	R	W	52	59
PSM	ANFTVQR	4807	sp|Q9DCY0|KEG1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1951.12	19.58638	2	834.429247	834.434801	K	M	267	274
PSM	LVMAAANR	4808	sp|Q99JY0|ECHB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1936.11	19.17195	2	844.454647	844.458907	R	L	438	446
PSM	EANYIDK	4809	sp|P47199|QOR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1818.12	15.88245	2	851.396847	851.402498	K	I	202	209
PSM	RALANSLACQGK	4810	tr|A6ZI46|A6ZI46_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	9-UNIMOD:4	ms_run[1]:scan=1.1.1837.10	16.41582	3	1287.660671	1287.671754	K	Y	386	398
PSM	LNSDFDR	4811	sp|P06801|MAOX_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1955.12	19.6996	2	865.387047	865.392996	R	Y	65	72
PSM	GAVGGTFDR	4812	sp|Q9DBL7|COASY_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1951.15	19.58888	2	878.423847	878.424630	R	L	193	202
PSM	TQNVLGEK	4813	sp|P62908|RS3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1822.14	15.99763	2	887.464447	887.471246	R	G	55	63
PSM	EDFEEAR	4814	sp|P16460|ASSY_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1912.13	18.50422	2	894.365647	894.371926	K	K	42	49
PSM	TVEAEAAHGTVTR	4815	sp|O88844|IDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1814.12	15.7698	3	1340.662271	1340.668442	K	H	302	315
PSM	QLTYIHK	4816	sp|Q9DC50|OCTC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1839.17	16.47727	2	901.493647	901.502152	R	K	220	227
PSM	LSGQDVER	4817	tr|E9Q7L0|E9Q7L0_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1785.12	14.95813	2	902.439247	902.445760	R	G	679	687
PSM	LHGRPGCCYETAMTR	4818	sp|Q9DC50|OCTC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	7-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.1931.16	19.03587	4	1807.783694	1807.791628	R	Y	431	446
PSM	SFQPDTGR	4819	sp|Q05920|PYC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1855.16	16.92273	2	906.413647	906.419545	R	I	386	394
PSM	VGEFSGANK	4820	sp|P10639|THIO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1816.14	15.82752	2	907.433847	907.439946	K	E	86	95
PSM	LNVKPLAR	4821	sp|Q8QZT1|THIL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1945.10	19.41713	2	909.570247	909.575986	R	I	301	309
PSM	SCTVEAVR	4822	sp|Q9DC50|OCTC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	2-UNIMOD:4	ms_run[1]:scan=1.1.1798.16	15.32245	2	920.431047	920.438566	R	W	457	465
PSM	AINVQEEK	4823	sp|P16546|SPTN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1801.15	15.40628	2	929.475047	929.481811	K	I	1493	1501
PSM	CIVVEEGK	4824	sp|Q9R0P5|DEST_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	1-UNIMOD:4	ms_run[1]:scan=1.1.1960.15	19.84407	2	932.461447	932.463718	K	E	46	54
PSM	EAHEVILK	4825	sp|Q64471|GSTT1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1834.14	16.33538	2	937.516247	937.523282	R	V	209	217
PSM	GHQQLYWSHPR	4826	sp|P62274|RS29_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14		ms_run[1]:scan=1.1.1930.15	19.00695	3	1407.6776	1407.6791	M	K	2	13
PSM	YKPESDELTAEK	4827	sp|P09103|PDIA1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1960.16	19.8449	3	1408.666571	1408.672190	K	I	329	341
PSM	LAPETCVR	4828	sp|Q9DBM2|ECHP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	6-UNIMOD:4	ms_run[1]:scan=1.1.1932.14	19.06215	2	944.470247	944.474952	R	S	226	234
PSM	IQTTAPPVK	4829	sp|P37040|NCPR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1948.13	19.50297	2	953.549847	953.554582	K	E	57	66
PSM	YYGAQTVR	4830	sp|P97807|FUMH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1929.12	18.97623	2	956.467447	956.471580	K	S	64	72
PSM	VLENAEGAR	4831	sp|P38647|GRP75_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1783.15	14.90417	2	957.481047	957.487959	K	T	77	86
PSM	AQCPIVER	4832	sp|P97461|RS5_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	3-UNIMOD:4	ms_run[1]:scan=1.1.1911.16	18.47932	2	971.482247	971.485851	K	L	64	72
PSM	HQPTAIIAK	4833	sp|P40142|TKT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1784.16	14.93323	2	977.561047	977.565815	K	T	233	242
PSM	HEQNIDCGGGYVK	4834	sp|P14211|CALR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	7-UNIMOD:4	ms_run[1]:scan=1.1.1915.15	18.58795	3	1475.645171	1475.646327	K	L	99	112
PSM	DYSVTANSK	4835	sp|P16125|LDHB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1889.16	17.87145	2	983.452047	983.455990	K	I	83	92
PSM	EGDPDQLSK	4836	sp|P97816|S100G_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1788.18	15.04702	2	987.444647	987.450905	K	E	21	30
PSM	KLELSENR	4837	sp|O35381|AN32A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1796.19	15.26868	2	987.528247	987.534909	K	I	68	76
PSM	HIDCAQVYQNEK	4838	sp|P45376|ALDR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	4-UNIMOD:4	ms_run[1]:scan=1.1.1939.17	19.25962	3	1503.677771	1503.677627	R	E	42	54
PSM	NVRPDYLK	4839	sp|P09671|SODM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1900.4	18.16948	3	1003.537871	1003.545080	K	A	195	203
PSM	HISTDEALK	4840	sp|Q9DBM2|ECHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1793.19	15.18525	2	1012.514247	1012.518925	R	L	155	164
PSM	TNCDLYEK	4841	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	3-UNIMOD:4	ms_run[1]:scan=1.1.1884.21	17.73628	2	1041.442447	1041.443711	K	L	414	422
PSM	TNCDLYEK	4842	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	3-UNIMOD:4	ms_run[1]:scan=1.1.1871.18	17.37403	2	1041.442447	1041.443711	K	L	414	422
PSM	TPGPGAQSALR	4843	sp|P62264|RS14_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1960.20	19.84825	2	1053.552447	1053.556707	K	A	107	118
PSM	DYCVTANSK	4844	sp|P06151|LDHA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	3-UNIMOD:4	ms_run[1]:scan=1.1.1919.21	18.70335	2	1056.450447	1056.454610	K	L	82	91
PSM	FQGTQPEPR	4845	sp|Q99J99|THTM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1840.20	16.50775	2	1058.509447	1058.514508	R	D	189	198
PSM	YPEGSPEER	4846	sp|P21981|TGM2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1834.18	16.33873	2	1062.456247	1062.461804	K	E	445	454
PSM	HGTCAAQVDALNSEK	4847	sp|C0HKG5|RNT2A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	4-UNIMOD:4	ms_run[1]:scan=1.1.1955.19	19.70543	3	1599.728171	1599.731119	K	K	122	137
PSM	VNIKPQVDR	4848	sp|P50247|SAHH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1881.6	17.64083	3	1067.603471	1067.608743	K	Y	319	328
PSM	AHIAQLCEK	4849	sp|Q68FD5|CLH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	7-UNIMOD:4	ms_run[1]:scan=1.1.1802.18	15.4369	2	1068.531447	1068.538614	R	A	611	620
PSM	NECFLQHK	4850	sp|P07724|ALBU_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	3-UNIMOD:4	ms_run[1]:scan=1.1.1851.17	16.8132	2	1074.483447	1074.491664	R	D	123	131
PSM	YHLGMYHR	4851	sp|Q60597|ODO1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1942.3	19.32935	3	1075.499471	1075.502169	K	R	349	357
PSM	TTTGSYIANR	4852	sp|Q60692|PSB6_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1909.16	18.4245	2	1082.531847	1082.535637	R	V	53	63
PSM	RQIIVEEAK	4853	sp|P45591|COF2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1837.20	16.42415	2	1084.617047	1084.624058	K	Q	45	54
PSM	DTDSEEEIR	4854	sp|P0DP26|CALM1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1883.15	17.70363	2	1092.453247	1092.457112	K	E	79	88
PSM	GRFEDVSER	4855	sp|P51855|GSHB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1832.20	16.28437	2	1093.509047	1093.515236	R	G	237	246
PSM	TQLAVCQQR	4856	sp|P30416|FKBP4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	6-UNIMOD:4	ms_run[1]:scan=1.1.1932.19	19.06633	2	1102.551847	1102.555327	K	T	391	400
PSM	LHPNDEDIHTANER	4857	sp|Q91YI0|ARLY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1818.18	15.88745	3	1659.757571	1659.760111	K	R	81	95
PSM	STTTGHLIYK	4858	sp|P10126|EF1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1869.20	17.31962	2	1119.588647	1119.592424	K	C	21	31
PSM	LIENTDAACK	4859	sp|Q9DCM2|GSTK1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	9-UNIMOD:4	ms_run[1]:scan=1.1.1885.19	17.76238	2	1133.535647	1133.538674	K	Y	168	178
PSM	ASGGWAAASDSR	4860	sp|Q60928|GGT1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1965.20	19.98812	2	1134.503047	1134.505400	R	K	549	561
PSM	TPEEYPESAK	4861	sp|Q9CWS0|DDAH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1881.21	17.65335	2	1149.515247	1149.518984	R	V	238	248
PSM	RIPGNNNFVK	4862	sp|Q64516|GLPK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1937.20	19.20767	2	1157.629247	1157.630541	K	S	129	139
PSM	HQGVMVGMGQK	4863	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1889.20	17.87478	2	1170.561647	1170.563783	R	D	40	51
PSM	VTQVDGNSPVR	4864	sp|Q5XJY5|COPD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1923.21	18.81482	2	1170.593447	1170.599300	K	F	486	497
PSM	KEEEVSNLVK	4865	sp|Q99MZ7|PECR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1948.21	19.50965	2	1173.620647	1173.624118	R	S	83	93
PSM	EDKYEEEIK	4866	tr|D3Z2H9|D3Z2H9_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1905.17	18.31623	2	1181.543847	1181.545199	K	I	182	191
PSM	GVSQAVEHINK	4867	sp|P17182|ENOA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1895.20	18.04312	2	1180.616847	1180.620036	K	T	61	72
PSM	DSYVGDEAQSK	4868	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1916.19	18.61865	2	1197.513247	1197.514961	K	R	51	62
PSM	GRNDLMEYAK	4869	sp|P16460|ASSY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	6-UNIMOD:35	ms_run[1]:scan=1.1.1880.6	17.61317	3	1211.556071	1211.560472	K	Q	156	166
PSM	EKIEDNGNFR	4870	sp|A2BIM8|MUP18_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1853.20	16.87082	2	1220.574047	1220.578565	R	L	49	59
PSM	KLGGPQEEQIK	4871	sp|Q93092|TALDO_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1820.21	15.9467	2	1225.661647	1225.666652	K	N	71	82
PSM	KGEHLSDAFAR	4872	sp|Q64471|GSTT1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1910.9	18.44602	3	1229.609471	1229.615285	R	V	37	48
PSM	VLVQNAAGSQEK	4873	sp|P26039|TLN1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1877.21	17.54335	2	1242.653847	1242.656815	K	L	2032	2044
PSM	SENEPIENEAAR	4874	sp|Q9Z2I8|SUCB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1956.21	19.7355	2	1357.601847	1357.610987	K	Y	281	293
PSM	YMCENQATISSK	4875	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	2-UNIMOD:35,3-UNIMOD:4	ms_run[1]:scan=1.1.1898.21	18.1286	2	1446.614447	1446.611916	K	L	287	299
PSM	FCSDRPSEVPEK	4876	sp|P11930|NUD19_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	2-UNIMOD:4	ms_run[1]:scan=1.1.1938.16	19.23158	3	1449.653171	1449.655829	R	W	258	270
PSM	IRDESASCSWNK	4877	sp|Q3TNA1|XYLB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	8-UNIMOD:4	ms_run[1]:scan=1.1.1874.16	17.45628	3	1451.655971	1451.646327	K	F	361	373
PSM	TYAVSHTQEDLNR	4878	sp|Q6ZQM8|UD17C_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1965.18	19.98645	3	1532.722571	1532.721935	K	E	76	89
PSM	LVEDLK	4879	sp|P26443|DHE3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1995.4	20.80335	2	715.408047	715.411606	K	T	85	91
PSM	NVNVFK	4880	sp|P16125|LDHB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2010.2	21.22708	2	719.390647	719.396625	R	F	114	120
PSM	NVNVFK	4881	sp|P16125|LDHB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2017.5	21.4223	2	719.390647	719.396625	R	F	114	120
PSM	VILHLK	4882	sp|P07901|HS90A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1987.4	20.58105	2	721.478447	721.485046	K	E	186	192
PSM	TNRPPLSLSR	4883	sp|P35980|RL18_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2036.2	21.94312	3	1139.634371	1139.641105	R	M	56	66
PSM	DPGVLDR	4884	sp|P50543|S10AB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2033.10	21.86792	2	770.385247	770.392267	K	M	51	58
PSM	LAPEFAK	4885	sp|O08709|PRDX6_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2105.5	23.8438	2	774.419847	774.427590	K	R	57	64
PSM	VFEHSSVELK	4886	sp|Q9R0P3|ESTD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2106.6	23.8721	3	1173.594671	1173.602989	K	C	18	28
PSM	GTQLLPR	4887	sp|Q9DBM2|ECHP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2113.5	24.06363	2	783.452647	783.460287	R	V	133	140
PSM	AVENELLDRK	4888	sp|P51855|GSHB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2131.4	24.563	3	1185.626171	1185.635351	R	I	222	232
PSM	YQQLIK	4889	sp|Q9EQ20|MMSA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2023.12	21.59177	2	791.448047	791.454139	R	E	108	114
PSM	LGLHSLR	4890	sp|P61205|ARF3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2004.10	21.06303	2	794.469847	794.476272	K	H	143	150
PSM	GRNDLMEYAK	4891	sp|P16460|ASSY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2149.6	25.07523	3	1195.560671	1195.565557	K	Q	156	166
PSM	NELFQR	4892	sp|Q61425|HCDH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2109.8	23.9559	2	805.401447	805.408252	K	L	128	134
PSM	YNQILR	4893	sp|P17182|ENOA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2020.7	21.50552	2	805.438847	805.444637	K	I	407	413
PSM	LASYLDK	4894	sp|P05784|K1C18_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2078.5	23.0996	2	808.426047	808.433070	R	V	83	90
PSM	GANQWIK	4895	sp|P35486|ODPA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2084.13	23.27042	2	815.421247	815.428987	R	F	379	386
PSM	VLLGETGK	4896	sp|P62281|RS11_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2015.8	21.3703	2	815.468047	815.475269	R	E	23	31
PSM	ILIENPK	4897	sp|Q60866|PTER_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2126.5	24.42693	2	825.488047	825.496004	K	Q	337	344
PSM	ASALACLK	4898	sp|Q8BMF4|ODP2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	6-UNIMOD:4	ms_run[1]:scan=1.1.2112.4	24.03505	2	832.442447	832.447674	K	V	478	486
PSM	AVSYLGPK	4899	sp|O08997|ATOX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2110.6	23.98162	2	833.456847	833.464704	K	-	61	69
PSM	VLCMDAK	4900	sp|Q9Z2I9|SUCB1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	3-UNIMOD:4	ms_run[1]:scan=1.1.1977.8	20.30947	2	835.389647	835.393196	K	I	268	275
PSM	AGIATHFVDSEK	4901	sp|Q8QZS1|HIBCH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2155.5	25.24557	3	1273.628471	1273.630266	R	L	209	221
PSM	VSNLPTVK	4902	sp|P30115|GSTA3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2060.9	22.60455	2	856.495047	856.501818	R	K	188	196
PSM	IDIVENR	4903	sp|P16460|ASSY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2137.9	24.73725	2	857.454247	857.460681	R	F	266	273
PSM	ITPFEEK	4904	sp|P08249|MDHM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2143.11	24.90982	2	862.438247	862.443634	K	M	308	315
PSM	VNTEFMK	4905	sp|O89023|TPP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2120.8	24.26367	2	867.411047	867.416039	R	A	339	346
PSM	IPAGLENR	4906	sp|O35215|DOPD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2025.11	21.64637	2	868.470047	868.476666	R	L	15	23
PSM	EEIHNNVEVVHTYR	4907	sp|Q62433|NDRG1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2070.10	22.88315	4	1737.837694	1737.843447	K	Q	199	213
PSM	FGDDPVTK	4908	sp|Q9QXG4|ACSA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1986.12	20.55985	2	877.413647	877.418148	K	H	419	427
PSM	ELLSGPNR	4909	sp|Q9D0F9|PGM1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2046.7	22.22307	2	884.465247	884.471580	K	L	210	218
PSM	VINSVDIK	4910	sp|O88342|WDR1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2129.9	24.51198	2	886.504047	886.512383	K	Q	148	156
PSM	NDITGELK	4911	sp|Q64669|NQO1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2139.11	24.79607	2	888.449647	888.455262	R	D	54	62
PSM	GFQVAPDR	4912	sp|P28271|ACOC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2102.12	23.7664	2	888.438847	888.445366	K	H	401	409
PSM	TFEGVDPK	4913	sp|Q61598|GDIB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2058.12	22.55188	2	891.429047	891.433798	R	K	157	165
PSM	GVFDVDKK	4914	sp|Q9D0K2|SCOT1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2003.9	21.0339	2	906.473247	906.481082	K	N	474	482
PSM	SPFDPDNK	4915	sp|Q99LB7|SARDH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2010.13	21.23627	2	918.402247	918.408311	K	R	906	914
PSM	SDPVVSYR	4916	sp|P58252|EF2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2067.17	22.80625	2	921.449047	921.455596	K	E	573	581
PSM	LLTYNAAR	4917	sp|Q9DBL1|ACDSB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2148.11	25.05097	2	920.501647	920.507966	R	L	348	356
PSM	VEGPEEIR	4918	sp|Q8R4N0|CLYBL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2005.15	21.0956	2	927.460447	927.466161	K	W	136	144
PSM	KVSLELGGK	4919	sp|Q8K009|AL1L2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1988.14	20.61732	2	929.549247	929.554582	K	S	690	699
PSM	TESEGHCPTHIAVLCR	4920	sp|Q9DC50|OCTC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	7-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=1.1.2109.15	23.96173	4	1865.842894	1865.851252	K	G	182	198
PSM	EVVQNFAK	4921	sp|Q9CQI6|COTL1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2063.13	22.69108	2	933.486647	933.491982	K	E	103	111
PSM	TIDDLEDK	4922	tr|D3Z2H9|D3Z2H9_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2062.14	22.66418	2	947.440047	947.444757	K	L	216	224
PSM	IAFSCPQK	4923	sp|Q9CPV4|GLOD4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	5-UNIMOD:4	ms_run[1]:scan=1.1.2126.11	24.43195	2	949.463447	949.469138	R	E	202	210
PSM	GGPLSDSYR	4924	sp|P00920|CAH2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2066.14	22.77583	2	950.439247	950.445760	K	L	81	90
PSM	GQIGAPMPGK	4925	sp|Q05920|PYC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2087.14	23.3556	2	954.492847	954.495687	K	V	1110	1120
PSM	VYELQASR	4926	sp|Q8QZY1|EIF3L_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2082.9	23.21205	2	964.492447	964.497795	K	V	71	79
PSM	EWRPQDAEPCAHPNSR	4927	sp|Q9Z2V4|PCKGC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	10-UNIMOD:4	ms_run[1]:scan=1.1.2085.16	23.30087	4	1948.861694	1948.859842	K	F	390	406
PSM	LEALDANSR	4928	sp|O08585|CLCA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2040.13	22.06197	2	987.488647	987.498523	R	K	120	129
PSM	LEALDANSR	4929	sp|O08585|CLCA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2047.15	22.25717	2	987.488647	987.498523	R	K	120	129
PSM	SLPCDICK	4930	sp|Q61207|SAP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	4-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=1.1.2159.15	25.36672	2	991.443447	991.446688	K	T	60	68
PSM	QGTTLVMNK	4931	sp|P51855|GSHB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1982.17	20.45302	2	990.510847	990.516816	R	H	435	444
PSM	LSVSQVVHK	4932	sp|P07759|SPA3K_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2076.16	23.05355	2	995.574047	995.576380	K	A	352	361
PSM	LSVSQVVHK	4933	sp|P07759|SPA3K_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2075.2	23.01403	3	995.566571	995.576380	K	A	352	361
PSM	TGVHHYSGNNIELGTACGK	4934	sp|P62889|RL30_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	17-UNIMOD:4	ms_run[1]:scan=1.1.2013.15	21.3212	4	2013.933694	2013.932673	K	Y	69	88
PSM	YTCSFCGK	4935	sp|P61514|RL37A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	3-UNIMOD:4,6-UNIMOD:4	ms_run[1]:scan=1.1.1981.16	20.42475	2	1021.400047	1021.399738	K	T	37	45
PSM	LTEIINTQHENVK	4936	sp|P13707|GPDA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2158.17	25.34047	3	1537.808471	1537.810021	K	Y	50	63
PSM	AREQAEAEVASLNR	4937	tr|D3Z6I8|D3Z6I8_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2093.14	23.5224	3	1542.765971	1542.775033	R	R	41	55
PSM	QQNFNTGIK	4938	sp|P16546|SPTN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2001.19	20.98552	2	1048.524047	1048.530158	K	D	1660	1669
PSM	LKNELFQR	4939	sp|Q61425|HCDH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2085.5	23.29168	3	1046.580671	1046.587279	K	L	126	134
PSM	NNFEGEITK	4940	sp|P09103|PDIA1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2131.18	24.57468	2	1050.492247	1050.498189	R	E	216	225
PSM	KFSGVYLEK	4941	sp|P40936|INMT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1000663, ProteinPilot, ]	14		ms_run[1]:scan=1.1.2129.13	24.51532	2	1069.5752470956602	1069.58079626017	K	E	211	220
PSM	KFSGVYLEK	4942	sp|P40936|INMT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1000663, ProteinPilot, ]	14		ms_run[1]:scan=1.1.2122.17	24.32803	2	1069.5752470956602	1069.58079626017	K	E	211	220
PSM	YYCFQGNK	4943	sp|Q91X72|HEMO_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	3-UNIMOD:4	ms_run[1]:scan=1.1.2125.13	24.40642	2	1078.447447	1078.454216	R	F	197	205
PSM	DANNMPVTAR	4944	tr|D3Z0Y2|D3Z0Y2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2028.18	21.73567	2	1087.505447	1087.508042	K	V	99	109
PSM	IANPVEGSSGR	4945	sp|P60335|PCBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1966.21	20.0169	2	1085.540647	1085.546536	K	Q	315	326
PSM	LSPDIVAEHK	4946	sp|Q64669|NQO1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2100.3	23.70358	3	1107.583571	1107.592424	R	K	81	91
PSM	GGTESDLTVSR	4947	sp|Q99LB7|SARDH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1996.20	20.84495	2	1120.531047	1120.536031	R	L	616	627
PSM	IYHPNIDEK	4948	sp|P68037|UB2L3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1982.9	20.44633	3	1127.552771	1127.561124	K	G	74	83
PSM	HGINCFINR	4949	sp|P80314|TCPB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	5-UNIMOD:4	ms_run[1]:scan=1.1.2144.16	24.94225	2	1129.541647	1129.545097	K	Q	285	294
PSM	YDDMATCMK	4950	sp|P68254|1433T_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	7-UNIMOD:4	ms_run[1]:scan=1.1.2148.19	25.05763	2	1133.412247	1133.419153	R	A	19	28
PSM	VCSQYAAYGK	4951	sp|P21614|VTDB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	2-UNIMOD:4	ms_run[1]:scan=1.1.1990.19	20.67673	2	1145.516247	1145.517545	R	E	219	229
PSM	VLIAAHGNSLR	4952	sp|O70250|PGAM2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2036.3	21.94395	3	1149.653771	1149.661841	R	G	181	192
PSM	ALQATVGNSYK	4953	sp|P11438|LAMP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2081.18	23.19227	2	1150.591247	1150.598238	K	C	316	327
PSM	KVESLEEVAR	4954	sp|P18894|OXDA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2026.18	21.68005	2	1158.616647	1158.624452	R	G	162	172
PSM	IVSPSGAAVPCK	4955	sp|Q8BTM8|FLNA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	11-UNIMOD:4	ms_run[1]:scan=1.1.2157.16	25.3116	2	1184.620247	1184.622344	K	V	1008	1020
PSM	DQNTVETLQR	4956	sp|Q62261|SPTB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2123.21	24.35862	2	1202.585447	1202.589129	R	M	1835	1845
PSM	SISKEEILER	4957	sp|Q9DBM2|ECHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2103.19	23.80007	2	1202.646047	1202.650667	R	C	608	618
PSM	NQDNLQGWNK	4958	sp|Q9DBP5|KCY_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2160.21	25.39963	2	1215.562247	1215.563249	R	T	97	107
PSM	PALPEGTEDTAK	4959	sp|P13020|GELS_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2073.20	22.97377	2	1227.598047	1227.598297	K	E	276	288
PSM	NNTQVLINCR	4960	sp|P62317|SMD2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	9-UNIMOD:4	ms_run[1]:scan=1.1.2159.20	25.37088	2	1230.614247	1230.613905	K	N	38	48
PSM	DGEEAGAYDGPR	4961	sp|P27773|PDIA3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2070.20	22.8915	2	1235.504647	1235.505459	R	T	108	120
PSM	IAPYVAHNFNK	4962	sp|Q05920|PYC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2135.9	24.68013	3	1272.654971	1272.661507	K	L	590	601
PSM	MDSTEPPYSQK	4963	sp|P10126|EF1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2003.20	21.04308	2	1281.552047	1281.554718	K	R	155	166
PSM	EVQGNESETFR	4964	sp|Q62468|VILI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1982.21	20.45635	2	1294.577647	1294.578959	R	S	98	109
PSM	AQEIDQTNDFK	4965	sp|Q9JHI5|IVD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2150.20	25.11542	2	1307.598447	1307.599360	K	N	66	77
PSM	LCTSATESEVTR	4966	sp|Q9CZ13|QCR1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	2-UNIMOD:4	ms_run[1]:scan=1.1.2039.21	22.04125	2	1352.630047	1352.624195	R	G	379	391
PSM	GVTHNIPLLR	4967	sp|Q91ZA3|PCCA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2370.5	31.18437	3	1118.648171	1118.656027	R	E	473	483
PSM	YLDIPK	4968	sp|O88990|ACTN3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2362.2	30.9662	2	747.413847	747.416691	K	M	228	234
PSM	SCLLLR	4969	sp|P62821|RAB1A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	2-UNIMOD:4	ms_run[1]:scan=1.1.2293.4	29.06228	2	760.419847	760.426545	K	F	25	31
PSM	LTIQGLK	4970	sp|Q99KI0|ACON_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2357.3	30.8336	2	771.479247	771.485440	K	D	724	731
PSM	LRPVAGLLSSR	4971	sp|P16331|PH4H_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2366.2	31.07297	3	1167.703871	1167.708791	R	D	242	253
PSM	HYFIEVNSR	4972	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2272.3	28.48567	3	1163.564171	1163.572357	K	L	320	329
PSM	YDLLEK	4973	sp|Q99KI0|ACON_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2312.3	29.58982	2	779.400047	779.406521	R	N	45	51
PSM	LILDSAR	4974	sp|P40142|TKT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2216.6	26.95092	2	786.453447	786.459953	K	A	544	551
PSM	VALYVAR	4975	sp|Q9D2R0|AACS_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2245.5	27.74275	2	790.462647	790.470124	R	E	114	121
PSM	QHGIPIPVTPK	4976	sp|P16460|ASSY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2322.4	29.86885	3	1185.681071	1185.686993	K	S	166	177
PSM	LPITLNK	4977	sp|P17427|AP2A2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2360.3	30.91417	2	797.493647	797.501090	K	F	818	825
PSM	LAPALSVK	4978	sp|Q93092|TALDO_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2223.5	27.1436	2	797.494647	797.501090	K	A	270	278
PSM	VQVSVFK	4979	sp|P16460|ASSY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2319.5	29.7853	2	805.464847	805.469790	K	G	349	356
PSM	ALTDSFR	4980	sp|Q6P069|SORCN_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2251.6	27.911	2	808.401447	808.407918	R	R	168	175
PSM	GVFNSGLK	4981	sp|Q9Z2I8|SUCB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2201.8	26.54698	2	820.439247	820.444303	K	G	95	103
PSM	ALAPQLAR	4982	sp|Q64105|SPRE_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2162.6	25.44332	2	838.496847	838.502487	R	L	23	31
PSM	VHIISFK	4983	sp|Q9D964|GATM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2213.5	26.86885	2	842.494447	842.501424	R	D	291	298
PSM	TVSAMQHVLQR	4984	sp|Q8K183|PDXK_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2172.9	25.7303	3	1268.661971	1268.665940	K	T	259	270
PSM	TEWLDGK	4985	sp|P17742|PPIA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2248.4	27.82505	2	847.405047	847.407583	K	H	119	126
PSM	PSPAFDVK	4986	sp|Q3UNX5|ACSM3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2162.9	25.44582	2	859.439447	859.443969	K	I	395	403
PSM	NVLELTGK	4987	sp|Q9D172|GAL3A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2351.7	30.67072	2	872.488447	872.496733	K	-	259	267
PSM	AMLSANIR	4988	sp|Q68FD5|CLH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2232.3	27.3889	2	874.463247	874.469472	R	Q	669	677
PSM	VGASFLQR	4989	sp|P05202|AATM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2321.11	29.8465	2	876.475047	876.481751	R	F	140	148
PSM	TALDTFGR	4990	sp|P51660|DHB4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2329.7	30.06768	2	879.438647	879.445031	K	I	85	93
PSM	ILVPEGTR	4991	sp|Q8BMF4|ODP2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2188.9	26.18048	2	883.505847	883.512717	K	D	147	155
PSM	VVYPGLPSHPQHELAK	4992	sp|Q8VCN5|CGL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2285.5	28.85762	4	1770.934894	1770.941704	K	R	288	304
PSM	SLAAEWGR	4993	sp|Q9CQ62|DECR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2352.7	30.6984	2	888.440247	888.445366	K	Y	223	231
PSM	SLVTLDGGK	4994	sp|P11404|FABPH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2268.8	28.37973	2	888.485047	888.491647	K	L	83	92
PSM	ADEGISFR	4995	sp|P35700|PRDX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2271.5	28.45982	2	893.418847	893.424296	K	G	121	129
PSM	QGYVIYR	4996	sp|Q9CZM2|RL15_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2249.9	27.85723	2	897.462647	897.470852	K	I	57	64
PSM	LITLEQGK	4997	sp|Q9EQ20|MMSA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2214.5	26.89585	2	900.522447	900.528033	R	T	122	130
PSM	NAFGAPLTK	4998	sp|Q07417|ACADS_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2279.9	28.68538	2	917.492247	917.497067	R	L	298	307
PSM	VMEYINR	4999	sp|Q68FD5|CLH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2176.8	25.84385	2	923.446847	923.453488	R	L	1040	1047
PSM	FKVETFR	5000	sp|P70296|PEBP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2173.2	25.75303	3	925.494671	925.502152	K	K	149	156
PSM	VAIEPGVPR	5001	sp|Q64442|DHSO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2296.6	29.14608	2	936.533847	936.539266	R	E	92	101
PSM	VVFDSVQR	5002	sp|Q8R146|APEH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2235.5	27.47458	2	948.499047	948.502881	R	S	376	384
PSM	LSDIGEGIR	5003	sp|P53395|ODB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2270.11	28.4374	2	958.503047	958.508360	K	E	69	78
PSM	GLTSVINQK	5004	sp|P16125|LDHB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2218.11	27.00955	2	958.541447	958.544745	R	L	300	309
PSM	DVNVNFEK	5005	sp|Q9R0Q7|TEBP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2329.18	30.07685	2	963.461247	963.466161	K	S	26	34
PSM	MLAEDELR	5006	sp|P61205|ARF3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2325.12	29.95958	2	975.469047	975.469532	R	D	110	118
PSM	IMEYYEK	5007	sp|P50518|VATE1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2178.16	25.90753	2	974.439847	974.441920	K	K	53	60
PSM	ETTVVWDK	5008	sp|Q64516|GLPK_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2272.9	28.49067	2	976.482047	976.486562	R	V	95	103
PSM	EINLQDYEGHQK	5009	sp|E9PV24|FIBA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2299.8	29.23152	3	1472.685371	1472.689572	R	Q	192	204
PSM	LAQIHFPR	5010	sp|P07758|A1AT1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2349.9	30.61722	2	980.545847	980.555585	R	L	301	309
PSM	AAWEVDSGR	5011	sp|P45952|ACADM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2197.12	26.43742	2	989.452847	989.456659	R	R	340	349
PSM	VDGALCLDK	5012	sp|Q91X72|HEMO_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	6-UNIMOD:4	ms_run[1]:scan=1.1.2270.12	28.43823	2	989.478647	989.485182	K	S	401	410
PSM	QNVFACVR	5013	sp|Q922D8|C1TC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	6-UNIMOD:4	ms_run[1]:scan=1.1.2300.7	29.25902	2	992.481847	992.486185	R	Q	403	411
PSM	AVILGPPGSGK	5014	sp|Q9WUR9|KAD4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2305.8	29.40178	2	994.574847	994.581131	R	G	8	19
PSM	EPDLSSDIK	5015	sp|A2BIM8|MUP18_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2251.15	27.91852	2	1002.486047	1002.486956	R	E	142	151
PSM	ASANMDLMR	5016	sp|Q9CPY7|AMPL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2264.12	28.272	2	1007.448447	1007.452836	K	A	295	304
PSM	GGNFGFGDSR	5017	sp|O88569|ROA2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2288.13	28.93507	2	1012.428447	1012.436258	R	G	204	214
PSM	LVLVGDGGTGK	5018	sp|P62827|RAN_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2316.9	29.70495	2	1014.566647	1014.570960	K	T	13	24
PSM	ALDEYYDK	5019	sp|P50516|VATA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2211.10	26.8234	2	1015.443647	1015.449842	R	H	460	468
PSM	QRDYETATLSDIK	5020	sp|P57780|ACTN4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2322.10	29.87385	3	1538.757671	1538.757651	K	A	439	452
PSM	TAVCDIPPR	5021	sp|P68372|TBB4B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	4-UNIMOD:4	ms_run[1]:scan=1.1.2201.12	26.55033	2	1027.507447	1027.512065	K	G	351	360
PSM	LQELESYR	5022	sp|Q8JZV9|BDH2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2241.14	27.64087	2	1036.512447	1036.518925	K	G	43	51
PSM	LGPGVSDICK	5023	sp|Q61207|SAP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	9-UNIMOD:4	ms_run[1]:scan=1.1.2305.11	29.40428	2	1044.522847	1044.527381	R	N	232	242
PSM	AATSPALFNR	5024	sp|Q9JHU4|DYHC1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2322.13	29.87637	2	1046.542847	1046.550893	R	C	3077	3087
PSM	RGPGLYYVDSEGNR	5025	sp|O55234|PSB5_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2278.14	28.66158	3	1581.755471	1581.753569	K	I	166	180
PSM	FESPEVAER	5026	sp|Q9D0E1|HNRPM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2166.18	25.56685	2	1062.496447	1062.498189	K	A	698	707
PSM	MHSVGICGSDVHYWEHGR	5027	sp|Q64442|DHSO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	7-UNIMOD:4	ms_run[1]:scan=1.1.2333.15	30.18748	4	2125.930894	2125.921062	K	I	39	57
PSM	MHSVGICGSDVHYWEHGR	5028	sp|Q64442|DHSO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	7-UNIMOD:4	ms_run[1]:scan=1.1.2342.10	30.4289	4	2125.930894	2125.921062	K	I	39	57
PSM	VEEAYDLAR	5029	sp|O55234|PSB5_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2282.12	28.77173	2	1064.511847	1064.513839	K	R	208	217
PSM	SGKYDLDFK	5030	sp|P17182|ENOA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14		ms_run[1]:scan=1.1.2229.14	27.31658	2	1071.5196	1071.5232	R	S	254	263
PSM	YLAEVATGEK	5031	sp|P61982|1433G_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2167.13	25.59102	2	1079.545847	1079.549890	R	R	133	143
PSM	LRVDPVNFK	5032	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2370.16	31.19353	2	1086.614247	1086.618579	K	L	92	101
PSM	VHIEIGPDGR	5033	sp|O35737|HNRH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2174.20	25.79667	2	1091.562447	1091.572357	R	V	317	327
PSM	IDEMPEAAVK	5034	sp|P51859|HDGF_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2305.14	29.4068	2	1101.534247	1101.537611	R	S	30	40
PSM	FVVQNVSAQK	5035	sp|Q61699|HS105_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2181.19	25.99217	2	1118.604247	1118.608408	R	D	462	472
PSM	EGAVTSVNLTK	5036	sp|Q99JW2|ACY1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2207.10	26.7141	2	1117.594647	1117.597903	K	L	245	256
PSM	SSDEAVILCK	5037	sp|Q9WVJ2|PSD13_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	9-UNIMOD:4	ms_run[1]:scan=1.1.2269.15	28.41322	2	1120.540447	1120.543425	K	T	106	116
PSM	QVEYLVNEK	5038	sp|P05201|AATC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2256.16	28.05695	2	1120.574047	1120.576440	K	H	370	379
PSM	ILSTAQRPLE	5039	sp|Q3TNA1|XYLB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2260.16	28.16553	2	1126.629247	1126.634623	R	-	542	552
PSM	EAIEGTYIDK	5040	sp|P62281|RS11_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2301.15	29.29407	2	1137.551047	1137.555370	K	K	49	59
PSM	ELGLVNHAVAQNEEGNAAYHR	5041	sp|Q3TLP5|ECHD2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2324.16	29.935	4	2291.112494	2291.104306	R	A	207	228
PSM	YLAEVAAGDDK	5042	sp|P63101|1433Z_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2201.20	26.557	2	1150.547047	1150.550619	R	K	128	139
PSM	VPLVAMHHAYVVTER	5043	sp|Q99LB7|SARDH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2366.15	31.08382	3	1720.908971	1720.908296	K	I	287	302
PSM	YKPVCNQVECHPYLNQMK	5044	sp|Q91WR5|AK1CL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	5-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.2276.15	28.60647	4	2307.062494	2307.059864	K	L	184	202
PSM	WCALSHLER	5045	sp|Q921I1|TRFE_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	2-UNIMOD:4	ms_run[1]:scan=1.1.2338.2	30.31553	3	1170.554771	1170.560413	K	T	362	371
PSM	NPADGACLLEK	5046	sp|Q91V76|CK054_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	7-UNIMOD:4	ms_run[1]:scan=1.1.2363.14	31.00218	2	1186.560047	1186.565223	K	Y	134	145
PSM	DNCCILDER	5047	sp|Q8VCM7|FIBG_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	3-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=1.1.2363.15	31.00302	2	1193.483447	1193.480508	R	F	31	40
PSM	DLSSSDLSTASK	5048	sp|Q61838|PZP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2222.19	27.12743	2	1209.569047	1209.572476	R	I	1240	1252
PSM	ALSTDPASPNLK	5049	sp|P26039|TLN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2224.21	27.18455	2	1212.635447	1212.635017	K	S	1321	1333
PSM	AVENSSTAIGIR	5050	sp|O70435|PSA3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2202.20	26.58518	2	1216.638447	1216.641165	K	C	30	42
PSM	FIGPSPEVVRK	5051	sp|Q05920|PYC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2240.7	27.60788	3	1227.693071	1227.697558	R	M	138	149
PSM	FHEICSNLVK	5052	sp|Q9JKW0|AR6P1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	5-UNIMOD:4	ms_run[1]:scan=1.1.2207.5	26.70742	3	1245.612671	1245.617593	R	T	105	115
PSM	YQAVTATLEEK	5053	sp|P19253|RL13A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2326.18	29.99253	2	1251.629447	1251.634683	K	R	149	160
PSM	SKFDNLYGCR	5054	sp|P50247|SAHH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	9-UNIMOD:4	ms_run[1]:scan=1.1.2173.20	25.76807	2	1258.574247	1258.576457	K	E	187	197
PSM	HNNLYLVATSK	5055	sp|P35585|AP1M1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2179.21	25.93897	2	1258.666047	1258.666986	K	K	62	73
PSM	RTIAQDYGVLK	5056	sp|P35700|PRDX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2310.15	29.5454	2	1262.696847	1262.698286	K	A	110	121
PSM	QELSIGTNCDR	5057	sp|Q61847|MEP1B_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	9-UNIMOD:4	ms_run[1]:scan=1.1.2188.21	26.1905	2	1291.584247	1291.582664	K	I	137	148
PSM	ISVYYNEATGGK	5058	sp|P99024|TBB5_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2355.21	30.79277	2	1300.621847	1300.629932	R	Y	47	59
PSM	EGASEEEINLSK	5059	sp|Q8VCC2|EST1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2221.21	27.10113	2	1304.605647	1304.609590	K	M	481	493
PSM	GPATVEELPSEAK	5060	sp|Q9Z2H7|GIPC2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2322.20	29.8822	2	1326.663847	1326.666711	K	A	231	244
PSM	TLIQNCGASTIR	5061	sp|P80318|TCPG_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	6-UNIMOD:4	ms_run[1]:scan=1.1.2265.19	28.30557	2	1332.677447	1332.681984	R	L	450	462
PSM	KFPPDGSAPYGAR	5062	sp|Q9QXD6|F16P1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2335.9	30.23948	3	1361.668571	1361.672800	K	Y	232	245
PSM	GAAQNIIPASTGAAK	5063	tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2276.21	28.61148	2	1368.736047	1368.736128	R	A	199	214
PSM	SEPIPESNEGPVK	5064	sp|P27773|PDIA3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2184.21	26.0769	2	1381.671447	1381.672525	K	V	367	380
PSM	VVAGVAAALAHKYH	5065	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14		ms_run[1]:scan=1.1.2345.5	30.50708	3	1405.7810	1405.7825	K	-	134	148
PSM	VTCVDPNPNFEK	5066	sp|Q9DD20|MET7B_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	3-UNIMOD:4	ms_run[1]:scan=1.1.2314.20	29.6589	2	1418.650247	1418.650015	K	F	94	106
PSM	KGNIYSLNEGYAK	5067	sp|Q9QXD6|F16P1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2199.12	26.49375	3	1455.732971	1455.735794	K	D	206	219
PSM	SLLHCFQCCGAK	5068	sp|O35488|S27A2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	5-UNIMOD:4,8-UNIMOD:4,9-UNIMOD:4	ms_run[1]:scan=1.1.2288.11	28.9334	3	1479.633971	1479.642111	K	V	142	154
PSM	LVNSLYPEGSKPVK	5069	sp|P37804|TAGL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2241.12	27.6392	3	1529.838971	1529.845344	K	V	65	79
PSM	SVTNEDVTQEQLGGAK	5070	sp|Q99MN9|PCCB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2269.21	28.41822	2	1674.806447	1674.806058	K	T	235	251
PSM	VMLGETNPADSKPGTIR	5071	sp|P15532|NDKA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	2-UNIMOD:35	ms_run[1]:scan=1.1.2230.19	27.3484	3	1800.901271	1800.903999	R	G	89	106
PSM	FSTVTGESGSADTVRDPR	5072	sp|P24270|CATA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2195.20	26.38798	3	1880.888771	1880.886434	R	G	113	131
PSM	VAVTGGTHGNEMCGVYLAR	5073	sp|Q91XE4|ACY3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	12-UNIMOD:35,13-UNIMOD:4	ms_run[1]:scan=1.1.2259.19	28.14245	3	2006.933771	2006.930230	R	Y	14	33
PSM	MREIVHIQAGQCGNQIGAK	5074	sp|P99024|TBB5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	12-UNIMOD:4	ms_run[1]:scan=1.1.2243.19	27.69965	3	2109.065471	2109.057162	-	F	1	20
PSM	CIASNQVEALEK	5075	sp|Q6PB66|LPPRC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	1-UNIMOD:4	ms_run[1]:scan=1.1.2383.21	31.55595	2	1360.660647	1360.665666	R	L	929	941
PSM	DDSWLK	5076	sp|P14152|MDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2420.3	32.5679	2	762.347247	762.354819	K	G	215	221
PSM	YDGHLPIEVK	5077	sp|Q99KQ4|NAMPT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2434.2	32.954	3	1169.607071	1169.608074	K	A	108	118
PSM	VIDFAVK	5078	sp|Q9DCW4|ETFB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2476.4	34.09747	2	790.454047	790.458890	R	I	13	20
PSM	THINIVVIGHVDSGK	5079	sp|P10126|EF1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2414.2	32.40313	4	1587.863294	1587.873290	K	S	6	21
PSM	LFLQGPK	5080	sp|Q05920|PYC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2383.4	31.54177	2	801.469247	801.474875	R	I	1037	1044
PSM	IGVTVLSR	5081	tr|A0A1B0GRG8|A0A1B0GRG8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2404.7	32.12807	2	843.510447	843.517802	K	I	199	207
PSM	IGVTVLSR	5082	tr|A0A1B0GRG8|A0A1B0GRG8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2411.7	32.32253	2	843.510447	843.517802	K	I	199	207
PSM	VLSAPPHFHFGQTNR	5083	sp|Q9D8N0|EF1G_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2382.5	31.51457	4	1706.866094	1706.864123	R	T	31	46
PSM	VFEGNRPTNSIVFTK	5084	sp|P06745|G6PI_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2464.9	33.78453	2	1707.892647	1707.894420	K	L	467	482
PSM	IVVNLTGR	5085	sp|P62245|RS15A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2404.9	32.12973	2	870.527047	870.528701	K	L	61	69
PSM	GELLEAIK	5086	sp|P09671|SODM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2533.3	35.68945	2	871.495647	871.501484	K	R	115	123
PSM	GIDLTQVK	5087	sp|Q8BMF4|ODP2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2374.7	31.29585	2	872.488847	872.496733	K	G	364	372
PSM	IAMGAFDR	5088	sp|P45952|ACADM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2419.5	32.54205	2	879.421847	879.427273	K	T	272	280
PSM	IIAVDINK	5089	sp|P00329|ADH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2380.7	31.46058	2	884.527247	884.533118	R	D	220	228
PSM	LYAWNPK	5090	sp|P28271|ACOC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2414.8	32.40815	2	890.460047	890.465038	K	S	633	640
PSM	NGGLYFPK	5091	sp|Q9D964|GATM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2445.6	33.26047	2	894.454047	894.459953	K	D	110	118
PSM	SPAQILIR	5092	sp|Q9DCT1|AKCL2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2483.9	34.29308	2	896.539647	896.544351	K	F	229	237
PSM	VISLSGEHSIIGR	5093	sp|P08228|SODC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2525.9	35.46943	3	1366.752671	1366.756864	R	T	104	117
PSM	IIQLIEGK	5094	sp|Q9Z0S1|BPNT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2544.5	35.99582	2	912.559447	912.564418	K	A	225	233
PSM	IIQLIEGK	5095	sp|Q9Z0S1|BPNT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2538.3	35.82852	2	912.559447	912.564418	K	A	225	233
PSM	VVFQEFR	5096	sp|Q8VDD5|MYH9_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2547.5	36.07845	2	923.480847	923.486502	R	Q	712	719
PSM	LEQLGIPR	5097	sp|Q5FWK3|RHG01_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2488.7	34.43112	2	924.531847	924.539266	K	Q	201	209
PSM	TFTAWCNSHLR	5098	sp|O88990|ACTN3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	6-UNIMOD:4	ms_run[1]:scan=1.1.2396.6	31.90732	3	1391.636171	1391.640454	K	K	49	60
PSM	QWLQEVK	5099	sp|P05202|AATM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2379.8	31.43362	2	929.495647	929.497067	K	G	339	346
PSM	SFTVTELR	5100	sp|Q99KR3|LACB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2527.7	35.52478	2	951.496647	951.502546	K	T	235	243
PSM	SFTVTELR	5101	sp|Q99KR3|LACB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2533.9	35.69447	2	951.496647	951.502546	K	T	235	243
PSM	NDLMEYAK	5102	sp|P16460|ASSY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2386.10	31.63107	2	982.436847	982.442982	R	Q	158	166
PSM	FAQLCEEHGILR	5103	sp|A2BIM8|MUP18_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	5-UNIMOD:4	ms_run[1]:scan=1.1.2482.10	34.26653	3	1471.720271	1471.724183	R	E	153	165
PSM	SEEALALPR	5104	sp|P34914|HYES_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2436.10	33.01545	2	984.522447	984.524010	R	D	26	35
PSM	EIMAEIYK	5105	sp|P10605|CATB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2563.10	36.51982	2	995.492847	995.499769	K	N	238	246
PSM	ILEAVPQVK	5106	sp|Q9DCZ1|GMPR1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2468.4	33.8802	2	995.594247	995.601532	R	F	116	125
PSM	VLTEIIASR	5107	sp|P48036|ANXA5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2565.9	36.57478	2	1000.586447	1000.591696	K	T	107	116
PSM	IAGNMGLAMK	5108	sp|P32020|NLTP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2389.12	31.7162	2	1004.514847	1004.514708	K	L	525	535
PSM	LLDAAGANLR	5109	sp|Q91Z53|GRHPR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2391.15	31.77478	2	1012.562447	1012.566543	K	V	67	77
PSM	GSFYITGDR	5110	sp|Q3UNX5|ACSM3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2387.13	31.66143	2	1014.474647	1014.477060	R	G	448	457
PSM	GSFYITGDR	5111	sp|Q3UNX5|ACSM3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2381.15	31.49505	2	1014.474647	1014.477060	R	G	448	457
PSM	GLQVHVVVDACSSR	5112	sp|P85094|ISC2A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	11-UNIMOD:4	ms_run[1]:scan=1.1.2386.12	31.63273	3	1525.763471	1525.767111	R	S	126	140
PSM	IDQAFALTR	5113	sp|Q9DBE0|CSAD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2566.6	36.60032	2	1033.551647	1033.555644	R	Y	381	390
PSM	VVLIGDSGVGK	5114	sp|P46638|RB11B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2476.12	34.10413	2	1042.597447	1042.602260	K	S	14	25
PSM	VVLIGDSGVGK	5115	sp|P46638|RB11B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2473.7	34.01755	2	1042.597447	1042.602260	K	S	14	25
PSM	MFASFPTTK	5116	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	1-UNIMOD:35	ms_run[1]:scan=1.1.2514.9	35.15752	2	1044.490847	1044.495018	R	T	33	42
PSM	MFASFPTTK	5117	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	1-UNIMOD:35	ms_run[1]:scan=1.1.2508.10	34.98843	2	1044.490847	1044.495018	R	T	33	42
PSM	YIEIYVQK	5118	sp|Q68FD5|CLH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2561.9	36.46303	2	1054.563847	1054.569898	K	V	799	807
PSM	AVENELLDR	5119	sp|P51855|GSHB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2383.14	31.5501	2	1057.537047	1057.540388	R	K	222	231
PSM	VLQLYPSNK	5120	sp|P30416|FKBP4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2428.11	32.79855	2	1060.585047	1060.591696	K	A	379	388
PSM	QGLSSSIFTK	5121	sp|Q9DBF1|AL7A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2553.8	36.24138	2	1066.562047	1066.565875	K	D	453	463
PSM	VITIMQNPR	5122	tr|A0A1Y7VKY1|A0A1Y7VKY1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2385.13	31.60557	2	1070.587047	1070.590650	R	Q	67	76
PSM	GASAINWTLIHGDKK	5123	sp|Q8R0Y6|AL1L1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2418.12	32.52042	3	1609.860371	1609.857640	R	G	115	130
PSM	VTLAVSDLQK	5124	sp|Q9CPV4|GLOD4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2541.13	35.92128	2	1072.608247	1072.612825	K	S	141	151
PSM	AQAVHPGYGFLSENK	5125	sp|Q91ZA3|PCCA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2396.11	31.91148	3	1616.795171	1616.794706	R	E	132	147
PSM	KYEDICPSTHNMDVPNIK	5126	sp|P63242|IF5A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	6-UNIMOD:4	ms_run[1]:scan=1.1.2483.14	34.29725	4	2160.003294	2159.997975	K	R	68	86
PSM	VFSGVVSTGLK	5127	sp|P58252|EF2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2560.8	36.43405	2	1092.614047	1092.617910	R	V	416	427
PSM	LVVNFQCDK	5128	sp|P21981|TGM2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	7-UNIMOD:4	ms_run[1]:scan=1.1.2487.10	34.40532	2	1121.547647	1121.553930	K	L	663	672
PSM	STLTDSLVCK	5129	sp|P58252|EF2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	9-UNIMOD:4	ms_run[1]:scan=1.1.2453.10	33.48177	2	1122.555447	1122.559075	K	A	33	43
PSM	ASYAVSEAIPK	5130	sp|Q6P1B1|XPP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2428.15	32.80188	2	1134.589047	1134.592090	K	D	294	305
PSM	LDHHPEWFNVYNK	5131	sp|P61458|PHS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2537.12	35.80782	3	1697.794571	1697.795040	K	V	60	73
PSM	ASYAVSEAIPK	5132	sp|Q6P1B1|XPP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2422.15	32.63345	2	1134.589047	1134.592090	K	D	294	305
PSM	NQWIDNVEK	5133	sp|Q64727|VINC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2436.15	33.01962	2	1144.550447	1144.551287	K	M	700	709
PSM	LGSTGENFLAR	5134	sp|O09174|AMACR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2499.16	34.74353	2	1163.593447	1163.593487	R	G	37	48
PSM	SCAHDWVYE	5135	sp|Q01768|NDKB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	2-UNIMOD:4	ms_run[1]:scan=1.1.2406.15	32.19058	2	1165.446447	1165.449859	K	-	144	153
PSM	KVEFVSELPK	5136	sp|Q91VA0|ACSM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2429.16	32.83037	2	1174.657047	1174.659775	R	T	545	555
PSM	GLAPEQPVTLR	5137	sp|O55137|ACOT1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2518.16	35.2778	2	1179.657247	1179.661172	R	S	25	36
PSM	ELGSSVALYSR	5138	sp|Q9CQN1|TRAP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2540.16	35.89573	2	1180.606047	1180.608802	R	K	360	371
PSM	EVCFACVDGK	5139	sp|Q68FD5|CLH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	3-UNIMOD:4,6-UNIMOD:4	ms_run[1]:scan=1.1.2413.15	32.38573	2	1183.498847	1183.500180	K	E	1255	1265
PSM	LLEAAITPQTK	5140	sp|Q8VCN5|CGL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2476.17	34.1083	2	1183.679847	1183.681239	K	L	141	152
PSM	VLIEGSINSVR	5141	sp|P59999|ARPC4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2558.15	36.38413	2	1185.666647	1185.671737	K	V	61	72
PSM	MPLFEHYTR	5142	sp|Q9CPY7|AMPL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2434.13	32.96318	2	1192.570447	1192.569914	R	Q	432	441
PSM	SVIVEPEGIEK	5143	sp|Q61838|PZP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2471.10	33.96595	2	1198.641047	1198.644519	K	E	914	925
PSM	GCLLYGPPGTGK	5144	sp|P62334|PRS10_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	2-UNIMOD:4	ms_run[1]:scan=1.1.2517.11	35.24503	2	1218.605647	1218.606694	K	T	169	181
PSM	LFEASVETGDR	5145	sp|Q9CPY7|AMPL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2401.17	32.0534	2	1222.580447	1222.582981	K	V	418	429
PSM	DCEDPNPLIR	5146	sp|O35643|AP1B1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	2-UNIMOD:4	ms_run[1]:scan=1.1.2517.12	35.24586	2	1227.551647	1227.555387	K	A	94	104
PSM	AAPGGASPTIFSR	5147	sp|Q9D0S9|HINT2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2467.15	33.86257	2	1230.634647	1230.635686	K	I	46	59
PSM	WKEDVELYR	5148	sp|Q00623|APOA1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2428.3	32.79187	3	1236.610871	1236.613888	K	Q	131	140
PSM	LNIPVNQVNPR	5149	sp|Q8VDN2|AT1A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2554.20	36.27857	2	1262.705847	1262.709519	R	D	648	659
PSM	CFIVGADNVGSK	5150	sp|P14869|RLA0_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	1-UNIMOD:4	ms_run[1]:scan=1.1.2511.16	35.0773	2	1265.610447	1265.607422	K	Q	27	39
PSM	HNFGPITTDIR	5151	sp|Q9D6Y7|MSRA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2463.14	33.7543	2	1269.645247	1269.646585	K	E	184	195
PSM	AEEVDPNFYSK	5152	sp|Q9DCV4|RMD1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2441.17	33.15988	2	1297.585247	1297.582647	K	N	246	257
PSM	ILYHSSFSVMK	5153	sp|Q3UZZ6|ST1D1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2476.6	34.09913	3	1310.665871	1310.669294	K	E	223	234
PSM	LTPEEEEILNK	5154	sp|P62242|RS8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2560.15	36.4399	2	1313.670047	1313.671462	K	K	129	140
PSM	QVATALQNLQTK	5155	sp|Q64727|VINC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2398.20	31.9736	2	1313.728247	1313.730314	K	T	465	477
PSM	GNIYSLNEGYAK	5156	sp|Q9QXD6|F16P1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2510.19	35.05165	2	1327.639647	1327.640831	K	D	207	219
PSM	DGYTGENSPLYK	5157	sp|O35744|CHIL3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2404.21	32.13975	2	1342.601647	1342.604111	K	S	219	231
PSM	SAAFTVENGSTIR	5158	sp|Q9WVM8|AADAT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2403.20	32.1111	2	1351.676847	1351.673193	K	F	50	63
PSM	TGIGAPTISTGPPGK	5159	sp|O35744|CHIL3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2471.12	33.96763	2	1352.735847	1352.729980	K	Y	279	294
PSM	VISLSGEHSIIGR	5160	sp|P08228|SODC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2538.16	35.83937	2	1366.756047	1366.756864	R	T	104	117
PSM	TAACLAAGNTVVIK	5161	sp|Q8R0Y6|AL1L1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	4-UNIMOD:4	ms_run[1]:scan=1.1.2523.20	35.42253	2	1387.747247	1387.749336	K	P	584	598
PSM	YNPTWHCIVGR	5162	sp|P63168|DYL1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	7-UNIMOD:4	ms_run[1]:scan=1.1.2482.7	34.26403	3	1401.663371	1401.661189	K	N	50	61
PSM	ESVQVPDDQDFR	5163	sp|Q9JMD3|STA10_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2558.20	36.38832	2	1433.645047	1433.642287	R	S	20	32
PSM	YAAVTQFEATDAR	5164	sp|Q11011|PSA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2529.21	35.59328	2	1441.683247	1441.683758	R	R	174	187
PSM	AGAGSATLSMAYAGAR	5165	sp|P08249|MDHM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2555.20	36.30582	2	1453.700847	1453.698362	K	F	242	258
PSM	EQQIVIQSSGGLSK	5166	sp|P38647|GRP75_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2407.21	32.2238	2	1472.782247	1472.783472	R	D	542	556
PSM	LLCEGLQDPQCR	5167	sp|Q91VI7|RINI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	3-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=1.1.2463.19	33.75846	2	1487.682647	1487.686084	K	L	127	139
PSM	FSSQEAASSFGDDR	5168	sp|Q91ZA3|PCCA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2385.21	31.61225	2	1502.629047	1502.627366	R	L	240	254
PSM	LLDEEEATDNDLR	5169	sp|Q9WU78|PDC6I_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2523.21	35.42337	2	1531.695647	1531.700196	R	A	457	470
PSM	VIQQNCWDPEVR	5170	sp|Q8R519|ACMSD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	6-UNIMOD:4	ms_run[1]:scan=1.1.2574.19	36.83652	2	1542.729247	1542.724912	R	I	48	60
PSM	HEDCYILDQGGLK	5171	sp|Q62468|VILI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	4-UNIMOD:4	ms_run[1]:scan=1.1.2504.19	34.88455	2	1546.712247	1546.708593	K	I	282	295
PSM	YSLKPNDQILAEDK	5172	sp|P55264|ADK_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2479.7	34.18242	3	1632.828371	1632.835902	K	H	47	61
PSM	VSQPIEGHAASFAQFK	5173	sp|Q68FD5|CLH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2516.13	35.21817	3	1715.865071	1715.863120	K	M	190	206
PSM	VGVVDEVVPEDQVHSK	5174	sp|P42125|ECI1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2477.13	34.1326	3	1734.880571	1734.878829	K	A	207	223
PSM	ALAAFLK	5175	sp|Q9CZX8|RS19_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2595.2	37.41082	2	732.446247	732.453411	R	K	17	24
PSM	GAIFGGFK	5176	sp|P00329|ADH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2623.2	38.17715	2	795.421447	795.427925	K	S	317	325
PSM	VMVILPK	5177	sp|Q3UNX5|ACSM3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2595.3	37.41165	2	798.496247	798.503732	R	I	117	124
PSM	SFLESLK	5178	sp|Q9CXN7|PBLD2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2631.3	38.3997	2	822.442447	822.448720	R	V	172	179
PSM	IGADFLGR	5179	sp|P05201|AATC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2631.5	38.40137	2	847.451647	847.455202	R	W	115	123
PSM	SGLIFYR	5180	sp|Q9CZN7|GLYM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2683.3	39.85103	2	854.459647	854.465038	R	K	287	294
PSM	VLLPGLQK	5181	sp|P97807|FUMH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2646.4	38.82275	2	866.553247	866.558939	K	L	203	211
PSM	VLLPGLQK	5182	sp|P97807|FUMH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2640.2	38.65103	2	866.553247	866.558939	K	L	203	211
PSM	LIQALALK	5183	sp|Q6PB66|LPPRC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2624.5	38.20687	2	868.570247	868.574589	R	G	1144	1152
PSM	IILLAEGR	5184	sp|P50247|SAHH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2588.5	37.21443	2	883.544247	883.549102	R	L	336	344
PSM	IIGIDINK	5185	sp|P28474|ADHX_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2616.4	37.9927	2	884.528447	884.533118	R	D	219	227
PSM	IIGIDINK	5186	sp|P28474|ADHX_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2608.3	37.7695	2	884.528447	884.533118	R	D	219	227
PSM	LFEMAYK	5187	sp|P38647|GRP75_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2619.4	38.07098	2	901.436647	900.441526	K	K	647	654
PSM	NLLSVAYK	5188	sp|O70456|1433S_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2588.6	37.21527	2	906.511847	906.517468	R	N	42	50
PSM	APAMFNIR	5189	sp|P97351|RS3A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2598.2	37.49425	2	918.468447	918.474557	K	N	35	43
PSM	RFSMVIDNGIVK	5190	sp|P99029|PRDX5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2703.4	40.40468	3	1377.741371	1377.743856	K	A	176	188
PSM	SLMDEVVK	5191	sp|P09411|PGK1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2624.7	38.20853	2	919.466247	919.468469	K	A	354	362
PSM	IEDFLER	5192	sp|Q6ZWN5|RS9_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2589.7	37.24408	2	920.458647	920.460347	K	R	102	109
PSM	RFSMVIDNGIVK	5193	sp|P99029|PRDX5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2690.3	40.04122	3	1377.741371	1377.743856	K	A	176	188
PSM	IVAEEFLK	5194	sp|P59999|ARPC4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2706.5	40.49163	2	947.531647	947.532784	R	N	159	167
PSM	MNVLADALK	5195	sp|P62245|RS15A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2778.6	42.50797	2	973.520447	973.526653	R	S	4	13
PSM	RMEDALDNYVIR	5196	sp|Q91ZA3|PCCA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2743.4	41.53527	3	1493.728871	1493.729663	K	G	461	473
PSM	SVVLMSHLGRPDGVPMPDK	5197	sp|P09411|PGK1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2703.9	40.40885	4	2034.043294	2034.039052	K	Y	57	76
PSM	YIATPIFSK	5198	sp|P10649|GSTM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2720.6	40.89432	2	1038.573647	1038.574983	R	M	203	212
PSM	MFASFPTTK	5199	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	1-UNIMOD:35	ms_run[1]:scan=1.1.2610.7	37.82845	2	1044.490847	1044.495018	R	T	33	42
PSM	NCVILPHIGSATYK	5200	sp|Q91Z53|GRHPR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	2-UNIMOD:4	ms_run[1]:scan=1.1.2602.9	37.60965	3	1571.814071	1571.812999	K	T	287	301
PSM	EAFPAWSSR	5201	sp|Q8BH00|AL8A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2625.7	38.23585	2	1049.488647	1049.493044	R	S	56	65
PSM	LPAVVTADLR	5202	sp|Q9DCW4|ETFB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2738.7	41.3966	2	1053.614247	1053.618245	K	L	177	187
PSM	NPDSLELIR	5203	sp|Q91YI0|ARLY_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2635.9	38.51647	2	1055.556047	1055.561124	K	S	289	298
PSM	RMTGSEFDFEEMK	5204	sp|Q61598|GDIB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2652.8	38.99633	3	1605.682571	1605.680329	K	R	423	436
PSM	GLEISGTFTR	5205	sp|O35643|AP1B1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2650.10	38.94153	2	1079.552247	1079.561124	K	Q	728	738
PSM	QWLQEIDR	5206	sp|P62821|RAB1A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2686.5	39.9367	2	1086.545447	1086.545808	K	Y	104	112
PSM	LLADPTGAFGK	5207	sp|P99029|PRDX5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2743.7	41.53777	2	1088.584847	1088.586610	R	A	145	156
PSM	VNFTVDQIR	5208	sp|P58252|EF2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14		ms_run[1]:scan=1.1.2633.10	38.46148	2	1090.5755	1090.5766	M	A	2	11
PSM	ELAMPGEDLK	5209	sp|Q8BFR5|EFTU_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2600.12	37.55738	2	1101.536447	1101.537611	K	L	396	406
PSM	HWPFMVVNDAGRPK	5210	sp|P63017|HSP7C_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2639.14	38.63251	3	1652.822471	1652.824566	K	V	89	103
PSM	ATPEMVSMLK	5211	sp|Q60759|GCDH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2681.9	39.79937	2	1105.548847	1105.551153	K	R	362	372
PSM	LNYAENLLR	5212	sp|Q9D2R0|AACS_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2744.9	41.56742	2	1104.589847	1104.592758	R	H	99	108
PSM	MLLDGEIEAK	5213	sp|Q99K67|AASS_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2705.8	40.46552	2	1117.566047	1117.568911	K	G	884	894
PSM	ENEVLEAWK	5214	sp|Q62261|SPTB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2700.10	40.32358	2	1116.541047	1116.545139	R	S	1886	1895
PSM	AVITFNQGLR	5215	sp|Q99NB1|ACS2L_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2654.12	39.05548	2	1117.621647	1117.624393	K	G	208	218
PSM	VLLLSQDYGK	5216	sp|Q62261|SPTB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2692.8	40.09955	2	1134.625047	1134.628475	K	H	549	559
PSM	EETFTLSTIK	5217	sp|Q9QZE5|COPG1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2740.18	41.46238	2	1167.603047	1167.602320	K	T	786	796
PSM	RVIISAPSADAPMFVMGVNHEK	5218	tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	13-UNIMOD:35	ms_run[1]:scan=1.1.2757.12	41.92568	4	2384.205294	2384.198072	K	Y	116	138
PSM	WMSEEDFEK	5219	sp|Q9Z2V4|PCKGC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2639.16	38.6342	2	1199.483847	1199.480490	R	A	116	125
PSM	AASDIAMTELPPTHPIR	5220	sp|P62259|1433E_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2704.10	40.43848	3	1818.926771	1818.929819	K	L	154	171
PSM	EVDIGIPDATGR	5221	sp|Q01853|TERA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2770.11	42.28842	2	1241.626647	1241.625181	R	L	366	378
PSM	DYETATLSDIK	5222	sp|P57780|ACTN4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2714.16	40.72962	2	1254.596247	1254.597963	R	A	441	452
PSM	AVFQYIDENQDRYVK	5223	sp|Q9D1A2|CNDP2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2697.15	40.2429	3	1886.919371	1886.916277	K	K	6	21
PSM	TKGDNTISLISIDSGSGVK	5224	sp|Q5U5V2|HYKK_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2738.16	41.40412	3	1890.997271	1890.989836	R	S	104	123
PSM	VQIEHISSLIK	5225	sp|Q8BG32|PSD11_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2597.3	37.46757	3	1265.729771	1265.734337	R	L	345	356
PSM	DYETATLSEIK	5226	sp|Q7TPR4|ACTN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2772.10	42.34363	2	1268.617247	1268.613613	K	A	421	432
PSM	LLVVDPETDER	5227	sp|P70441|NHRF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2613.18	37.92092	2	1284.656847	1284.656146	R	L	88	99
PSM	DFTPAAQAAFQK	5228	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2680.14	39.77497	2	1293.637647	1293.635351	K	V	122	134
PSM	NANSLGGGFHCWTCDVR	5229	sp|Q9D964|GATM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	11-UNIMOD:4,14-UNIMOD:4	ms_run[1]:scan=1.1.2655.17	39.0874	3	1949.831771	1949.826099	R	R	397	414
PSM	SLLPGCQSVISR	5230	sp|Q9DCM0|ETHE1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	6-UNIMOD:4	ms_run[1]:scan=1.1.2683.18	39.86355	2	1315.692447	1315.691821	R	L	93	105
PSM	ASAAFSSVGSVITK	5231	sp|Q62393|TPD52_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2678.20	39.72289	2	1323.708647	1323.703431	K	K	149	163
PSM	ISENMIPVVAEK	5232	sp|Q8VCT4|CES1D_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2781.16	42.6009	2	1328.705847	1328.700988	K	Y	389	401
PSM	AMTGVEQWPYR	5233	sp|P80318|TCPG_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2742.15	41.51635	2	1336.628247	1336.623406	K	A	428	439
PSM	NTNAGAPPGTAYQSPLSLSR	5234	sp|Q60597|ODO1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2758.12	41.95363	3	2001.000071	2000.991568	R	S	82	102
PSM	TVYFAEEVQCEGNSFHK	5235	sp|P97315|CSRP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	10-UNIMOD:4	ms_run[1]:scan=1.1.2717.17	40.81707	3	2043.902171	2043.899641	K	S	16	33
PSM	SGLFVVGPESAGAHPGPACYR	5236	sp|Q8K010|OPLA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	19-UNIMOD:4	ms_run[1]:scan=1.1.2773.19	42.37947	3	2128.027871	2128.016009	R	K	364	385
PSM	SGLFVVGPESAGAHPGPACYR	5237	sp|Q8K010|OPLA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	19-UNIMOD:4	ms_run[1]:scan=1.1.2767.21	42.21333	3	2128.027871	2128.016009	R	K	364	385
PSM	LFIGGLNTETNEK	5238	tr|A0A2I3BRL8|A0A2I3BRL8_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2766.17	42.18207	2	1434.741447	1434.735459	K	A	10	23
PSM	APQVSTPTLVEAAR	5239	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2610.17	37.8368	2	1438.782047	1438.777993	K	N	439	453
PSM	NAQLNIEQDVAPH	5240	sp|Q99KQ4|NAMPT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2647.19	38.86357	2	1447.706247	1447.705556	K	-	479	492
PSM	AGTAFYIDQCAVR	5241	sp|Q8CC88|VWA8_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	10-UNIMOD:4	ms_run[1]:scan=1.1.2721.19	40.93372	2	1470.693847	1470.692549	R	A	152	165
PSM	IFVGGLSPDTPEEK	5242	sp|Q60668|HNRPD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2769.17	42.26558	2	1487.755247	1487.750775	K	I	184	198
PSM	TASNVEEAFINTAK	5243	sp|P53994|RAB2A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2741.20	41.49232	2	1493.734447	1493.736188	K	E	152	166
PSM	VWCTSLHPELVR	5244	sp|Q91WR5|AK1CL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	3-UNIMOD:4	ms_run[1]:scan=1.1.2664.20	39.33512	2	1495.763047	1495.760569	K	A	85	97
PSM	LLVVDPETDEHFK	5245	sp|Q9JHL1|NHRF2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2682.6	39.82525	3	1540.773371	1540.777324	R	R	225	238
PSM	LQCTYIEVEQVGK	5246	sp|Q8VCA8|SCRN2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	3-UNIMOD:4	ms_run[1]:scan=1.1.2696.20	40.21928	2	1565.779247	1565.775944	R	T	57	70
PSM	TPIAAGHPSMNLLLR	5247	sp|Q9D6R2|IDH3A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2777.12	42.48517	3	1589.869871	1589.871182	K	K	101	116
PSM	IQPLPSYEDQNFR	5248	sp|Q5U5V2|HYKK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2770.20	42.29593	2	1605.784247	1605.778721	K	V	37	50
PSM	NQVALNPQNTVFDAK	5249	sp|P17879|HS71B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2745.19	41.60372	2	1657.848847	1657.842384	K	R	57	72
PSM	SQVFSTAADGQTQVEIK	5250	sp|P38647|GRP75_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2638.11	38.60175	3	1807.897271	1807.895208	K	V	469	486
PSM	AIEQADLLQEEDESPR	5251	sp|P61967|AP1S1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2720.21	40.90683	2	1841.874247	1841.864301	K	S	134	150
PSM	LASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEK	5252	tr|A0A5F8MPY2|A0A5F8MPY2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2776.21	42.46498	3	2773.439471	2773.424637	K	K	62	95
PSM	PFDPENTEEAEFHVDK	5253	sp|P22599|A1AT2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2644.16	38.77603	3	1902.827771	1902.827188	K	S	215	231
PSM	TDVLTPAGTTIHGLHALER	5254	sp|Q9DCC4|P5CR3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2726.14	41.07288	3	2001.069671	2001.064339	R	G	232	251
PSM	RAATVMLAAGWTHSSPAGFR	5255	sp|P11930|NUD19_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2711.18	40.64538	3	2086.058471	2086.053062	R	L	9	29
PSM	MVVNEGADGGQSVYHIHLHVLGGR	5256	sp|P70349|HINT1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2685.4	39.90717	5	2544.276618	2544.265575	R	Q	96	120
PSM	TLASAGGPDNLVLLDPGK	5257	sp|Q9QYC0|ADDA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3159.19	53.211	2	1736.946847	1736.930865	R	Y	331	349
PSM	FIIPNIVK	5258	sp|P06151|LDHA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3094.2	51.36535	2	942.587847	942.590239	K	Y	119	127
PSM	FLFPEGIK	5259	sp|Q8K009|AL1L2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3008.2	48.96323	2	949.521247	949.527304	R	A	189	197
PSM	FLIDGFPR	5260	sp|Q9DBP5|KCY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3143.2	52.73588	2	963.513447	963.517802	K	N	89	97
PSM	LVFGLLNGR	5261	sp|P23492|PNPH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3115.3	51.94557	2	987.582247	987.586551	R	C	68	77
PSM	VISSILAFR	5262	sp|Q99JW2|ACY1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3023.2	49.36907	2	1004.597847	1004.601866	K	E	222	231
PSM	WLPELVDR	5263	sp|Q9EQ20|MMSA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2998.4	48.68248	2	1026.544447	1026.549831	K	A	332	340
PSM	VIALGLPVPR	5264	sp|Q8CC88|VWA8_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3086.4	51.13865	2	1033.660647	1033.664801	R	Y	237	247
PSM	GFTIPEAFR	5265	sp|Q9Z1Q5|CLIC1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3053.3	50.2086	2	1036.528647	1036.534181	R	G	196	205
PSM	YLTVAAVFR	5266	sp|P68372|TBB4B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3025.2	49.42365	2	1038.582047	1038.586216	R	G	310	319
PSM	EAEILEVLR	5267	sp|P36552|HEM6_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3090.3	51.2525	2	1070.593447	1070.597175	K	H	428	437
PSM	LQLLEPFDK	5268	sp|Q99KI0|ACON_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3103.4	51.61673	2	1101.602447	1101.607011	R	W	565	574
PSM	MEILEMQLK	5269	sp|Q6IRU2|TPM4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3070.4	50.68305	2	1133.580647	1133.582453	K	E	105	114
PSM	LAVNMVPFPR	5270	sp|A2AQ07|TBB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3067.4	50.59665	2	1142.625647	1142.627035	K	L	253	263
PSM	CVLIFGVPSR	5271	sp|P10518|HEM2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	1-UNIMOD:4	ms_run[1]:scan=1.1.3096.8	51.42675	2	1146.621647	1146.621950	R	V	75	85
PSM	YAFVNWINK	5272	sp|Q61233|PLSL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3088.8	51.19972	2	1153.593047	1153.592030	K	A	124	133
PSM	RTDDIPVWDQEFLK	5273	sp|Q9WTX5|SKP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3140.7	52.65387	3	1760.880371	1760.873350	K	V	81	95
PSM	SPGASLLPVLTK	5274	sp|Q8VC30|TKFC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2997.8	48.658	2	1181.700247	1181.701974	K	A	511	523
PSM	GGIVGMTLPIAR	5275	tr|A2AFQ2|A2AFQ2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3106.4	51.69988	2	1183.676647	1183.674714	K	D	183	195
PSM	GGIVGMTLPIAR	5276	tr|A2AFQ2|A2AFQ2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3113.4	51.89203	2	1183.676647	1183.674714	K	D	183	195
PSM	EQIDIFEGIK	5277	sp|Q9Z2I8|SUCB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3147.9	52.85668	2	1190.618447	1190.618304	K	D	192	202
PSM	EQIDIFEGIK	5278	sp|Q9Z2I8|SUCB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3143.6	52.73922	2	1190.618447	1190.618304	K	D	192	202
PSM	GDFSLCEVLR	5279	sp|Q80W22|THNS2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	6-UNIMOD:4	ms_run[1]:scan=1.1.3156.8	53.11658	2	1194.570447	1194.570309	K	T	298	308
PSM	FELTGIPPAPR	5280	sp|P63017|HSP7C_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2984.8	48.30657	2	1196.649047	1196.655359	K	G	459	470
PSM	VTSLVVDIVPR	5281	sp|Q8R146|APEH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3068.11	50.63122	2	1196.712647	1196.712873	K	Q	340	351
PSM	HQVLFIADEIQTGLAR	5282	sp|P29758|OAT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3160.4	53.22577	3	1809.982571	1809.973733	R	T	256	272
PSM	TLMNLGGLAVAR	5283	sp|Q9WVA4|TAGL2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3072.6	50.74207	2	1214.675847	1214.680527	R	D	128	140
PSM	LVSELWDAGIK	5284	sp|Q61035|HARS1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3080.7	50.96877	2	1229.667247	1229.665589	K	A	427	438
PSM	FLASVSTVLTSK	5285	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3028.10	49.51053	2	1251.708447	1251.707454	K	Y	129	141
PSM	TASAQPVSSVGVLGLGTMGR	5286	sp|Q9DBM2|ECHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3135.10	52.51392	3	1886.993171	1886.988397	K	G	289	309
PSM	LPPSYDLAPFR	5287	sp|Q9D826|SOX_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3021.5	49.33107	2	1274.666047	1274.665923	K	M	368	379
PSM	LEYSDFSIRY	5288	sp|P56375|ACYP2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3137.7	52.56793	2	1291.613447	1291.608468	K	-	97	107
PSM	VHLVGIDIFTGK	5289	sp|P63242|IF5A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3095.12	51.40205	2	1297.739447	1297.739423	K	K	56	68
PSM	FLAVGLVDNTVR	5290	sp|Q921M3|SF3B3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3068.15	50.63455	2	1302.721247	1302.729586	R	I	604	616
PSM	VLTPELYAELR	5291	sp|Q04447|KCRB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3062.13	50.4621	2	1302.721247	1302.718353	K	A	33	44
PSM	YVRPGGGFEPNFTLFEK	5292	sp|P11352|GPX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3128.8	52.31483	3	1956.984971	1956.973398	K	C	96	113
PSM	NLGVSIQLQTLK	5293	sp|Q3UP75|UD3A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3008.11	48.97073	2	1312.768447	1312.771451	K	A	405	417
PSM	LCNPPVNAISPTVITEVR	5294	sp|Q9DBM2|ECHP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	2-UNIMOD:4	ms_run[1]:scan=1.1.3154.13	53.0627	3	1979.060171	1979.050997	R	N	16	34
PSM	LAGQIFLGGSIVR	5295	sp|P17563|SBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3129.12	52.34653	2	1329.779847	1329.776871	R	G	345	358
PSM	YQIPALAQAGFR	5296	sp|P34914|HYES_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3103.9	51.62092	2	1333.716447	1333.714270	R	V	274	286
PSM	QGTIFLAGPPLVK	5297	sp|Q3ULD5|MCCB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3166.8	53.3924	2	1339.788647	1339.786373	K	A	236	249
PSM	VAIVGAGVSGLASIK	5298	sp|P50285|FMO1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2997.12	48.66133	2	1340.796247	1340.802751	R	C	5	20
PSM	QGTIFLAGPPLVK	5299	sp|Q3ULD5|MCCB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3173.11	53.58828	2	1339.788647	1339.786373	K	A	236	249
PSM	GFPTIYFSPANK	5300	sp|P27773|PDIA3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3108.10	51.76042	2	1340.679847	1340.676488	K	K	449	461
PSM	QVFFELNGQLR	5301	sp|Q05920|PYC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3123.15	52.17868	2	1349.709047	1349.709185	R	S	1075	1086
PSM	LEEDVLPEMGIK	5302	sp|P07759|SPA3K_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3075.12	50.83207	2	1371.699847	1371.695568	R	E	323	335
PSM	LNCQVIGASVDSHFCHLAWINTPK	5303	sp|P35700|PRDX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	3-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=1.1.3123.17	52.18035	4	2766.363694	2766.337026	K	K	69	93
PSM	LDNNTELSFFAK	5304	sp|O88844|IDHC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3061.16	50.43688	2	1397.686447	1397.682696	K	A	346	358
PSM	FSASQFWDDCR	5305	sp|O35488|S27A2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	10-UNIMOD:4	ms_run[1]:scan=1.1.3001.16	48.77747	2	1417.573647	1417.572099	K	K	292	303
PSM	SFSTVPYIVGINK	5306	sp|Q8VCT4|CES1D_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3139.14	52.63103	2	1423.769047	1423.771117	K	Q	339	352
PSM	TIVPWDVDTVCK	5307	sp|Q6P3A8|ODBB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	11-UNIMOD:4	ms_run[1]:scan=1.1.3093.14	51.34695	2	1431.712847	1431.706802	R	S	304	316
PSM	DGEAVWFGCDVGK	5308	sp|Q8R016|BLMH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	9-UNIMOD:4	ms_run[1]:scan=1.1.3126.13	52.26208	2	1438.624847	1438.618715	K	H	318	331
PSM	DPNNLLNDWSQK	5309	sp|Q9D8W5|PSD12_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3041.17	49.87915	2	1442.683647	1442.679007	K	L	420	432
PSM	NVGLDIEAEVPAVK	5310	sp|P42932|TCPQ_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3093.15	51.34778	2	1452.781247	1452.782410	K	D	477	491
PSM	DIELVMSQANVSR	5311	sp|P70670|NACAM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2981.15	48.22865	2	1460.731047	1460.729328	K	A	2152	2165
PSM	VVTYGMANLLTGPK	5312	sp|Q62465|VAT1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3130.14	52.37662	2	1462.780247	1462.785387	K	R	295	309
PSM	TGLVFMPGTIQMR	5313	sp|Q8K0L3|ACSM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	6-UNIMOD:35	ms_run[1]:scan=1.1.3072.11	50.74623	2	1465.743647	1465.742142	R	S	129	142
PSM	DGIHNLENIAFPK	5314	sp|Q9R1P3|PSB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3006.3	48.9083	3	1466.745671	1466.751778	K	R	186	199
PSM	TPSSDVLVFDYTK	5315	sp|Q60972|RBBP4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3040.18	49.85133	2	1470.729847	1470.724226	K	H	144	157
PSM	NLANTVTEEILEK	5316	sp|Q7TMK9|HNRPQ_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3176.14	53.6751	2	1472.778447	1472.772239	R	S	344	357
PSM	LSEAVTSESVTDEAITQTMAR	5317	sp|Q80W22|THNS2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3042.13	49.9045	3	2238.073571	2238.068557	K	C	360	381
PSM	VVLDDKDYFLFR	5318	sp|Q64433|CH10_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3167.2	53.41477	3	1528.797071	1528.792580	K	D	81	93
PSM	TIQNLASIQSFQIK	5319	sp|Q91XE0|GLYAT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3161.17	53.26388	2	1589.884447	1589.877707	K	H	114	128
PSM	EAFEEAGVLLLRPR	5320	sp|P11930|NUD19_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3105.4	51.67215	3	1598.880371	1598.878041	R	D	112	126
PSM	FGIQAQMVTTDFQK	5321	sp|Q9R1P1|PSB3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3040.21	49.85383	2	1612.807247	1612.791928	R	I	28	42
PSM	VINEPTAAALAYGLDK	5322	sp|P38647|GRP75_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3076.14	50.86183	2	1644.882247	1644.872287	R	S	219	235
PSM	VDAILCVAGGWAGGNAK	5323	sp|Q8BVI4|DHPR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	6-UNIMOD:4	ms_run[1]:scan=1.1.3182.16	53.84538	2	1657.834847	1657.824626	K	S	77	94
PSM	IINEPTAAAIAYGLDK	5324	sp|P16627|HS71L_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3125.17	52.23698	2	1658.896647	1658.887937	R	G	174	190
PSM	ICDQWDNLGALTQK	5325	sp|Q7TPR4|ACTN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	2-UNIMOD:4	ms_run[1]:scan=1.1.3084.18	51.09265	2	1660.797647	1660.787906	K	R	479	493
PSM	VITAFNDGLNHLDSLK	5326	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3004.8	48.8562	3	1755.927671	1755.915549	K	G	68	84
PSM	VAGHDINYLALSGVLSK	5327	sp|O09174|AMACR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1000663, ProteinPilot, ]	14		ms_run[1]:scan=1.1.3123.6	52.17117	3	1755.95497064349	1755.9519341072703	K	I	118	135
PSM	VYAILTHGIFSGPAISR	5328	tr|G3UXL2|G3UXL2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3140.8	52.6547	3	1800.989771	1800.988654	R	I	244	261
PSM	HQVLFIADEIQTGLAR	5329	sp|P29758|OAT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3167.9	53.42062	3	1809.982571	1809.973733	R	T	256	272
PSM	VSHALAEGLGVIACIGEK	5330	sp|P17751|TPIS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	14-UNIMOD:4	ms_run[1]:scan=1.1.3135.7	52.51142	3	1822.973171	1822.961119	K	L	164	182
PSM	AYHEQLSVAEITNACFEPANQMVK	5331	sp|P05213|TBA1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	15-UNIMOD:4	ms_run[1]:scan=1.1.3125.21	52.24032	3	2749.303571	2749.283987	K	C	281	305
PSM	ESSIYLIGGSIPEEDAGK	5332	sp|Q9JHW2|NIT2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3142.21	52.72307	2	1863.919047	1863.910189	K	L	75	93
PSM	SYQANSLVITAGPWTNR	5333	sp|Q9D826|SOX_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3157.21	53.15663	2	1876.957447	1876.943161	K	L	192	209
PSM	KQGLLPLTFADPSDYNK	5334	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3117.8	52.00442	3	1906.000871	1905.983629	K	I	701	718
PSM	LLPQVMYLDGYDRDNK	5335	sp|O35381|AN32A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3039.11	49.81683	3	1938.954071	1938.950948	K	E	138	154
PSM	EGAAHAFAQYNLDQFTPVK	5336	sp|P47754|CAZA2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3028.17	49.51638	3	2106.016571	2106.017054	R	I	48	67
PSM	DAEVVLCGGTESMSQSPYCVR	5337	sp|Q8BWT1|THIM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	7-UNIMOD:4,19-UNIMOD:4	ms_run[1]:scan=1.1.3042.17	49.90783	3	2344.023071	2344.013368	K	N	110	131
PSM	GGSVQVLEDQELTCQPEPLVVK	5338	sp|P17563|SBP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	14-UNIMOD:4	ms_run[1]:scan=1.1.3184.20	53.90358	3	2424.236171	2424.220641	R	G	358	380
PSM	KLQEGTYVMLAGPNFETVAESR	5339	sp|P23492|PNPH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3125.16	52.23615	3	2439.231671	2439.210411	R	L	186	208
PSM	GELLGCFGLTEPNHGSDPGGMETR	5340	sp|Q60759|GCDH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	6-UNIMOD:4	ms_run[1]:scan=1.1.3026.9	49.46315	3	2530.133471	2530.121672	K	A	171	195
PSM	LLSHCLLVTLASHHPADFTPAVHASLDK	5341	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	5-UNIMOD:4	ms_run[1]:scan=1.1.3049.12	50.10438	5	3049.608618	3049.580761	K	F	101	129
PSM	TLIEFLLR	5342	sp|Q9CPY7|AMPL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3566.3	64.5943	2	1003.603247	1003.606617	R	F	506	514
PSM	TLLELIPELR	5343	sp|Q6PB66|LPPRC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3621.5	66.14668	2	1195.719247	1195.717624	K	D	1304	1314
PSM	DSTLIMQLLR	5344	sp|O70456|1433S_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	6-UNIMOD:35	ms_run[1]:scan=1.1.3472.6	61.9264	2	1204.650047	1204.648559	K	D	215	225
PSM	GGELGLAMASFLK	5345	sp|O55137|ACOT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3496.6	62.60683	2	1292.682447	1292.679859	K	G	234	247
PSM	EFEPLLNWMK	5346	sp|P08113|ENPL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3601.3	65.5679	2	1305.644047	1305.642745	K	D	614	624
PSM	VLLVLELQGLQK	5347	sp|Q8BHN3|GANAB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3489.10	62.4088	2	1351.847647	1351.843888	K	N	85	97
PSM	LLIQSEFPSLLK	5348	sp|P97816|S100G_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3452.8	61.37672	2	1386.818247	1386.812253	K	A	34	46
PSM	ELNDFISYLQR	5349	sp|P27773|PDIA3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3440.7	61.04808	2	1396.701247	1396.698680	R	E	472	483
PSM	HPDEPVLLEEPVVLALAEK	5350	sp|Q9JII6|AK1A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3587.4	65.18165	3	2097.156371	2097.135772	R	H	222	241
PSM	ESVCQAALGLILK	5351	sp|Q99MR8|MCCA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14	4-UNIMOD:4	ms_run[1]:scan=1.1.3539.9	63.82427	2	1400.7721	1400.7692	K	E	502	515
PSM	SVDPTLALSVYLR	5352	sp|Q68FD5|CLH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3538.10	63.79612	2	1432.798247	1432.792580	K	A	469	482
PSM	SVDPTLALSVYLR	5353	sp|Q68FD5|CLH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3526.10	63.45105	2	1432.798247	1432.792580	K	A	469	482
PSM	FSLPSEAFYMIR	5354	sp|Q9QXN5|MIOX_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3581.9	65.02061	2	1459.723447	1459.716973	K	F	207	219
PSM	GLETIASDVVSLASK	5355	sp|Q8BMF4|ODP2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3611.12	65.86293	2	1488.810847	1488.803539	K	A	528	543
PSM	DIVLVAYGVLGTQR	5356	sp|Q91WR5|AK1CL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3596.6	65.4284	2	1502.853047	1502.845679	K	Y	210	224
PSM	LMNESLMLVTALNPHIGYDK	5357	sp|P97807|FUMH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3497.11	62.6401	3	2258.157071	2258.143911	K	A	445	465
PSM	MLAAYLYEVSQLK	5358	sp|Q9D1A2|CNDP2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3477.16	62.07348	2	1527.812847	1527.800702	K	N	462	475
PSM	INFLVNNGGGQFMAPVEDITAK	5359	sp|Q99MZ7|PECR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3604.10	65.65997	3	2334.178571	2334.167818	K	G	101	123
PSM	TGALCWFLDEAAAR	5360	sp|Q9CQ60|6PGL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	5-UNIMOD:4	ms_run[1]:scan=1.1.3596.7	65.42923	2	1579.760447	1579.745313	R	L	232	246
PSM	VVLAYEPVWAIGTGK	5361	sp|P17751|TPIS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3421.19	60.54347	2	1601.891047	1601.881730	K	T	211	226
PSM	TFVSITPAEVGVLVGK	5362	sp|P62962|PROF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3526.16	63.45607	2	1615.930647	1615.918509	K	D	39	55
PSM	AFGENAVVQLISLQK	5363	sp|Q99KC8|VMA5A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3499.16	62.70243	2	1615.898047	1615.893357	K	A	682	697
PSM	DISEASVFDAYVLPK	5364	sp|P62855|RS26_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3626.11	66.29645	2	1652.836247	1652.829754	R	L	52	67
PSM	EPVGQGEALLGMDLLR	5365	sp|Q8VCA8|SCRN2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3552.11	64.2012	2	1696.890047	1696.881806	K	L	104	120
PSM	EPVGQGEALLGMDLLR	5366	sp|Q8VCA8|SCRN2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3558.16	64.3783	2	1696.890047	1696.881806	K	L	104	120
PSM	SDPLLMGIPTSENPFK	5367	sp|Q9DAS9|GBG12_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3524.18	63.40018	2	1744.884647	1744.870573	R	D	49	65
PSM	YCNTWPMAISMLASK	5368	sp|Q64442|DHSO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	2-UNIMOD:4	ms_run[1]:scan=1.1.3562.18	64.4944	2	1771.820247	1771.809569	R	T	300	315
PSM	QGLLPLTFADPSDYNK	5369	sp|Q99KI0|ACON_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3519.15	63.25557	2	1777.901247	1777.888666	K	I	702	718
PSM	SGGGGNFVLSTSLVGYLR	5370	sp|Q9DC50|OCTC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3537.17	63.7733	2	1782.933847	1782.926448	R	V	533	551
PSM	ILPYLAAAYALDHFSK	5371	sp|Q9EPL9|ACOX3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3572.5	64.76475	3	1791.962771	1791.955957	R	T	356	372
PSM	LFIGGLSFETTEESLR	5372	sp|O88569|ROA2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3529.20	63.54568	2	1797.926047	1797.914880	K	N	23	39
PSM	EEFQQFAGLLQAGIEK	5373	sp|P47199|QOR_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3602.17	65.60837	2	1806.927447	1806.915215	K	G	279	295
PSM	DMGMVTILVHNTASALR	5374	sp|P34914|HYES_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3538.2	63.78943	3	1827.940871	1827.933524	R	E	195	212
PSM	VILITPPPLCEAAWEK	5375	sp|Q9DB29|IAH1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	10-UNIMOD:4	ms_run[1]:scan=1.1.3522.20	63.34437	2	1835.997447	1835.985543	R	E	128	144
PSM	YGMNCLIQFEDFANR	5376	sp|P06801|MAOX_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	5-UNIMOD:4	ms_run[1]:scan=1.1.3535.19	63.71755	2	1876.842047	1876.823640	K	N	236	251
PSM	QKLPDGSEIPLPPILLGK	5377	sp|Q9D1A2|CNDP2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3518.7	63.21863	3	1914.128471	1914.119000	K	L	67	85
PSM	ISVGSDADLVIWDPDSVK	5378	sp|O08553|DPYL2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3500.19	62.73393	2	1914.973447	1914.957474	R	T	401	419
PSM	SLPADILYEDQQCLVFR	5379	sp|Q9D0S9|HINT2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	13-UNIMOD:4	ms_run[1]:scan=1.1.3601.6	65.5704	3	2066.025371	2066.014277	R	D	63	80
PSM	INESIGQGDLSELPELHALTAGLK	5380	sp|Q9R0H0|ACOX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3516.18	63.1714	3	2504.331371	2504.312233	R	A	355	379
PSM	LNPNFLVDFGKEPLGPALAHELR	5381	sp|P17563|SBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3494.9	62.55135	4	2546.384094	2546.364544	K	Y	438	461
PSM	AVNACGINCSALLQDDITAAIQCAK	5382	sp|P08905|LYZ2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	5-UNIMOD:4,9-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=1.1.3589.12	65.24268	3	2676.288671	2676.266957	R	R	91	116
PSM	AAHPVPGSLDVCLITEAPLEEVIER	5383	sp|Q9D8I3|GLOD5_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	12-UNIMOD:4	ms_run[1]:scan=1.1.3624.16	66.24506	3	2714.417171	2714.394917	K	L	81	106
PSM	ITFHGEGDQEPGLEPGDIIIVLDQK	5384	sp|P63037|DNJA1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3552.17	64.20621	3	2719.393871	2719.370476	K	D	222	247
PSM	RDPHLACVAYER	5385	sp|Q68FD5|CLH1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	7-UNIMOD:4	ms_run[1]:scan=1.1.2014.17	21.35038	3	1486.716071	1485.714681	K	G	912	924
PSM	ACTELGIR	5386	sp|Q05920|PYC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	2-UNIMOD:4	ms_run[1]:scan=1.1.2112.9	24.03922	2	918.457847	918.459301	R	T	55	63
PSM	INGCAIQCR	5387	sp|Q05920|PYC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	4-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.2021.20	21.5436	2	1090.506847	1090.501183	R	V	369	378
PSM	AWAVAR	5388	sp|P07724|ALBU_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2013.5	21.31287	2	672.364447	672.370744	K	L	237	243
PSM	CCSGSLVER	5389	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14	1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:4	ms_run[1]:scan=1.1.2444.8	33.2345	2	1049.4227	1049.4265	K	R	500	509
PSM	VLETAEDIQER	5390	sp|P16546|SPTN1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2278.20	28.6666	2	1301.645847	1301.646310	K	R	8	19
PSM	VQAVVAVAR	5391	sp|Q62261|SPTB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2105.11	23.8488	2	911.547047	911.555250	R	E	478	487
PSM	GYENGNFVGPTIISNVK	5392	sp|Q9EQ20|MMSA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3128.21	52.32568	2	1808.901247	1807.910464	K	P	392	409
PSM	ISELIR	5393	tr|A9C474|A9C474_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2236.2	27.49562	2	729.432247	729.438489	K	N	198	204
PSM	CEFQDAYVLLSEKK	5394	sp|P63038|CH60_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.3462.11	61.6607	2	1711.8203	1711.8122	K	I	237	251
PSM	HIADLAGNPEVILPVPAFNVINGGSHAGNK	5395	sp|P17182|ENOA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3485.13	62.29835	4	3021.600094	3020.583204	R	L	133	163
PSM	SSYATCVLVSEENTNAIIIEPEKR	5396	sp|Q9QXD6|F16P1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	6-UNIMOD:4	ms_run[1]:scan=1.1.3071.20	50.72503	3	2722.363271	2722.348361	K	G	88	112
PSM	RGILTLK	5397	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2044.5	22.16612	2	799.522047	799.527973	K	Y	62	69
PSM	CDVDIRK	5398	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.2156.11	25.2791	2	887.4127	887.4166	K	D	285	292
PSM	IIAPPERK	5399	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14		ms_run[1]:scan=1.1.1790.16	15.10002	2	922.5539	922.5595	K	Y	329	337
PSM	ALNDHHVYLEGTLLK	5400	sp|Q91Y97|ALDOB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2583.20	37.08847	2	1721.915647	1721.910070	K	P	216	231
PSM	QHGIPIPVTPK	5401	sp|P16460|ASSY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14	1-UNIMOD:28	ms_run[1]:scan=1.1.2715.11	40.75433	2	1168.6605	1168.6599	K	S	166	177
PSM	NQAPPGLYTK	5402	sp|P16460|ASSY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14		ms_run[1]:scan=1.1.2088.18	23.3872	2	1087.5617	1087.5657	K	T	200	210
PSM	EIRPALELLEPIEQK	5403	sp|Q61598|GDIB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3182.4	53.83537	3	1777.003271	1776.998551	K	F	365	380
PSM	DLGTDSQIFISR	5404	sp|Q61598|GDIB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3040.16	49.84967	2	1351.684447	1350.677945	K	A	391	403
PSM	QLLQEEVGPVGVETMR	5405	sp|Q7TNG8|LDHD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14	1-UNIMOD:28	ms_run[1]:scan=1.1.3598.10	65.49358	2	1766.8722	1766.8872	R	Q	451	467
PSM	GDYPLEAVR	5406	sp|P52480|KPYM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14		ms_run[1]:scan=1.1.2470.5	33.93652	2	1018.5021	1018.5078	K	M	368	377
PSM	SDKLPYK	5407	sp|P50247|SAHH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14	1-UNIMOD:1	ms_run[1]:scan=1.1.2137.12	24.73975	2	891.4630	891.4697	M	V	2	9
PSM	RTIQFVDWCPTGFK	5408	sp|P05214|TBA3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	9-UNIMOD:4	ms_run[1]:scan=1.1.3064.7	50.51327	3	1753.863371	1753.861011	K	V	339	353
PSM	INVLPLGSGAIAGNPLGVDR	5409	sp|Q91YI0|ARLY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3480.9	62.15298	3	1932.089171	1932.079260	R	E	194	214
PSM	YFDSFGDLSSASAIMGNAK	5410	tr|A8DUK4|A8DUK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3552.19	64.20955	2	1980.894847	1979.893493	R	V	42	61
PSM	QWLQEVK	5411	sp|P05202|AATM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14	1-UNIMOD:28	ms_run[1]:scan=1.1.3118.2	52.02702	2	912.4673	912.4700	K	G	339	346
PSM	GAPTTSLVSVAVTK	5412	sp|Q9DBF1|AL7A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14		ms_run[1]:scan=1.1.2656.16	39.11425	2	1329.7488	1329.7499	K	I	219	233
PSM	QKPEFLK	5413	sp|P10649|GSTM1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14	1-UNIMOD:28	ms_run[1]:scan=1.1.2324.10	29.92998	2	871.4753	871.4798	K	T	123	130
PSM	DLQILAEFHEK	5414	sp|P07759|SPA3K_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3036.14	49.73418	2	1340.678047	1341.692866	K	T	145	156
PSM	AVLDVAETGTEAAAATGVIGGIR	5415	sp|P07759|SPA3K_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3430.4	60.78215	3	2141.142071	2141.132812	K	K	361	384
PSM	SSLPGSREPLLR	5416	sp|Q91XE4|ACY3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14	1-UNIMOD:1	ms_run[1]:scan=1.1.2667.8	39.41187	2	1352.7411	1352.7407	M	V	2	14
PSM	SEVTFTTPAVYIYTSGTTGLPK	5417	sp|O35488|S27A2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3527.11	63.48067	3	2332.203071	2332.183845	R	A	212	234
PSM	SPGASLLPVLTK	5418	sp|Q8VC30|TKFC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14		ms_run[1]:scan=1.1.3007.9	48.94117	2	1181.6998	1181.7015	K	A	511	523
PSM	CELLSDESLAVCSPR	5419	sp|Q8R146|APEH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14	1-UNIMOD:385,1-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.3541.17	63.88857	2	1717.7752	1717.7642	K	L	292	307
PSM	QGLEYYHALK	5420	sp|Q8R146|APEH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14	1-UNIMOD:28	ms_run[1]:scan=1.1.2721.8	40.92453	2	1203.5903	1203.5919	K	A	682	692
PSM	CAVVDVPFGGAK	5421	sp|P26443|DHE3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.3413.6	60.30203	2	1201.5787	1201.5796	K	A	172	184
PSM	KIEPELEGSSAVTSHDSSTNGLISFIK	5422	sp|P06745|G6PI_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3078.14	50.91812	4	2846.441294	2845.434533	K	Q	524	551
PSM	DNLTLWTSDMQGDGEEQNK	5423	sp|P62259|1433E_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3174.15	53.61948	3	2179.944071	2179.932792	R	E	226	245
PSM	ALDEYYDK	5424	sp|P50516|VATA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2218.13	27.01122	2	1015.443647	1015.449842	R	H	460	468
PSM	GPILMELQTYR	5425	sp|P35486|ODPA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3087.12	51.17433	2	1320.686647	1319.690758	K	Y	278	289
PSM	GIVVLNTSLKEER	5426	sp|Q91WR5|AK1CL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2484.8	34.31997	3	1456.820171	1456.824943	R	I	264	277
PSM	CLHSVGCPLPLK	5427	sp|Q9Z2V4|PCKGC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14	1-UNIMOD:385,1-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=1.1.2991.12	48.49837	2	1363.6762	1362.6782	K	K	192	204
PSM	FDAQGNLR	5428	sp|Q9Z2V4|PCKGC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2045.13	22.20053	2	920.448447	919.451179	K	A	317	325
PSM	AINPENGFFGVAPGTSVK	5429	sp|Q9Z2V4|PCKGC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3125.20	52.23948	2	1804.909447	1803.915549	R	T	325	343
PSM	LSLQGDTK	5430	sp|Q91WU0|CES1F_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1951.14	19.58805	2	860.454447	860.460347	K	N	305	313
PSM	NGGLYFPK	5431	sp|Q9D964|GATM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2438.8	33.06944	2	894.454047	894.459953	K	D	110	118
PSM	NHYQAEVFSVNFAESEEAKK	5432	sp|P07758|A1AT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14		ms_run[1]:scan=1.1.2646.15	38.83192	4	2326.0932	2326.0861	K	V	154	174
PSM	NKFPGDSVVTGR	5433	sp|Q99MN9|PCCB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2152.11	25.16497	3	1275.648071	1275.657149	K	G	102	114
PSM	QNSLDEDLIRK	5434	sp|Q02053|UBA1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14	1-UNIMOD:28	ms_run[1]:scan=1.1.2645.19	38.80687	2	1312.6638	1312.6618	K	L	375	386
PSM	QVEAELLPCLR	5435	sp|Q8CG76|ARK72_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14	9-UNIMOD:4	ms_run[1]:scan=1.1.3012.7	49.08695	2	1327.6932	1326.6962	R	H	214	225
PSM	YWETVQR	5436	sp|Q99NB1|ACS2L_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2196.10	26.40762	2	980.462647	980.471580	R	L	365	372
PSM	LGPALATGNVVVMK	5437	sp|P47738|ALDH2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	13-UNIMOD:35	ms_run[1]:scan=1.1.2651.19	38.97735	2	1385.775047	1384.774822	K	V	198	212
PSM	MEIQEIQLK	5438	sp|P58771|TPM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2754.6	41.83812	2	1130.594647	1130.600546	K	E	141	150
PSM	AELAESR	5439	tr|D3Z2H9|D3Z2H9_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1686.9	12.20953	2	774.387447	774.387182	R	C	147	154
PSM	QGIDHEYLSSVDLK	5440	sp|Q9D826|SOX_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14	1-UNIMOD:28	ms_run[1]:scan=1.1.3005.16	48.89115	2	1585.7645	1585.7619	R	Q	113	127
PSM	KGESVMVVPTLSEEEAK	5441	sp|O08709|PRDX6_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2642.13	38.71705	3	1833.920771	1831.923731	K	Q	183	200
PSM	QLLDLELQSQGESR	5442	sp|Q9DBE0|CSAD_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14	1-UNIMOD:28	ms_run[1]:scan=1.1.3620.10	66.12282	2	1597.8042	1597.7942	K	E	54	68
PSM	ASYILMEK	5443	sp|P51855|GSHB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2441.8	33.15237	2	953.483247	953.489204	R	I	393	401
PSM	IVEVLK	5444	sp|P15247|IL9_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2144.2	24.93057	2	699.447247	699.453077	R	N	95	101
PSM	IILDLISESPIK	5445	sp|P61979|HNRPK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3488.7	62.37802	2	1340.798647	1339.796269	K	G	208	220
PSM	CGVIGEIGCSWPLTDSERK	5446	sp|Q60866|PTER_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14	1-UNIMOD:385,1-UNIMOD:4,9-UNIMOD:4	ms_run[1]:scan=1.1.3568.9	64.65545	3	2146.0012	2145.9822	K	I	164	183
PSM	ALQLEEER	5447	sp|P26040|EZRI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2135.14	24.6843	2	986.497247	986.503275	K	R	372	380
PSM	CDVRDPDMVHNTVLELIK	5448	sp|Q9CQ62|DECR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.3464.8	61.70913	3	2136.0522	2136.0342	R	V	116	134
PSM	ALELEQER	5449	sp|P26041|MOES_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2128.12	24.48715	2	986.497247	986.503275	R	K	372	380
PSM	IGNCPFSQR	5450	sp|Q9Z1Q5|CLIC1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	4-UNIMOD:4	ms_run[1]:scan=1.1.2108.14	23.93368	2	1077.499447	1077.502563	K	L	21	30
PSM	LHIVQVVCK	5451	sp|Q9Z1Q5|CLIC1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	8-UNIMOD:4	ms_run[1]:scan=1.1.2196.3	26.40177	3	1094.619071	1094.627036	K	K	184	193
PSM	ANQVIR	5452	sp|P28474|ADHX_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14	1-UNIMOD:1	ms_run[1]:scan=1.1.2240.4	27.60538	2	741.4081	741.4128	M	C	2	8
PSM	NVGLDIEAEVPAVK	5453	sp|P42932|TCPQ_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3095.14	51.40373	2	1453.786447	1452.782410	K	D	477	491
PSM	FVLSSGK	5454	sp|P14211|CALR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2057.3	22.51713	2	736.405447	736.411940	K	F	49	56
PSM	ETSKDPELR	5455	sp|Q64105|SPRE_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1676.18	11.93602	2	1073.531247	1073.535303	R	S	212	221
PSM	AYAEGMNR	5456	sp|Q9CZU6|CISY_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1789.18	15.07433	2	910.391247	910.396701	R	A	184	192
PSM	AAADEPKPK	5457	sp|P55264|ADK_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14	1-UNIMOD:1	ms_run[1]:scan=1.1.1749.18	13.95315	2	967.4919	967.4969	M	K	2	11
PSM	TGCTFPEKPDFH	5458	sp|P55264|ADK_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	3-UNIMOD:4	ms_run[1]:scan=1.1.2380.12	31.46477	3	1434.618971	1434.623801	R	-	350	362
PSM	PSYAFGSVGK	5459	sp|P30416|FKBP4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2366.12	31.08132	2	1010.499847	1011.502546	K	E	223	233
PSM	FMAGQVSFGPWYDHVK	5460	sp|Q3UZZ6|ST1D1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3107.8	51.73098	3	1866.880571	1867.871576	K	S	162	178
PSM	TANSLLWK	5461	sp|Q8VCT4|CES1D_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2500.6	34.76265	2	931.510047	931.512717	K	S	375	383
PSM	IRVDILENQAMDTR	5462	sp|P15626|GSTM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2770.9	42.28675	3	1672.859171	1672.856654	R	I	95	109
PSM	CLAFHDISPQAPTHFLVIPK	5463	sp|P70349|HINT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.3556.8	64.31382	3	2274.1832	2273.1662	R	K	38	58
PSM	ASGNAQIGK	5464	sp|Q61171|PRDX2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14	1-UNIMOD:1	ms_run[1]:scan=1.1.1923.11	18.80648	2	886.4469	886.4503	M	S	2	11
PSM	SYPYPALTPEQK	5465	tr|A6ZI47|A6ZI47_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14	1-UNIMOD:1	ms_run[1]:scan=1.1.2303.11	29.3475	3	1434.6980	1434.7026	M	K	2	14
PSM	RLAEDGAHVVVSSR	5466	sp|Q99LB2|DHRS4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1942.13	19.3377	3	1494.790871	1494.790289	R	K	52	66
PSM	AVPEGSVIPR	5467	sp|Q99KQ4|NAMPT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14		ms_run[1]:scan=1.1.2284.11	28.8273	2	1024.5862	1023.5712	K	G	118	128
PSM	DVQIGDIVTVGECRPLSK	5468	sp|P62281|RS11_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	13-UNIMOD:4	ms_run[1]:scan=1.1.3071.11	50.71752	3	1984.011671	1985.025176	R	T	119	137
PSM	CRNPEWGLR	5469	sp|Q9DCS2|MTL26_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.2539.18	35.86938	2	1169.5367	1169.5395	R	D	162	171
PSM	KLTPITYPQGLAMAK	5470	sp|P63001|RAC1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2737.9	41.3703	3	1630.917371	1630.911650	K	E	133	148
PSM	SDAAVDTSSEITTK	5471	sp|P26350|PTMA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14	1-UNIMOD:1	ms_run[1]:scan=1.1.2553.20	36.2514	2	1465.6784	1465.6779	M	D	2	16
PSM	LMHTHQTVDFVSR	5472	sp|Q9QXN5|MIOX_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14		ms_run[1]:scan=1.1.2094.6	23.54277	4	1569.7728	1569.7717	K	K	46	59
PSM	IQTFQGDSDHNWK	5473	sp|P28825|MEP1A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2213.16	26.8822	2	1575.717047	1574.711370	K	I	376	389
PSM	SQAEFDK	5474	sp|P31786|ACBP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14	1-UNIMOD:1	ms_run[1]:scan=1.1.2151.10	25.1356	2	865.3769	865.3812	M	A	2	9
PSM	VDELKK	5475	sp|P31786|ACBP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1588.3	9.4971	2	730.415447	730.422505	K	K	78	84
PSM	YIEACAR	5476	sp|O70475|UGDH_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	5-UNIMOD:4	ms_run[1]:scan=1.1.1815.16	15.8011	2	881.401847	881.406538	K	R	108	115
PSM	HCLTGGEALNPDVR	5477	sp|Q8BGA8|ACSM5_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	2-UNIMOD:4	ms_run[1]:scan=1.1.2223.15	27.15195	3	1539.750971	1537.730725	R	D	341	355
PSM	ETSNLYK	5478	sp|O55125|NIPS1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1766.13	14.4266	2	853.412047	853.418148	K	I	67	74
PSM	AHSNHTDIISFR	5479	sp|Q3UEG6|AGT2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2081.15	23.18977	3	1396.680971	1396.684761	R	G	182	194
PSM	LTLLEVGCGTGANFK	5480	tr|G3X9G9|G3X9G9_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	8-UNIMOD:4	ms_run[1]:scan=1.1.3098.15	51.48788	2	1578.806647	1578.807579	K	F	72	87
PSM	ADGYVLEGK	5481	sp|P62242|RS8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2138.13	24.76917	2	951.468047	950.470912	R	E	185	194
PSM	LCDFNPK	5482	sp|O08585|CLCA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	2-UNIMOD:4	ms_run[1]:scan=1.1.2071.11	22.91135	2	892.403847	892.411289	R	S	204	211
PSM	YHLGNDVILFTTDGASEK	5483	sp|P23780|BGAL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2999.9	48.71482	3	1979.973971	1978.963622	R	M	210	228
PSM	IEVIEIMTDR	5484	sp|P49312|ROA1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.3109.11	51.78912	2	1217.635647	1217.632574	K	G	131	141
PSM	AEAGEGQKPSPAQLELR	5485	sp|Q8K183|PDXK_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14		ms_run[1]:scan=1.1.2257.18	28.08578	3	1780.9122	1779.9112	K	M	276	293
PSM	SAHLQWMVVR	5486	sp|P41105|RL28_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14	1-UNIMOD:1	ms_run[1]:scan=1.1.3040.15	49.84883	2	1267.6511	1267.6490	M	N	2	12
PSM	CGESGHLAK	5487	sp|P53996|CNBP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1790.17	15.10085	2	940.4061	940.4067	R	D	57	66
PSM	TTGIVETHFTFK	5488	sp|B2RSH2|GNAI1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2589.7	37.24408	3	1379.700071	1379.708516	K	D	181	193
PSM	AIHSWLTR	5489	sp|P99026|PSB4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14		ms_run[1]:scan=1.1.2183.4	26.03483	3	982.5268	982.5343	R	A	132	140
PSM	SHTILLVQPTK	5490	sp|P84089|ERH_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14	1-UNIMOD:1	ms_run[1]:scan=1.1.2701.14	40.35553	2	1277.7339	1277.7338	M	R	2	13
PSM	KTLPHR	5491	tr|A0A140LHQ9|A0A140LHQ9_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14	1-UNIMOD:1	ms_run[1]:scan=1.1.1713.6	12.95823	2	792.4533	792.4601	M	S	2	8
PSM	EETPKAEVMR	5492	tr|A0A2I3BQA5|A0A2I3BQA5_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14	9-UNIMOD:35	ms_run[1]:scan=1.1.2189.19	26.21732	2	1204.5750	1204.5753	K	A	871	881
PSM	YPHVPPHPADQK	5493	sp|Q9Z1T6|FYV1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14		ms_run[1]:scan=1.1.2195.12	26.3813	3	1385.7062	1384.6882	K	E	534	546
PSM	MQGPGGNVSRGLPSGPASTVASGAGR	5494	sp|Q3UF25|STIMA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=1.1.2999.16	48.72066	3	2427.2132	2425.1762	-	C	1	27
PSM	QVEQLEK	5495	sp|P23116|EIF3A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1760.9	14.25493	2	872.454647	872.460347	K	E	673	680
PSM	DRGEWESLTPEAR	5496	sp|E9Q735|UBE4A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14		ms_run[1]:scan=1.1.2113.16	24.07282	3	1546.7362	1544.7212	K	R	779	792
PSM	YQLAGR	5497	tr|E9PZ36|E9PZ36_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1830.10	16.22013	2	706.369647	706.376223	R	N	3998	4004
PSM	ADEELEALRK	5498	sp|P56812|PDCD5_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14	1-UNIMOD:1	ms_run[1]:scan=1.1.2678.16	39.71953	2	1214.6226	1214.6138	M	Q	2	12
PSM	KEGIEWEFIDFGMDLAACIELIEK	5499	tr|B1AR69|B1AR69_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14	13-UNIMOD:35,18-UNIMOD:4	ms_run[1]:scan=1.1.2642.11	38.71538	5	2871.3726	2871.3705	K	P	505	529
PSM	KDLENEIK	5500	sp|Q0II04|NEBL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1859.16	17.03398	2	987.523847	987.523676	K	G	379	387
PSM	KIIADIK	5501	sp|Q9DB34|CHM2A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14		ms_run[1]:scan=1.1.2058.8	22.54855	2	799.5215	799.5162	K	K	42	49
PSM	TLMGPTRVFR	5502	sp|O88425|NDK6_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14	3-UNIMOD:35	ms_run[1]:scan=1.1.2689.4	40.01765	2	1193.6382	1192.6382	R	A	97	107
PSM	GEGGSPGPIRSPGQIR	5503	sp|Q80ST9|LCA5_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14		ms_run[1]:scan=1.1.2669.9	39.46143	3	1563.8056	1563.8112	R	S	533	549
PSM	AVQSLDK	5504	sp|Q9CPW4|ARPC5_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1696.12	12.49418	2	759.405247	759.412669	K	N	94	101
PSM	EPHLPPK	5505	sp|Q6P1Y1|RTL3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1624.11	10.50017	2	819.454647	816.449388	K	S	138	145
PSM	KDLVSSR	5506	sp|Q8VIG6|TRAIP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1667.13	11.68557	2	802.447847	803.450117	K	S	227	234
PSM	WNTEDK	5507	sp|P09411|PGK1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1720.14	13.15082	2	793.346647	791.344983	K	V	383	389
PSM	QEVISTSSK	5508	sp|P68040|RACK1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1768.16	14.48512	2	976.502047	977.502940	K	A	272	281
PSM	VCLLHEK	5509	sp|P07724|ALBU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	2-UNIMOD:4	ms_run[1]:scan=1.1.1845.2	16.63357	3	899.474771	897.474223	R	T	484	491
PSM	NLGIGK	5510	sp|P08249|MDHM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1853.2	16.8558	2	601.366847	600.359511	K	I	302	308
PSM	ALAPEYAK	5511	sp|P09103|PDIA1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.1979.11	20.36598	2	860.454447	861.459619	K	A	60	68
PSM	SCEEFMK	5512	sp|P12658|CALB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	2-UNIMOD:4	ms_run[1]:scan=1.1.2004.15	21.0672	2	930.356647	929.362290	K	T	99	106
PSM	RGLCGTVLIHK	5513	sp|Q8VC30|TKFC_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	4-UNIMOD:4	ms_run[1]:scan=1.1.2015.9	21.37113	3	1253.703371	1252.707411	R	V	152	163
PSM	ELGTVMR	5514	sp|P0DP26|CALM1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2068.8	22.82643	2	805.412047	804.416374	K	S	32	39
PSM	LSAAVEVGDASEVK	5515	sp|Q9WVF7|DPOE1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2108.11	23.93118	3	1376.701271	1373.703825	K	R	779	793
PSM	GSSSRSTFHGEQLR	5516	sp|Q8VHJ5|MARK1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2114.21	24.10488	2	1546.739247	1547.744067	R	E	607	621
PSM	IAELEEER	5517	sp|P14873|MAP1B_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2128.12	24.48715	2	987.496447	987.487290	K	S	328	336
PSM	SLEAEGFR	5518	sp|Q9Z1J3|NFS1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2206.5	26.68635	2	908.442447	907.439946	R	V	167	175
PSM	LGGNLIGHK	5519	sp|Q9DAI4|ZBT43_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2229.10	27.31325	2	907.518047	907.523950	K	Q	330	339
PSM	IIAEGANGPTTPEADK	5520	sp|P26443|DHE3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2242.20	27.67317	2	1583.771647	1582.783866	K	I	400	416
PSM	VIGSELVQK	5521	sp|P46471|PRS7_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2251.13	27.91685	2	971.561047	971.565147	R	Y	240	249
PSM	DSLLAAWK	5522	tr|Q6NZL1|Q6NZL1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2307.7	29.45732	2	903.496647	902.486168	R	K	1111	1119
PSM	TVDLSGSR	5523	sp|Q8CDM4|CCD73_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2403.3	32.09692	2	832.428447	833.424296	K	V	919	927
PSM	TINKQIR	5524	sp|Q3ZT31|SNX25_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2407.9	32.21378	2	870.527047	871.523950	R	D	717	724
PSM	YGVSGYPTLK	5525	sp|P27773|PDIA3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2514.10	35.15837	2	1082.565447	1083.560061	K	I	95	105
PSM	TEAITQDNGGSHFSWAK	5526	sp|Q7TNG8|LDHD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2560.12	36.4374	3	1848.830471	1847.843841	R	E	319	336
PSM	LIASVADDEAAVPNNK	5527	sp|P16125|LDHB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2628.19	38.32915	2	1626.814647	1625.826065	K	I	8	24
PSM	FVMQEEFSR	5528	sp|P27773|PDIA3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2641.14	38.68953	2	1172.528847	1171.533194	K	D	336	345
PSM	VLQALEGLK	5529	sp|Q9CZX8|RS19_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2649.8	38.91132	2	970.579847	969.585882	R	M	103	112
PSM	GAVEIIFK	5530	sp|Q99MN9|PCCB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1.1.2757.2	41.91733	2	876.510047	875.511654	K	G	469	477
PSM	EILQSVYECIEK	5531	sp|Q64516|GLPK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14	9-UNIMOD:4	ms_run[1]:scan=1.1.3131.17	52.40753	2	1509.745647	1509.738496	K	T	59	71